data_6FO8 # _entry.id 6FO8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6FO8 pdb_00006fo8 10.2210/pdb6fo8/pdb WWPDB D_1200008658 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-16 2 'Structure model' 1 1 2018-06-27 3 'Structure model' 1 2 2021-02-24 4 'Structure model' 1 3 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' Advisory 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_assembly_gen 4 3 'Structure model' pdbx_struct_assembly_prop 5 3 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 9 4 'Structure model' pdbx_initial_refinement_model 10 4 'Structure model' pdbx_unobs_or_zero_occ_atoms # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_pdbx_struct_assembly.oligomeric_count' 5 3 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 6 3 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 7 3 'Structure model' '_pdbx_struct_assembly_prop.value' 8 4 'Structure model' '_database_2.pdbx_DOI' 9 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6FO8 _pdbx_database_status.recvd_initial_deposition_date 2018-02-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Rochel, N.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Med. Chem.' _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 1520-4804 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 61 _citation.language ? _citation.page_first 4928 _citation.page_last 4937 _citation.title 'Aromatic-Based Design of Highly Active and Noncalcemic Vitamin D Receptor Agonists.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.8b00337 _citation.pdbx_database_id_PubMed 29733645 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gogoi, P.' 1 ? primary 'Seoane, S.' 2 ? primary 'Sigueiro, R.' 3 ? primary 'Guiberteau, T.' 4 ? primary 'Maestro, M.A.' 5 ? primary 'Perez-Fernandez, R.' 6 ? primary 'Rochel, N.' 7 ? primary 'Mourino, A.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Vitamin D3 receptor A' 33916.543 1 ? ? ? ;HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVREGPVTRSASRAASLHSLSDASSDSFNHSPESVDTKLNFSNLLM MYQDSGSPDSSEEDQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMS WSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQA YIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS ; 2 polymer syn 'Nuclear receptor coactivator 1' 1776.072 1 ? ? ? ? 3 non-polymer syn '(1~{R},3~{S},5~{Z})-4-methylidene-5-[(~{E})-3-[3-(6-methyl-6-oxidanyl-heptyl)phenyl]non-2-enylidene]cyclohexane-1,3-diol' 454.684 1 ? ? ? ? 4 water nat water 18.015 57 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'VDR-A,1,25-dihydroxyvitamin D3 receptor A,Nuclear receptor subfamily 1 group I member 1-A' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVREGPVTRSASRAASLHSLSDASSDSFNHSPESVDTKLNFSNLLM MYQDSGSPDSSEEDQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMS WSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQA YIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS ; ;HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVREGPVTRSASRAASLHSLSDASSDSFNHSPESVDTKLNFSNLLM MYQDSGSPDSSEEDQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMS WSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQA YIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS ; 1 ? 2 'polypeptide(L)' no no RHKILHRLLQEGSPS RHKILHRLLQEGSPS B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 '(1~{R},3~{S},5~{Z})-4-methylidene-5-[(~{E})-3-[3-(6-methyl-6-oxidanyl-heptyl)phenyl]non-2-enylidene]cyclohexane-1,3-diol' DZT 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 MET n 1 3 LEU n 1 4 SER n 1 5 ASP n 1 6 GLU n 1 7 GLN n 1 8 MET n 1 9 GLN n 1 10 ILE n 1 11 ILE n 1 12 ASN n 1 13 SER n 1 14 LEU n 1 15 VAL n 1 16 GLU n 1 17 ALA n 1 18 HIS n 1 19 HIS n 1 20 LYS n 1 21 THR n 1 22 TYR n 1 23 ASP n 1 24 ASP n 1 25 SER n 1 26 TYR n 1 27 SER n 1 28 ASP n 1 29 PHE n 1 30 VAL n 1 31 ARG n 1 32 PHE n 1 33 ARG n 1 34 PRO n 1 35 PRO n 1 36 VAL n 1 37 ARG n 1 38 GLU n 1 39 GLY n 1 40 PRO n 1 41 VAL n 1 42 THR n 1 43 ARG n 1 44 SER n 1 45 ALA n 1 46 SER n 1 47 ARG n 1 48 ALA n 1 49 ALA n 1 50 SER n 1 51 LEU n 1 52 HIS n 1 53 SER n 1 54 LEU n 1 55 SER n 1 56 ASP n 1 57 ALA n 1 58 SER n 1 59 SER n 1 60 ASP n 1 61 SER n 1 62 PHE n 1 63 ASN n 1 64 HIS n 1 65 SER n 1 66 PRO n 1 67 GLU n 1 68 SER n 1 69 VAL n 1 70 ASP n 1 71 THR n 1 72 LYS n 1 73 LEU n 1 74 ASN n 1 75 PHE n 1 76 SER n 1 77 ASN n 1 78 LEU n 1 79 LEU n 1 80 MET n 1 81 MET n 1 82 TYR n 1 83 GLN n 1 84 ASP n 1 85 SER n 1 86 GLY n 1 87 SER n 1 88 PRO n 1 89 ASP n 1 90 SER n 1 91 SER n 1 92 GLU n 1 93 GLU n 1 94 ASP n 1 95 GLN n 1 96 GLN n 1 97 SER n 1 98 ARG n 1 99 LEU n 1 100 SER n 1 101 MET n 1 102 LEU n 1 103 PRO n 1 104 HIS n 1 105 LEU n 1 106 ALA n 1 107 ASP n 1 108 LEU n 1 109 VAL n 1 110 SER n 1 111 TYR n 1 112 SER n 1 113 ILE n 1 114 GLN n 1 115 LYS n 1 116 VAL n 1 117 ILE n 1 118 GLY n 1 119 PHE n 1 120 ALA n 1 121 LYS n 1 122 MET n 1 123 ILE n 1 124 PRO n 1 125 GLY n 1 126 PHE n 1 127 ARG n 1 128 ASP n 1 129 LEU n 1 130 THR n 1 131 ALA n 1 132 GLU n 1 133 ASP n 1 134 GLN n 1 135 ILE n 1 136 ALA n 1 137 LEU n 1 138 LEU n 1 139 LYS n 1 140 SER n 1 141 SER n 1 142 ALA n 1 143 ILE n 1 144 GLU n 1 145 ILE n 1 146 ILE n 1 147 MET n 1 148 LEU n 1 149 ARG n 1 150 SER n 1 151 ASN n 1 152 GLN n 1 153 SER n 1 154 PHE n 1 155 SER n 1 156 LEU n 1 157 GLU n 1 158 ASP n 1 159 MET n 1 160 SER n 1 161 TRP n 1 162 SER n 1 163 CYS n 1 164 GLY n 1 165 GLY n 1 166 PRO n 1 167 ASP n 1 168 PHE n 1 169 LYS n 1 170 TYR n 1 171 CYS n 1 172 ILE n 1 173 ASN n 1 174 ASP n 1 175 VAL n 1 176 THR n 1 177 LYS n 1 178 ALA n 1 179 GLY n 1 180 HIS n 1 181 THR n 1 182 LEU n 1 183 GLU n 1 184 LEU n 1 185 LEU n 1 186 GLU n 1 187 PRO n 1 188 LEU n 1 189 VAL n 1 190 LYS n 1 191 PHE n 1 192 GLN n 1 193 VAL n 1 194 GLY n 1 195 LEU n 1 196 LYS n 1 197 LYS n 1 198 LEU n 1 199 LYS n 1 200 LEU n 1 201 HIS n 1 202 GLU n 1 203 GLU n 1 204 GLU n 1 205 HIS n 1 206 VAL n 1 207 LEU n 1 208 LEU n 1 209 MET n 1 210 ALA n 1 211 ILE n 1 212 CYS n 1 213 LEU n 1 214 LEU n 1 215 SER n 1 216 PRO n 1 217 ASP n 1 218 ARG n 1 219 PRO n 1 220 GLY n 1 221 VAL n 1 222 GLN n 1 223 ASP n 1 224 HIS n 1 225 VAL n 1 226 ARG n 1 227 ILE n 1 228 GLU n 1 229 ALA n 1 230 LEU n 1 231 GLN n 1 232 ASP n 1 233 ARG n 1 234 LEU n 1 235 CYS n 1 236 ASP n 1 237 VAL n 1 238 LEU n 1 239 GLN n 1 240 ALA n 1 241 TYR n 1 242 ILE n 1 243 ARG n 1 244 ILE n 1 245 GLN n 1 246 HIS n 1 247 PRO n 1 248 GLY n 1 249 GLY n 1 250 ARG n 1 251 LEU n 1 252 LEU n 1 253 TYR n 1 254 ALA n 1 255 LYS n 1 256 MET n 1 257 ILE n 1 258 GLN n 1 259 LYS n 1 260 LEU n 1 261 ALA n 1 262 ASP n 1 263 LEU n 1 264 ARG n 1 265 SER n 1 266 LEU n 1 267 ASN n 1 268 GLU n 1 269 GLU n 1 270 HIS n 1 271 SER n 1 272 LYS n 1 273 GLN n 1 274 TYR n 1 275 ARG n 1 276 SER n 1 277 LEU n 1 278 SER n 1 279 PHE n 1 280 GLN n 1 281 PRO n 1 282 GLU n 1 283 HIS n 1 284 SER n 1 285 MET n 1 286 GLN n 1 287 LEU n 1 288 THR n 1 289 PRO n 1 290 LEU n 1 291 VAL n 1 292 LEU n 1 293 GLU n 1 294 VAL n 1 295 PHE n 1 296 GLY n 1 297 SER n 1 298 GLU n 1 299 VAL n 1 300 SER n 2 1 ARG n 2 2 HIS n 2 3 LYS n 2 4 ILE n 2 5 LEU n 2 6 HIS n 2 7 ARG n 2 8 LEU n 2 9 LEU n 2 10 GLN n 2 11 GLU n 2 12 GLY n 2 13 SER n 2 14 PRO n 2 15 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 300 _entity_src_gen.gene_src_common_name Zebrafish _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'vdra, nr1i1a, vdr' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Danio rerio' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7955 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 15 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DZT non-polymer . '(1~{R},3~{S},5~{Z})-4-methylidene-5-[(~{E})-3-[3-(6-methyl-6-oxidanyl-heptyl)phenyl]non-2-enylidene]cyclohexane-1,3-diol' ? 'C30 H46 O3' 454.684 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 154 ? ? ? 1 . n A 1 2 MET 2 155 ? ? ? 1 . n A 1 3 LEU 3 156 156 LEU LEU 1 . n A 1 4 SER 4 157 157 SER SER 1 . n A 1 5 ASP 5 158 158 ASP ASP 1 . n A 1 6 GLU 6 159 159 GLU GLU 1 . n A 1 7 GLN 7 160 160 GLN GLN 1 . n A 1 8 MET 8 161 161 MET MET 1 . n A 1 9 GLN 9 162 162 GLN GLN 1 . n A 1 10 ILE 10 163 163 ILE ILE 1 . n A 1 11 ILE 11 164 164 ILE ILE 1 . n A 1 12 ASN 12 165 165 ASN ASN 1 . n A 1 13 SER 13 166 166 SER SER 1 . n A 1 14 LEU 14 167 167 LEU LEU 1 . n A 1 15 VAL 15 168 168 VAL VAL 1 . n A 1 16 GLU 16 169 169 GLU GLU 1 . n A 1 17 ALA 17 170 170 ALA ALA 1 . n A 1 18 HIS 18 171 171 HIS HIS 1 . n A 1 19 HIS 19 172 172 HIS HIS 1 . n A 1 20 LYS 20 173 173 LYS LYS 1 . n A 1 21 THR 21 174 174 THR THR 1 . n A 1 22 TYR 22 175 175 TYR TYR 1 . n A 1 23 ASP 23 176 176 ASP ASP 1 . n A 1 24 ASP 24 177 177 ASP ASP 1 . n A 1 25 SER 25 178 178 SER SER 1 . n A 1 26 TYR 26 179 179 TYR TYR 1 . n A 1 27 SER 27 180 180 SER SER 1 . n A 1 28 ASP 28 181 181 ASP ASP 1 . n A 1 29 PHE 29 182 182 PHE PHE 1 . n A 1 30 VAL 30 183 183 VAL VAL 1 . n A 1 31 ARG 31 184 184 ARG ARG 1 . n A 1 32 PHE 32 185 185 PHE PHE 1 . n A 1 33 ARG 33 186 186 ARG ARG 1 . n A 1 34 PRO 34 187 187 PRO PRO 1 . n A 1 35 PRO 35 188 188 PRO PRO 1 . n A 1 36 VAL 36 189 189 VAL VAL 1 . n A 1 37 ARG 37 190 190 ARG ARG 1 . n A 1 38 GLU 38 191 ? ? ? 1 . n A 1 39 GLY 39 192 ? ? ? 1 . n A 1 40 PRO 40 193 ? ? ? 1 . n A 1 41 VAL 41 194 ? ? ? 1 . n A 1 42 THR 42 195 ? ? ? 1 . n A 1 43 ARG 43 196 ? ? ? 1 . n A 1 44 SER 44 197 ? ? ? 1 . n A 1 45 ALA 45 198 ? ? ? 1 . n A 1 46 SER 46 199 ? ? ? 1 . n A 1 47 ARG 47 200 ? ? ? 1 . n A 1 48 ALA 48 201 ? ? ? 1 . n A 1 49 ALA 49 202 ? ? ? 1 . n A 1 50 SER 50 203 ? ? ? 1 . n A 1 51 LEU 51 204 ? ? ? 1 . n A 1 52 HIS 52 205 ? ? ? 1 . n A 1 53 SER 53 206 ? ? ? 1 . n A 1 54 LEU 54 207 ? ? ? 1 . n A 1 55 SER 55 208 ? ? ? 1 . n A 1 56 ASP 56 209 ? ? ? 1 . n A 1 57 ALA 57 210 ? ? ? 1 . n A 1 58 SER 58 211 ? ? ? 1 . n A 1 59 SER 59 212 ? ? ? 1 . n A 1 60 ASP 60 213 ? ? ? 1 . n A 1 61 SER 61 214 ? ? ? 1 . n A 1 62 PHE 62 215 ? ? ? 1 . n A 1 63 ASN 63 216 ? ? ? 1 . n A 1 64 HIS 64 217 ? ? ? 1 . n A 1 65 SER 65 218 ? ? ? 1 . n A 1 66 PRO 66 219 ? ? ? 1 . n A 1 67 GLU 67 220 ? ? ? 1 . n A 1 68 SER 68 221 ? ? ? 1 . n A 1 69 VAL 69 222 ? ? ? 1 . n A 1 70 ASP 70 223 ? ? ? 1 . n A 1 71 THR 71 224 ? ? ? 1 . n A 1 72 LYS 72 225 ? ? ? 1 . n A 1 73 LEU 73 226 ? ? ? 1 . n A 1 74 ASN 74 227 ? ? ? 1 . n A 1 75 PHE 75 228 ? ? ? 1 . n A 1 76 SER 76 229 ? ? ? 1 . n A 1 77 ASN 77 230 ? ? ? 1 . n A 1 78 LEU 78 231 ? ? ? 1 . n A 1 79 LEU 79 232 ? ? ? 1 . n A 1 80 MET 80 233 ? ? ? 1 . n A 1 81 MET 81 234 ? ? ? 1 . n A 1 82 TYR 82 235 ? ? ? 1 . n A 1 83 GLN 83 236 ? ? ? 1 . n A 1 84 ASP 84 237 ? ? ? 1 . n A 1 85 SER 85 238 ? ? ? 1 . n A 1 86 GLY 86 239 ? ? ? 1 . n A 1 87 SER 87 240 ? ? ? 1 . n A 1 88 PRO 88 241 ? ? ? 1 . n A 1 89 ASP 89 242 ? ? ? 1 . n A 1 90 SER 90 243 ? ? ? 1 . n A 1 91 SER 91 244 ? ? ? 1 . n A 1 92 GLU 92 245 ? ? ? 1 . n A 1 93 GLU 93 246 ? ? ? 1 . n A 1 94 ASP 94 247 ? ? ? 1 . n A 1 95 GLN 95 248 ? ? ? 1 . n A 1 96 GLN 96 249 ? ? ? 1 . n A 1 97 SER 97 250 ? ? ? 1 . n A 1 98 ARG 98 251 251 ARG ARG 1 . n A 1 99 LEU 99 252 252 LEU LEU 1 . n A 1 100 SER 100 253 253 SER SER 1 . n A 1 101 MET 101 254 254 MET MET 1 . n A 1 102 LEU 102 255 255 LEU LEU 1 . n A 1 103 PRO 103 256 256 PRO PRO 1 . n A 1 104 HIS 104 257 257 HIS HIS 1 . n A 1 105 LEU 105 258 258 LEU LEU 1 . n A 1 106 ALA 106 259 259 ALA ALA 1 . n A 1 107 ASP 107 260 260 ASP ASP 1 . n A 1 108 LEU 108 261 261 LEU LEU 1 . n A 1 109 VAL 109 262 262 VAL VAL 1 . n A 1 110 SER 110 263 263 SER SER 1 . n A 1 111 TYR 111 264 264 TYR TYR 1 . n A 1 112 SER 112 265 265 SER SER 1 . n A 1 113 ILE 113 266 266 ILE ILE 1 . n A 1 114 GLN 114 267 267 GLN GLN 1 . n A 1 115 LYS 115 268 268 LYS LYS 1 . n A 1 116 VAL 116 269 269 VAL VAL 1 . n A 1 117 ILE 117 270 270 ILE ILE 1 . n A 1 118 GLY 118 271 271 GLY GLY 1 . n A 1 119 PHE 119 272 272 PHE PHE 1 . n A 1 120 ALA 120 273 273 ALA ALA 1 . n A 1 121 LYS 121 274 274 LYS LYS 1 . n A 1 122 MET 122 275 275 MET MET 1 . n A 1 123 ILE 123 276 276 ILE ILE 1 . n A 1 124 PRO 124 277 277 PRO PRO 1 . n A 1 125 GLY 125 278 278 GLY GLY 1 . n A 1 126 PHE 126 279 279 PHE PHE 1 . n A 1 127 ARG 127 280 280 ARG ARG 1 . n A 1 128 ASP 128 281 281 ASP ASP 1 . n A 1 129 LEU 129 282 282 LEU LEU 1 . n A 1 130 THR 130 283 283 THR THR 1 . n A 1 131 ALA 131 284 284 ALA ALA 1 . n A 1 132 GLU 132 285 285 GLU GLU 1 . n A 1 133 ASP 133 286 286 ASP ASP 1 . n A 1 134 GLN 134 287 287 GLN GLN 1 . n A 1 135 ILE 135 288 288 ILE ILE 1 . n A 1 136 ALA 136 289 289 ALA ALA 1 . n A 1 137 LEU 137 290 290 LEU LEU 1 . n A 1 138 LEU 138 291 291 LEU LEU 1 . n A 1 139 LYS 139 292 292 LYS LYS 1 . n A 1 140 SER 140 293 293 SER SER 1 . n A 1 141 SER 141 294 294 SER SER 1 . n A 1 142 ALA 142 295 295 ALA ALA 1 . n A 1 143 ILE 143 296 296 ILE ILE 1 . n A 1 144 GLU 144 297 297 GLU GLU 1 . n A 1 145 ILE 145 298 298 ILE ILE 1 . n A 1 146 ILE 146 299 299 ILE ILE 1 . n A 1 147 MET 147 300 300 MET MET 1 . n A 1 148 LEU 148 301 301 LEU LEU 1 . n A 1 149 ARG 149 302 302 ARG ARG 1 . n A 1 150 SER 150 303 303 SER SER 1 . n A 1 151 ASN 151 304 304 ASN ASN 1 . n A 1 152 GLN 152 305 305 GLN GLN 1 . n A 1 153 SER 153 306 306 SER SER 1 . n A 1 154 PHE 154 307 307 PHE PHE 1 . n A 1 155 SER 155 308 308 SER SER 1 . n A 1 156 LEU 156 309 309 LEU LEU 1 . n A 1 157 GLU 157 310 310 GLU GLU 1 . n A 1 158 ASP 158 311 311 ASP ASP 1 . n A 1 159 MET 159 312 312 MET MET 1 . n A 1 160 SER 160 313 313 SER SER 1 . n A 1 161 TRP 161 314 314 TRP TRP 1 . n A 1 162 SER 162 315 315 SER SER 1 . n A 1 163 CYS 163 316 316 CYS CYS 1 . n A 1 164 GLY 164 317 317 GLY GLY 1 . n A 1 165 GLY 165 318 318 GLY GLY 1 . n A 1 166 PRO 166 319 319 PRO PRO 1 . n A 1 167 ASP 167 320 320 ASP ASP 1 . n A 1 168 PHE 168 321 321 PHE PHE 1 . n A 1 169 LYS 169 322 322 LYS LYS 1 . n A 1 170 TYR 170 323 323 TYR TYR 1 . n A 1 171 CYS 171 324 324 CYS CYS 1 . n A 1 172 ILE 172 325 325 ILE ILE 1 . n A 1 173 ASN 173 326 326 ASN ASN 1 . n A 1 174 ASP 174 327 327 ASP ASP 1 . n A 1 175 VAL 175 328 328 VAL VAL 1 . n A 1 176 THR 176 329 329 THR THR 1 . n A 1 177 LYS 177 330 330 LYS LYS 1 . n A 1 178 ALA 178 331 331 ALA ALA 1 . n A 1 179 GLY 179 332 332 GLY GLY 1 . n A 1 180 HIS 180 333 333 HIS HIS 1 . n A 1 181 THR 181 334 334 THR THR 1 . n A 1 182 LEU 182 335 335 LEU LEU 1 . n A 1 183 GLU 183 336 336 GLU GLU 1 . n A 1 184 LEU 184 337 337 LEU LEU 1 . n A 1 185 LEU 185 338 338 LEU LEU 1 . n A 1 186 GLU 186 339 339 GLU GLU 1 . n A 1 187 PRO 187 340 340 PRO PRO 1 . n A 1 188 LEU 188 341 341 LEU LEU 1 . n A 1 189 VAL 189 342 342 VAL VAL 1 . n A 1 190 LYS 190 343 343 LYS LYS 1 . n A 1 191 PHE 191 344 344 PHE PHE 1 . n A 1 192 GLN 192 345 345 GLN GLN 1 . n A 1 193 VAL 193 346 346 VAL VAL 1 . n A 1 194 GLY 194 347 347 GLY GLY 1 . n A 1 195 LEU 195 348 348 LEU LEU 1 . n A 1 196 LYS 196 349 349 LYS LYS 1 . n A 1 197 LYS 197 350 350 LYS LYS 1 . n A 1 198 LEU 198 351 351 LEU LEU 1 . n A 1 199 LYS 199 352 352 LYS LYS 1 . n A 1 200 LEU 200 353 353 LEU LEU 1 . n A 1 201 HIS 201 354 354 HIS HIS 1 . n A 1 202 GLU 202 355 355 GLU GLU 1 . n A 1 203 GLU 203 356 356 GLU GLU 1 . n A 1 204 GLU 204 357 357 GLU GLU 1 . n A 1 205 HIS 205 358 358 HIS HIS 1 . n A 1 206 VAL 206 359 359 VAL VAL 1 . n A 1 207 LEU 207 360 360 LEU LEU 1 . n A 1 208 LEU 208 361 361 LEU LEU 1 . n A 1 209 MET 209 362 362 MET MET 1 . n A 1 210 ALA 210 363 363 ALA ALA 1 . n A 1 211 ILE 211 364 364 ILE ILE 1 . n A 1 212 CYS 212 365 365 CYS CYS 1 . n A 1 213 LEU 213 366 366 LEU LEU 1 . n A 1 214 LEU 214 367 367 LEU LEU 1 . n A 1 215 SER 215 368 368 SER SER 1 . n A 1 216 PRO 216 369 369 PRO PRO 1 . n A 1 217 ASP 217 370 370 ASP ASP 1 . n A 1 218 ARG 218 371 371 ARG ARG 1 . n A 1 219 PRO 219 372 372 PRO PRO 1 . n A 1 220 GLY 220 373 373 GLY GLY 1 . n A 1 221 VAL 221 374 374 VAL VAL 1 . n A 1 222 GLN 222 375 375 GLN GLN 1 . n A 1 223 ASP 223 376 376 ASP ASP 1 . n A 1 224 HIS 224 377 377 HIS HIS 1 . n A 1 225 VAL 225 378 378 VAL VAL 1 . n A 1 226 ARG 226 379 379 ARG ARG 1 . n A 1 227 ILE 227 380 380 ILE ILE 1 . n A 1 228 GLU 228 381 381 GLU GLU 1 . n A 1 229 ALA 229 382 382 ALA ALA 1 . n A 1 230 LEU 230 383 383 LEU LEU 1 . n A 1 231 GLN 231 384 384 GLN GLN 1 . n A 1 232 ASP 232 385 385 ASP ASP 1 . n A 1 233 ARG 233 386 386 ARG ARG 1 . n A 1 234 LEU 234 387 387 LEU LEU 1 . n A 1 235 CYS 235 388 388 CYS CYS 1 . n A 1 236 ASP 236 389 389 ASP ASP 1 . n A 1 237 VAL 237 390 390 VAL VAL 1 . n A 1 238 LEU 238 391 391 LEU LEU 1 . n A 1 239 GLN 239 392 392 GLN GLN 1 . n A 1 240 ALA 240 393 393 ALA ALA 1 . n A 1 241 TYR 241 394 394 TYR TYR 1 . n A 1 242 ILE 242 395 395 ILE ILE 1 . n A 1 243 ARG 243 396 396 ARG ARG 1 . n A 1 244 ILE 244 397 397 ILE ILE 1 . n A 1 245 GLN 245 398 398 GLN GLN 1 . n A 1 246 HIS 246 399 399 HIS HIS 1 . n A 1 247 PRO 247 400 400 PRO PRO 1 . n A 1 248 GLY 248 401 401 GLY GLY 1 . n A 1 249 GLY 249 402 402 GLY GLY 1 . n A 1 250 ARG 250 403 403 ARG ARG 1 . n A 1 251 LEU 251 404 404 LEU LEU 1 . n A 1 252 LEU 252 405 405 LEU LEU 1 . n A 1 253 TYR 253 406 406 TYR TYR 1 . n A 1 254 ALA 254 407 407 ALA ALA 1 . n A 1 255 LYS 255 408 408 LYS LYS 1 . n A 1 256 MET 256 409 409 MET MET 1 . n A 1 257 ILE 257 410 410 ILE ILE 1 . n A 1 258 GLN 258 411 411 GLN GLN 1 . n A 1 259 LYS 259 412 412 LYS LYS 1 . n A 1 260 LEU 260 413 413 LEU LEU 1 . n A 1 261 ALA 261 414 414 ALA ALA 1 . n A 1 262 ASP 262 415 415 ASP ASP 1 . n A 1 263 LEU 263 416 416 LEU LEU 1 . n A 1 264 ARG 264 417 417 ARG ARG 1 . n A 1 265 SER 265 418 418 SER SER 1 . n A 1 266 LEU 266 419 419 LEU LEU 1 . n A 1 267 ASN 267 420 420 ASN ASN 1 . n A 1 268 GLU 268 421 421 GLU GLU 1 . n A 1 269 GLU 269 422 422 GLU GLU 1 . n A 1 270 HIS 270 423 423 HIS HIS 1 . n A 1 271 SER 271 424 424 SER SER 1 . n A 1 272 LYS 272 425 425 LYS LYS 1 . n A 1 273 GLN 273 426 426 GLN GLN 1 . n A 1 274 TYR 274 427 427 TYR TYR 1 . n A 1 275 ARG 275 428 428 ARG ARG 1 . n A 1 276 SER 276 429 429 SER SER 1 . n A 1 277 LEU 277 430 430 LEU LEU 1 . n A 1 278 SER 278 431 431 SER SER 1 . n A 1 279 PHE 279 432 432 PHE PHE 1 . n A 1 280 GLN 280 433 433 GLN GLN 1 . n A 1 281 PRO 281 434 434 PRO PRO 1 . n A 1 282 GLU 282 435 435 GLU GLU 1 . n A 1 283 HIS 283 436 436 HIS HIS 1 . n A 1 284 SER 284 437 437 SER SER 1 . n A 1 285 MET 285 438 438 MET MET 1 . n A 1 286 GLN 286 439 439 GLN GLN 1 . n A 1 287 LEU 287 440 440 LEU LEU 1 . n A 1 288 THR 288 441 441 THR THR 1 . n A 1 289 PRO 289 442 442 PRO PRO 1 . n A 1 290 LEU 290 443 443 LEU LEU 1 . n A 1 291 VAL 291 444 444 VAL VAL 1 . n A 1 292 LEU 292 445 445 LEU LEU 1 . n A 1 293 GLU 293 446 446 GLU GLU 1 . n A 1 294 VAL 294 447 447 VAL VAL 1 . n A 1 295 PHE 295 448 448 PHE PHE 1 . n A 1 296 GLY 296 449 449 GLY GLY 1 . n A 1 297 SER 297 450 450 SER SER 1 . n A 1 298 GLU 298 451 451 GLU GLU 1 . n A 1 299 VAL 299 452 ? ? ? 1 . n A 1 300 SER 300 453 ? ? ? 1 . n B 2 1 ARG 1 687 ? ? ? B . n B 2 2 HIS 2 688 688 HIS HIS B . n B 2 3 LYS 3 689 689 LYS LYS B . n B 2 4 ILE 4 690 690 ILE ILE B . n B 2 5 LEU 5 691 691 LEU LEU B . n B 2 6 HIS 6 692 692 HIS HIS B . n B 2 7 ARG 7 693 693 ARG ARG B . n B 2 8 LEU 8 694 694 LEU LEU B . n B 2 9 LEU 9 695 695 LEU LEU B . n B 2 10 GLN 10 696 696 GLN ALA B . n B 2 11 GLU 11 697 ? ? ? B . n B 2 12 GLY 12 698 ? ? ? B . n B 2 13 SER 13 699 ? ? ? B . n B 2 14 PRO 14 700 ? ? ? B . n B 2 15 SER 15 701 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 DZT 1 500 500 DZT LX4 1 . D 4 HOH 1 601 49 HOH HOH 1 . D 4 HOH 2 602 11 HOH HOH 1 . D 4 HOH 3 603 4 HOH HOH 1 . D 4 HOH 4 604 39 HOH HOH 1 . D 4 HOH 5 605 15 HOH HOH 1 . D 4 HOH 6 606 30 HOH HOH 1 . D 4 HOH 7 607 23 HOH HOH 1 . D 4 HOH 8 608 13 HOH HOH 1 . D 4 HOH 9 609 29 HOH HOH 1 . D 4 HOH 10 610 2 HOH HOH 1 . D 4 HOH 11 611 26 HOH HOH 1 . D 4 HOH 12 612 22 HOH HOH 1 . D 4 HOH 13 613 34 HOH HOH 1 . D 4 HOH 14 614 8 HOH HOH 1 . D 4 HOH 15 615 19 HOH HOH 1 . D 4 HOH 16 616 20 HOH HOH 1 . D 4 HOH 17 617 5 HOH HOH 1 . D 4 HOH 18 618 58 HOH HOH 1 . D 4 HOH 19 619 37 HOH HOH 1 . D 4 HOH 20 620 43 HOH HOH 1 . D 4 HOH 21 621 38 HOH HOH 1 . D 4 HOH 22 622 17 HOH HOH 1 . D 4 HOH 23 623 42 HOH HOH 1 . D 4 HOH 24 624 45 HOH HOH 1 . D 4 HOH 25 625 1 HOH HOH 1 . D 4 HOH 26 626 18 HOH HOH 1 . D 4 HOH 27 627 35 HOH HOH 1 . D 4 HOH 28 628 47 HOH HOH 1 . D 4 HOH 29 629 59 HOH HOH 1 . D 4 HOH 30 630 52 HOH HOH 1 . D 4 HOH 31 631 16 HOH HOH 1 . D 4 HOH 32 632 10 HOH HOH 1 . D 4 HOH 33 633 7 HOH HOH 1 . D 4 HOH 34 634 6 HOH HOH 1 . D 4 HOH 35 635 54 HOH HOH 1 . D 4 HOH 36 636 31 HOH HOH 1 . D 4 HOH 37 637 3 HOH HOH 1 . D 4 HOH 38 638 14 HOH HOH 1 . D 4 HOH 39 639 33 HOH HOH 1 . D 4 HOH 40 640 56 HOH HOH 1 . D 4 HOH 41 641 57 HOH HOH 1 . D 4 HOH 42 642 48 HOH HOH 1 . D 4 HOH 43 643 36 HOH HOH 1 . D 4 HOH 44 644 9 HOH HOH 1 . D 4 HOH 45 645 41 HOH HOH 1 . D 4 HOH 46 646 53 HOH HOH 1 . D 4 HOH 47 647 46 HOH HOH 1 . D 4 HOH 48 648 40 HOH HOH 1 . D 4 HOH 49 649 55 HOH HOH 1 . D 4 HOH 50 650 51 HOH HOH 1 . D 4 HOH 51 651 21 HOH HOH 1 . D 4 HOH 52 652 44 HOH HOH 1 . D 4 HOH 53 653 60 HOH HOH 1 . D 4 HOH 54 654 32 HOH HOH 1 . E 4 HOH 1 801 12 HOH HOH B . E 4 HOH 2 802 28 HOH HOH B . E 4 HOH 3 803 50 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 1 ARG 280 ? CZ ? A ARG 127 CZ 2 1 Y 0 1 ARG 280 ? NH1 ? A ARG 127 NH1 3 1 Y 0 1 ARG 280 ? NH2 ? A ARG 127 NH2 4 1 Y 0 1 GLU 310 ? CG ? A GLU 157 CG 5 1 Y 0 1 GLU 310 ? CD ? A GLU 157 CD 6 1 Y 0 1 ASP 311 ? CG ? A ASP 158 CG 7 1 Y 0 1 ASP 311 ? OD1 ? A ASP 158 OD1 8 1 Y 0 1 ASP 311 ? OD2 ? A ASP 158 OD2 9 1 Y 0 1 GLU 339 ? CD ? A GLU 186 CD 10 1 Y 0 1 GLU 339 ? OE1 ? A GLU 186 OE1 11 1 Y 0 1 GLU 339 ? OE2 ? A GLU 186 OE2 12 1 Y 0 1 GLN 375 ? CG ? A GLN 222 CG 13 1 Y 0 1 GLN 375 ? CD ? A GLN 222 CD 14 1 Y 0 1 GLN 375 ? OE1 ? A GLN 222 OE1 15 1 Y 0 1 GLN 375 ? NE2 ? A GLN 222 NE2 16 1 Y 0 1 ARG 403 ? C ? A ARG 250 C 17 1 Y 0 1 ARG 403 ? CG ? A ARG 250 CG 18 1 Y 0 1 ARG 403 ? CD ? A ARG 250 CD 19 1 Y 0 1 ARG 403 ? NE ? A ARG 250 NE 20 1 Y 0 1 ARG 403 ? CZ ? A ARG 250 CZ 21 1 Y 0 1 ARG 403 ? NH1 ? A ARG 250 NH1 22 1 Y 0 1 ARG 403 ? NH2 ? A ARG 250 NH2 23 1 Y 0 B LYS 689 ? CG ? B LYS 3 CG 24 1 Y 0 B LYS 689 ? CD ? B LYS 3 CD 25 1 Y 0 B LYS 689 ? CE ? B LYS 3 CE 26 1 Y 0 B LYS 689 ? NZ ? B LYS 3 NZ 27 1 Y 1 B GLN 696 ? CG ? B GLN 10 CG 28 1 Y 1 B GLN 696 ? CD ? B GLN 10 CD 29 1 Y 1 B GLN 696 ? OE1 ? B GLN 10 OE1 30 1 Y 1 B GLN 696 ? NE2 ? B GLN 10 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6FO8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.690 _cell.length_a_esd ? _cell.length_b 66.690 _cell.length_b_esd ? _cell.length_c 264.520 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6FO8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6FO8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.38 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.29 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'BisTris pH 6.5, 1.6 M lithium sulfate and 50 mM magnesium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-01-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0721 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0721 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 1' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6FO8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.3 _reflns.d_resolution_low 25 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16402 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.064 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.08 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.3 _reflns_shell.d_res_low 2.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.2 _reflns_shell.pdbx_Rsym_value 0.415 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6FO8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3 _refine.ls_d_res_low 24.16 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16402 _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.81 _refine.ls_percent_reflns_R_free 4.74 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2354 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1975 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2HC4 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1973 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 57 _refine_hist.number_atoms_total 2063 _refine_hist.d_res_high 2.3 _refine_hist.d_res_low 24.16 # _struct.entry_id 6FO8 _struct.title 'Vitamin D nuclear receptor complex 4' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6FO8 _struct_keywords.text 'nuclear receptor, ligand binding domain, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP VDRA_DANRE Q9PTN2 ? 1 ;LSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVREGPVTRSASRAASLHSLSDASSDSFNHSPESVDTKLNFSNLLMMY QDSGSPDSSEEDQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSWS CGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQAYI RIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS ; 156 2 PDB 6FO8 6FO8 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6FO8 1 3 ? 300 ? Q9PTN2 156 ? 453 ? 156 453 2 2 6FO8 B 1 ? 15 ? 6FO8 687 ? 701 ? 687 701 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6FO8 HIS 1 1 ? UNP Q9PTN2 ? ? 'expression tag' 154 1 1 6FO8 MET 1 2 ? UNP Q9PTN2 ? ? 'expression tag' 155 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3850 ? 1 MORE -33 ? 1 'SSA (A^2)' 21840 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+1/6 0.5000000000 -0.8660254038 0.0000000000 33.3450000000 -0.8660254038 -0.5000000000 0.0000000000 57.7552341784 0.0000000000 0.0000000000 -1.0000000000 44.0866666667 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 4 ? TYR A 22 ? SER 1 157 TYR 1 175 1 ? 19 HELX_P HELX_P2 AA2 TYR A 26 ? PHE A 32 ? TYR 1 179 PHE 1 185 5 ? 7 HELX_P HELX_P3 AA3 MET A 101 ? LYS A 121 ? MET 1 254 LYS 1 274 1 ? 21 HELX_P HELX_P4 AA4 THR A 130 ? SER A 150 ? THR 1 283 SER 1 303 1 ? 21 HELX_P HELX_P5 AA5 CYS A 171 ? LYS A 177 ? CYS 1 324 LYS 1 330 1 ? 7 HELX_P HELX_P6 AA6 THR A 181 ? LEU A 198 ? THR 1 334 LEU 1 351 1 ? 18 HELX_P HELX_P7 AA7 HIS A 201 ? LEU A 214 ? HIS 1 354 LEU 1 367 1 ? 14 HELX_P HELX_P8 AA8 ASP A 223 ? HIS A 246 ? ASP 1 376 HIS 1 399 1 ? 24 HELX_P HELX_P9 AA9 LEU A 251 ? PHE A 279 ? LEU 1 404 PHE 1 432 1 ? 29 HELX_P HELX_P10 AB1 GLN A 280 ? MET A 285 ? GLN 1 433 MET 1 438 1 ? 6 HELX_P HELX_P11 AB2 THR A 288 ? PHE A 295 ? THR 1 441 PHE 1 448 1 ? 8 HELX_P HELX_P12 AB3 LYS B 3 ? LEU B 9 ? LYS B 689 LEU B 695 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 154 ? SER A 155 ? PHE 1 307 SER 1 308 AA1 2 SER A 160 ? SER A 162 ? SER 1 313 SER 1 315 AA1 3 LYS A 169 ? TYR A 170 ? LYS 1 322 TYR 1 323 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 155 ? N SER 1 308 O SER A 160 ? O SER 1 313 AA1 2 3 N TRP A 161 ? N TRP 1 314 O TYR A 170 ? O TYR 1 323 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id 1 _struct_site.pdbx_auth_comp_id DZT _struct_site.pdbx_auth_seq_id 500 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 17 _struct_site.details 'binding site for residue DZT 1 500' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 17 TYR A 22 ? TYR 1 175 . ? 1_555 ? 2 AC1 17 MET A 101 ? MET 1 254 . ? 1_555 ? 3 AC1 17 LEU A 105 ? LEU 1 258 . ? 1_555 ? 4 AC1 17 LEU A 108 ? LEU 1 261 . ? 1_555 ? 5 AC1 17 VAL A 109 ? VAL 1 262 . ? 1_555 ? 6 AC1 17 SER A 112 ? SER 1 265 . ? 1_555 ? 7 AC1 17 ILE A 143 ? ILE 1 296 . ? 1_555 ? 8 AC1 17 ILE A 146 ? ILE 1 299 . ? 1_555 ? 9 AC1 17 MET A 147 ? MET 1 300 . ? 1_555 ? 10 AC1 17 ARG A 149 ? ARG 1 302 . ? 1_555 ? 11 AC1 17 SER A 150 ? SER 1 303 . ? 1_555 ? 12 AC1 17 SER A 153 ? SER 1 306 . ? 1_555 ? 13 AC1 17 TRP A 161 ? TRP 1 314 . ? 1_555 ? 14 AC1 17 CYS A 163 ? CYS 1 316 . ? 1_555 ? 15 AC1 17 TYR A 170 ? TYR 1 323 . ? 1_555 ? 16 AC1 17 HIS A 180 ? HIS 1 333 . ? 1_555 ? 17 AC1 17 HIS A 270 ? HIS 1 423 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS 1 316 ? ? -116.97 60.97 2 1 LEU 1 367 ? ? -96.58 31.60 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 1 HIS 154 ? A HIS 1 2 1 Y 1 1 MET 155 ? A MET 2 3 1 Y 1 1 GLU 191 ? A GLU 38 4 1 Y 1 1 GLY 192 ? A GLY 39 5 1 Y 1 1 PRO 193 ? A PRO 40 6 1 Y 1 1 VAL 194 ? A VAL 41 7 1 Y 1 1 THR 195 ? A THR 42 8 1 Y 1 1 ARG 196 ? A ARG 43 9 1 Y 1 1 SER 197 ? A SER 44 10 1 Y 1 1 ALA 198 ? A ALA 45 11 1 Y 1 1 SER 199 ? A SER 46 12 1 Y 1 1 ARG 200 ? A ARG 47 13 1 Y 1 1 ALA 201 ? A ALA 48 14 1 Y 1 1 ALA 202 ? A ALA 49 15 1 Y 1 1 SER 203 ? A SER 50 16 1 Y 1 1 LEU 204 ? A LEU 51 17 1 Y 1 1 HIS 205 ? A HIS 52 18 1 Y 1 1 SER 206 ? A SER 53 19 1 Y 1 1 LEU 207 ? A LEU 54 20 1 Y 1 1 SER 208 ? A SER 55 21 1 Y 1 1 ASP 209 ? A ASP 56 22 1 Y 1 1 ALA 210 ? A ALA 57 23 1 Y 1 1 SER 211 ? A SER 58 24 1 Y 1 1 SER 212 ? A SER 59 25 1 Y 1 1 ASP 213 ? A ASP 60 26 1 Y 1 1 SER 214 ? A SER 61 27 1 Y 1 1 PHE 215 ? A PHE 62 28 1 Y 1 1 ASN 216 ? A ASN 63 29 1 Y 1 1 HIS 217 ? A HIS 64 30 1 Y 1 1 SER 218 ? A SER 65 31 1 Y 1 1 PRO 219 ? A PRO 66 32 1 Y 1 1 GLU 220 ? A GLU 67 33 1 Y 1 1 SER 221 ? A SER 68 34 1 Y 1 1 VAL 222 ? A VAL 69 35 1 Y 1 1 ASP 223 ? A ASP 70 36 1 Y 1 1 THR 224 ? A THR 71 37 1 Y 1 1 LYS 225 ? A LYS 72 38 1 Y 1 1 LEU 226 ? A LEU 73 39 1 Y 1 1 ASN 227 ? A ASN 74 40 1 Y 1 1 PHE 228 ? A PHE 75 41 1 Y 1 1 SER 229 ? A SER 76 42 1 Y 1 1 ASN 230 ? A ASN 77 43 1 Y 1 1 LEU 231 ? A LEU 78 44 1 Y 1 1 LEU 232 ? A LEU 79 45 1 Y 1 1 MET 233 ? A MET 80 46 1 Y 1 1 MET 234 ? A MET 81 47 1 Y 1 1 TYR 235 ? A TYR 82 48 1 Y 1 1 GLN 236 ? A GLN 83 49 1 Y 1 1 ASP 237 ? A ASP 84 50 1 Y 1 1 SER 238 ? A SER 85 51 1 Y 1 1 GLY 239 ? A GLY 86 52 1 Y 1 1 SER 240 ? A SER 87 53 1 Y 1 1 PRO 241 ? A PRO 88 54 1 Y 1 1 ASP 242 ? A ASP 89 55 1 Y 1 1 SER 243 ? A SER 90 56 1 Y 1 1 SER 244 ? A SER 91 57 1 Y 1 1 GLU 245 ? A GLU 92 58 1 Y 1 1 GLU 246 ? A GLU 93 59 1 Y 1 1 ASP 247 ? A ASP 94 60 1 Y 1 1 GLN 248 ? A GLN 95 61 1 Y 1 1 GLN 249 ? A GLN 96 62 1 Y 1 1 SER 250 ? A SER 97 63 1 Y 1 1 VAL 452 ? A VAL 299 64 1 Y 1 1 SER 453 ? A SER 300 65 1 Y 1 B ARG 687 ? B ARG 1 66 1 Y 1 B GLU 697 ? B GLU 11 67 1 Y 1 B GLY 698 ? B GLY 12 68 1 Y 1 B SER 699 ? B SER 13 69 1 Y 1 B PRO 700 ? B PRO 14 70 1 Y 1 B SER 701 ? B SER 15 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DZT C2 C N N 88 DZT C3 C N N 89 DZT C4 C N N 90 DZT C5 C N N 91 DZT C6 C N N 92 DZT C7 C N N 93 DZT C8 C N N 94 DZT O9 O N N 95 DZT C10 C N N 96 DZT C11 C N N 97 DZT C12 C N N 98 DZT C13 C N N 99 DZT C14 C N N 100 DZT C15 C N N 101 DZT C16 C N N 102 DZT C17 C N N 103 DZT C18 C Y N 104 DZT C19 C Y N 105 DZT C20 C Y N 106 DZT C21 C Y N 107 DZT C22 C Y N 108 DZT C23 C Y N 109 DZT C24 C N N 110 DZT C25 C N N 111 DZT C26 C N N 112 DZT C27 C N N 113 DZT C28 C N N 114 DZT C29 C N S 115 DZT O30 O N N 116 DZT C31 C N N 117 DZT C32 C N R 118 DZT O33 O N N 119 DZT C34 C N N 120 DZT H1 H N N 121 DZT H2 H N N 122 DZT H3 H N N 123 DZT H4 H N N 124 DZT H5 H N N 125 DZT H6 H N N 126 DZT H7 H N N 127 DZT H8 H N N 128 DZT H9 H N N 129 DZT H10 H N N 130 DZT H11 H N N 131 DZT H12 H N N 132 DZT H13 H N N 133 DZT H14 H N N 134 DZT H15 H N N 135 DZT H16 H N N 136 DZT H17 H N N 137 DZT H18 H N N 138 DZT H19 H N N 139 DZT H20 H N N 140 DZT H21 H N N 141 DZT H22 H N N 142 DZT H23 H N N 143 DZT H24 H N N 144 DZT H25 H N N 145 DZT H26 H N N 146 DZT H27 H N N 147 DZT H28 H N N 148 DZT H29 H N N 149 DZT H30 H N N 150 DZT H31 H N N 151 DZT H32 H N N 152 DZT H33 H N N 153 DZT H34 H N N 154 DZT H35 H N N 155 DZT H36 H N N 156 DZT H37 H N N 157 DZT H38 H N N 158 DZT H39 H N N 159 DZT H40 H N N 160 DZT H41 H N N 161 DZT H42 H N N 162 DZT H43 H N N 163 DZT H44 H N N 164 DZT H45 H N N 165 DZT H46 H N N 166 GLN N N N N 167 GLN CA C N S 168 GLN C C N N 169 GLN O O N N 170 GLN CB C N N 171 GLN CG C N N 172 GLN CD C N N 173 GLN OE1 O N N 174 GLN NE2 N N N 175 GLN OXT O N N 176 GLN H H N N 177 GLN H2 H N N 178 GLN HA H N N 179 GLN HB2 H N N 180 GLN HB3 H N N 181 GLN HG2 H N N 182 GLN HG3 H N N 183 GLN HE21 H N N 184 GLN HE22 H N N 185 GLN HXT H N N 186 GLU N N N N 187 GLU CA C N S 188 GLU C C N N 189 GLU O O N N 190 GLU CB C N N 191 GLU CG C N N 192 GLU CD C N N 193 GLU OE1 O N N 194 GLU OE2 O N N 195 GLU OXT O N N 196 GLU H H N N 197 GLU H2 H N N 198 GLU HA H N N 199 GLU HB2 H N N 200 GLU HB3 H N N 201 GLU HG2 H N N 202 GLU HG3 H N N 203 GLU HE2 H N N 204 GLU HXT H N N 205 GLY N N N N 206 GLY CA C N N 207 GLY C C N N 208 GLY O O N N 209 GLY OXT O N N 210 GLY H H N N 211 GLY H2 H N N 212 GLY HA2 H N N 213 GLY HA3 H N N 214 GLY HXT H N N 215 HIS N N N N 216 HIS CA C N S 217 HIS C C N N 218 HIS O O N N 219 HIS CB C N N 220 HIS CG C Y N 221 HIS ND1 N Y N 222 HIS CD2 C Y N 223 HIS CE1 C Y N 224 HIS NE2 N Y N 225 HIS OXT O N N 226 HIS H H N N 227 HIS H2 H N N 228 HIS HA H N N 229 HIS HB2 H N N 230 HIS HB3 H N N 231 HIS HD1 H N N 232 HIS HD2 H N N 233 HIS HE1 H N N 234 HIS HE2 H N N 235 HIS HXT H N N 236 HOH O O N N 237 HOH H1 H N N 238 HOH H2 H N N 239 ILE N N N N 240 ILE CA C N S 241 ILE C C N N 242 ILE O O N N 243 ILE CB C N S 244 ILE CG1 C N N 245 ILE CG2 C N N 246 ILE CD1 C N N 247 ILE OXT O N N 248 ILE H H N N 249 ILE H2 H N N 250 ILE HA H N N 251 ILE HB H N N 252 ILE HG12 H N N 253 ILE HG13 H N N 254 ILE HG21 H N N 255 ILE HG22 H N N 256 ILE HG23 H N N 257 ILE HD11 H N N 258 ILE HD12 H N N 259 ILE HD13 H N N 260 ILE HXT H N N 261 LEU N N N N 262 LEU CA C N S 263 LEU C C N N 264 LEU O O N N 265 LEU CB C N N 266 LEU CG C N N 267 LEU CD1 C N N 268 LEU CD2 C N N 269 LEU OXT O N N 270 LEU H H N N 271 LEU H2 H N N 272 LEU HA H N N 273 LEU HB2 H N N 274 LEU HB3 H N N 275 LEU HG H N N 276 LEU HD11 H N N 277 LEU HD12 H N N 278 LEU HD13 H N N 279 LEU HD21 H N N 280 LEU HD22 H N N 281 LEU HD23 H N N 282 LEU HXT H N N 283 LYS N N N N 284 LYS CA C N S 285 LYS C C N N 286 LYS O O N N 287 LYS CB C N N 288 LYS CG C N N 289 LYS CD C N N 290 LYS CE C N N 291 LYS NZ N N N 292 LYS OXT O N N 293 LYS H H N N 294 LYS H2 H N N 295 LYS HA H N N 296 LYS HB2 H N N 297 LYS HB3 H N N 298 LYS HG2 H N N 299 LYS HG3 H N N 300 LYS HD2 H N N 301 LYS HD3 H N N 302 LYS HE2 H N N 303 LYS HE3 H N N 304 LYS HZ1 H N N 305 LYS HZ2 H N N 306 LYS HZ3 H N N 307 LYS HXT H N N 308 MET N N N N 309 MET CA C N S 310 MET C C N N 311 MET O O N N 312 MET CB C N N 313 MET CG C N N 314 MET SD S N N 315 MET CE C N N 316 MET OXT O N N 317 MET H H N N 318 MET H2 H N N 319 MET HA H N N 320 MET HB2 H N N 321 MET HB3 H N N 322 MET HG2 H N N 323 MET HG3 H N N 324 MET HE1 H N N 325 MET HE2 H N N 326 MET HE3 H N N 327 MET HXT H N N 328 PHE N N N N 329 PHE CA C N S 330 PHE C C N N 331 PHE O O N N 332 PHE CB C N N 333 PHE CG C Y N 334 PHE CD1 C Y N 335 PHE CD2 C Y N 336 PHE CE1 C Y N 337 PHE CE2 C Y N 338 PHE CZ C Y N 339 PHE OXT O N N 340 PHE H H N N 341 PHE H2 H N N 342 PHE HA H N N 343 PHE HB2 H N N 344 PHE HB3 H N N 345 PHE HD1 H N N 346 PHE HD2 H N N 347 PHE HE1 H N N 348 PHE HE2 H N N 349 PHE HZ H N N 350 PHE HXT H N N 351 PRO N N N N 352 PRO CA C N S 353 PRO C C N N 354 PRO O O N N 355 PRO CB C N N 356 PRO CG C N N 357 PRO CD C N N 358 PRO OXT O N N 359 PRO H H N N 360 PRO HA H N N 361 PRO HB2 H N N 362 PRO HB3 H N N 363 PRO HG2 H N N 364 PRO HG3 H N N 365 PRO HD2 H N N 366 PRO HD3 H N N 367 PRO HXT H N N 368 SER N N N N 369 SER CA C N S 370 SER C C N N 371 SER O O N N 372 SER CB C N N 373 SER OG O N N 374 SER OXT O N N 375 SER H H N N 376 SER H2 H N N 377 SER HA H N N 378 SER HB2 H N N 379 SER HB3 H N N 380 SER HG H N N 381 SER HXT H N N 382 THR N N N N 383 THR CA C N S 384 THR C C N N 385 THR O O N N 386 THR CB C N R 387 THR OG1 O N N 388 THR CG2 C N N 389 THR OXT O N N 390 THR H H N N 391 THR H2 H N N 392 THR HA H N N 393 THR HB H N N 394 THR HG1 H N N 395 THR HG21 H N N 396 THR HG22 H N N 397 THR HG23 H N N 398 THR HXT H N N 399 TRP N N N N 400 TRP CA C N S 401 TRP C C N N 402 TRP O O N N 403 TRP CB C N N 404 TRP CG C Y N 405 TRP CD1 C Y N 406 TRP CD2 C Y N 407 TRP NE1 N Y N 408 TRP CE2 C Y N 409 TRP CE3 C Y N 410 TRP CZ2 C Y N 411 TRP CZ3 C Y N 412 TRP CH2 C Y N 413 TRP OXT O N N 414 TRP H H N N 415 TRP H2 H N N 416 TRP HA H N N 417 TRP HB2 H N N 418 TRP HB3 H N N 419 TRP HD1 H N N 420 TRP HE1 H N N 421 TRP HE3 H N N 422 TRP HZ2 H N N 423 TRP HZ3 H N N 424 TRP HH2 H N N 425 TRP HXT H N N 426 TYR N N N N 427 TYR CA C N S 428 TYR C C N N 429 TYR O O N N 430 TYR CB C N N 431 TYR CG C Y N 432 TYR CD1 C Y N 433 TYR CD2 C Y N 434 TYR CE1 C Y N 435 TYR CE2 C Y N 436 TYR CZ C Y N 437 TYR OH O N N 438 TYR OXT O N N 439 TYR H H N N 440 TYR H2 H N N 441 TYR HA H N N 442 TYR HB2 H N N 443 TYR HB3 H N N 444 TYR HD1 H N N 445 TYR HD2 H N N 446 TYR HE1 H N N 447 TYR HE2 H N N 448 TYR HH H N N 449 TYR HXT H N N 450 VAL N N N N 451 VAL CA C N S 452 VAL C C N N 453 VAL O O N N 454 VAL CB C N N 455 VAL CG1 C N N 456 VAL CG2 C N N 457 VAL OXT O N N 458 VAL H H N N 459 VAL H2 H N N 460 VAL HA H N N 461 VAL HB H N N 462 VAL HG11 H N N 463 VAL HG12 H N N 464 VAL HG13 H N N 465 VAL HG21 H N N 466 VAL HG22 H N N 467 VAL HG23 H N N 468 VAL HXT H N N 469 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DZT C12 C10 sing N N 83 DZT C11 C10 sing N N 84 DZT C10 O9 sing N N 85 DZT C10 C13 sing N N 86 DZT C2 C3 sing N N 87 DZT C13 C14 sing N N 88 DZT C3 C4 sing N N 89 DZT C4 C5 sing N N 90 DZT C14 C15 sing N N 91 DZT C5 C6 sing N N 92 DZT C16 C15 sing N N 93 DZT C16 C17 sing N N 94 DZT C28 C27 doub N N 95 DZT C6 C7 sing N N 96 DZT C27 C26 sing N N 97 DZT C27 C29 sing N N 98 DZT C34 C26 sing N N 99 DZT C34 C32 sing N N 100 DZT C17 C18 sing N N 101 DZT C31 C32 sing N N 102 DZT C31 C29 sing N N 103 DZT C26 C25 doub N Z 104 DZT O30 C29 sing N N 105 DZT C25 C24 sing N N 106 DZT C19 C18 doub Y N 107 DZT C19 C23 sing Y N 108 DZT C32 O33 sing N N 109 DZT C24 C8 doub N E 110 DZT C18 C20 sing Y N 111 DZT C7 C8 sing N N 112 DZT C8 C23 sing N N 113 DZT C23 C22 doub Y N 114 DZT C20 C21 doub Y N 115 DZT C22 C21 sing Y N 116 DZT C2 H1 sing N N 117 DZT C2 H2 sing N N 118 DZT C2 H3 sing N N 119 DZT C3 H4 sing N N 120 DZT C3 H5 sing N N 121 DZT C4 H6 sing N N 122 DZT C4 H7 sing N N 123 DZT C5 H8 sing N N 124 DZT C5 H9 sing N N 125 DZT C6 H10 sing N N 126 DZT C6 H11 sing N N 127 DZT C7 H12 sing N N 128 DZT C7 H13 sing N N 129 DZT O9 H14 sing N N 130 DZT C11 H15 sing N N 131 DZT C11 H16 sing N N 132 DZT C11 H17 sing N N 133 DZT C12 H18 sing N N 134 DZT C12 H19 sing N N 135 DZT C12 H20 sing N N 136 DZT C13 H21 sing N N 137 DZT C13 H22 sing N N 138 DZT C14 H23 sing N N 139 DZT C14 H24 sing N N 140 DZT C15 H25 sing N N 141 DZT C15 H26 sing N N 142 DZT C16 H27 sing N N 143 DZT C16 H28 sing N N 144 DZT C17 H29 sing N N 145 DZT C17 H30 sing N N 146 DZT C19 H31 sing N N 147 DZT C20 H32 sing N N 148 DZT C21 H33 sing N N 149 DZT C22 H34 sing N N 150 DZT C24 H35 sing N N 151 DZT C25 H36 sing N N 152 DZT C28 H37 sing N N 153 DZT C28 H38 sing N N 154 DZT C29 H39 sing N N 155 DZT O30 H40 sing N N 156 DZT C31 H41 sing N N 157 DZT C31 H42 sing N N 158 DZT C32 H43 sing N N 159 DZT O33 H44 sing N N 160 DZT C34 H45 sing N N 161 DZT C34 H46 sing N N 162 GLN N CA sing N N 163 GLN N H sing N N 164 GLN N H2 sing N N 165 GLN CA C sing N N 166 GLN CA CB sing N N 167 GLN CA HA sing N N 168 GLN C O doub N N 169 GLN C OXT sing N N 170 GLN CB CG sing N N 171 GLN CB HB2 sing N N 172 GLN CB HB3 sing N N 173 GLN CG CD sing N N 174 GLN CG HG2 sing N N 175 GLN CG HG3 sing N N 176 GLN CD OE1 doub N N 177 GLN CD NE2 sing N N 178 GLN NE2 HE21 sing N N 179 GLN NE2 HE22 sing N N 180 GLN OXT HXT sing N N 181 GLU N CA sing N N 182 GLU N H sing N N 183 GLU N H2 sing N N 184 GLU CA C sing N N 185 GLU CA CB sing N N 186 GLU CA HA sing N N 187 GLU C O doub N N 188 GLU C OXT sing N N 189 GLU CB CG sing N N 190 GLU CB HB2 sing N N 191 GLU CB HB3 sing N N 192 GLU CG CD sing N N 193 GLU CG HG2 sing N N 194 GLU CG HG3 sing N N 195 GLU CD OE1 doub N N 196 GLU CD OE2 sing N N 197 GLU OE2 HE2 sing N N 198 GLU OXT HXT sing N N 199 GLY N CA sing N N 200 GLY N H sing N N 201 GLY N H2 sing N N 202 GLY CA C sing N N 203 GLY CA HA2 sing N N 204 GLY CA HA3 sing N N 205 GLY C O doub N N 206 GLY C OXT sing N N 207 GLY OXT HXT sing N N 208 HIS N CA sing N N 209 HIS N H sing N N 210 HIS N H2 sing N N 211 HIS CA C sing N N 212 HIS CA CB sing N N 213 HIS CA HA sing N N 214 HIS C O doub N N 215 HIS C OXT sing N N 216 HIS CB CG sing N N 217 HIS CB HB2 sing N N 218 HIS CB HB3 sing N N 219 HIS CG ND1 sing Y N 220 HIS CG CD2 doub Y N 221 HIS ND1 CE1 doub Y N 222 HIS ND1 HD1 sing N N 223 HIS CD2 NE2 sing Y N 224 HIS CD2 HD2 sing N N 225 HIS CE1 NE2 sing Y N 226 HIS CE1 HE1 sing N N 227 HIS NE2 HE2 sing N N 228 HIS OXT HXT sing N N 229 HOH O H1 sing N N 230 HOH O H2 sing N N 231 ILE N CA sing N N 232 ILE N H sing N N 233 ILE N H2 sing N N 234 ILE CA C sing N N 235 ILE CA CB sing N N 236 ILE CA HA sing N N 237 ILE C O doub N N 238 ILE C OXT sing N N 239 ILE CB CG1 sing N N 240 ILE CB CG2 sing N N 241 ILE CB HB sing N N 242 ILE CG1 CD1 sing N N 243 ILE CG1 HG12 sing N N 244 ILE CG1 HG13 sing N N 245 ILE CG2 HG21 sing N N 246 ILE CG2 HG22 sing N N 247 ILE CG2 HG23 sing N N 248 ILE CD1 HD11 sing N N 249 ILE CD1 HD12 sing N N 250 ILE CD1 HD13 sing N N 251 ILE OXT HXT sing N N 252 LEU N CA sing N N 253 LEU N H sing N N 254 LEU N H2 sing N N 255 LEU CA C sing N N 256 LEU CA CB sing N N 257 LEU CA HA sing N N 258 LEU C O doub N N 259 LEU C OXT sing N N 260 LEU CB CG sing N N 261 LEU CB HB2 sing N N 262 LEU CB HB3 sing N N 263 LEU CG CD1 sing N N 264 LEU CG CD2 sing N N 265 LEU CG HG sing N N 266 LEU CD1 HD11 sing N N 267 LEU CD1 HD12 sing N N 268 LEU CD1 HD13 sing N N 269 LEU CD2 HD21 sing N N 270 LEU CD2 HD22 sing N N 271 LEU CD2 HD23 sing N N 272 LEU OXT HXT sing N N 273 LYS N CA sing N N 274 LYS N H sing N N 275 LYS N H2 sing N N 276 LYS CA C sing N N 277 LYS CA CB sing N N 278 LYS CA HA sing N N 279 LYS C O doub N N 280 LYS C OXT sing N N 281 LYS CB CG sing N N 282 LYS CB HB2 sing N N 283 LYS CB HB3 sing N N 284 LYS CG CD sing N N 285 LYS CG HG2 sing N N 286 LYS CG HG3 sing N N 287 LYS CD CE sing N N 288 LYS CD HD2 sing N N 289 LYS CD HD3 sing N N 290 LYS CE NZ sing N N 291 LYS CE HE2 sing N N 292 LYS CE HE3 sing N N 293 LYS NZ HZ1 sing N N 294 LYS NZ HZ2 sing N N 295 LYS NZ HZ3 sing N N 296 LYS OXT HXT sing N N 297 MET N CA sing N N 298 MET N H sing N N 299 MET N H2 sing N N 300 MET CA C sing N N 301 MET CA CB sing N N 302 MET CA HA sing N N 303 MET C O doub N N 304 MET C OXT sing N N 305 MET CB CG sing N N 306 MET CB HB2 sing N N 307 MET CB HB3 sing N N 308 MET CG SD sing N N 309 MET CG HG2 sing N N 310 MET CG HG3 sing N N 311 MET SD CE sing N N 312 MET CE HE1 sing N N 313 MET CE HE2 sing N N 314 MET CE HE3 sing N N 315 MET OXT HXT sing N N 316 PHE N CA sing N N 317 PHE N H sing N N 318 PHE N H2 sing N N 319 PHE CA C sing N N 320 PHE CA CB sing N N 321 PHE CA HA sing N N 322 PHE C O doub N N 323 PHE C OXT sing N N 324 PHE CB CG sing N N 325 PHE CB HB2 sing N N 326 PHE CB HB3 sing N N 327 PHE CG CD1 doub Y N 328 PHE CG CD2 sing Y N 329 PHE CD1 CE1 sing Y N 330 PHE CD1 HD1 sing N N 331 PHE CD2 CE2 doub Y N 332 PHE CD2 HD2 sing N N 333 PHE CE1 CZ doub Y N 334 PHE CE1 HE1 sing N N 335 PHE CE2 CZ sing Y N 336 PHE CE2 HE2 sing N N 337 PHE CZ HZ sing N N 338 PHE OXT HXT sing N N 339 PRO N CA sing N N 340 PRO N CD sing N N 341 PRO N H sing N N 342 PRO CA C sing N N 343 PRO CA CB sing N N 344 PRO CA HA sing N N 345 PRO C O doub N N 346 PRO C OXT sing N N 347 PRO CB CG sing N N 348 PRO CB HB2 sing N N 349 PRO CB HB3 sing N N 350 PRO CG CD sing N N 351 PRO CG HG2 sing N N 352 PRO CG HG3 sing N N 353 PRO CD HD2 sing N N 354 PRO CD HD3 sing N N 355 PRO OXT HXT sing N N 356 SER N CA sing N N 357 SER N H sing N N 358 SER N H2 sing N N 359 SER CA C sing N N 360 SER CA CB sing N N 361 SER CA HA sing N N 362 SER C O doub N N 363 SER C OXT sing N N 364 SER CB OG sing N N 365 SER CB HB2 sing N N 366 SER CB HB3 sing N N 367 SER OG HG sing N N 368 SER OXT HXT sing N N 369 THR N CA sing N N 370 THR N H sing N N 371 THR N H2 sing N N 372 THR CA C sing N N 373 THR CA CB sing N N 374 THR CA HA sing N N 375 THR C O doub N N 376 THR C OXT sing N N 377 THR CB OG1 sing N N 378 THR CB CG2 sing N N 379 THR CB HB sing N N 380 THR OG1 HG1 sing N N 381 THR CG2 HG21 sing N N 382 THR CG2 HG22 sing N N 383 THR CG2 HG23 sing N N 384 THR OXT HXT sing N N 385 TRP N CA sing N N 386 TRP N H sing N N 387 TRP N H2 sing N N 388 TRP CA C sing N N 389 TRP CA CB sing N N 390 TRP CA HA sing N N 391 TRP C O doub N N 392 TRP C OXT sing N N 393 TRP CB CG sing N N 394 TRP CB HB2 sing N N 395 TRP CB HB3 sing N N 396 TRP CG CD1 doub Y N 397 TRP CG CD2 sing Y N 398 TRP CD1 NE1 sing Y N 399 TRP CD1 HD1 sing N N 400 TRP CD2 CE2 doub Y N 401 TRP CD2 CE3 sing Y N 402 TRP NE1 CE2 sing Y N 403 TRP NE1 HE1 sing N N 404 TRP CE2 CZ2 sing Y N 405 TRP CE3 CZ3 doub Y N 406 TRP CE3 HE3 sing N N 407 TRP CZ2 CH2 doub Y N 408 TRP CZ2 HZ2 sing N N 409 TRP CZ3 CH2 sing Y N 410 TRP CZ3 HZ3 sing N N 411 TRP CH2 HH2 sing N N 412 TRP OXT HXT sing N N 413 TYR N CA sing N N 414 TYR N H sing N N 415 TYR N H2 sing N N 416 TYR CA C sing N N 417 TYR CA CB sing N N 418 TYR CA HA sing N N 419 TYR C O doub N N 420 TYR C OXT sing N N 421 TYR CB CG sing N N 422 TYR CB HB2 sing N N 423 TYR CB HB3 sing N N 424 TYR CG CD1 doub Y N 425 TYR CG CD2 sing Y N 426 TYR CD1 CE1 sing Y N 427 TYR CD1 HD1 sing N N 428 TYR CD2 CE2 doub Y N 429 TYR CD2 HD2 sing N N 430 TYR CE1 CZ doub Y N 431 TYR CE1 HE1 sing N N 432 TYR CE2 CZ sing Y N 433 TYR CE2 HE2 sing N N 434 TYR CZ OH sing N N 435 TYR OH HH sing N N 436 TYR OXT HXT sing N N 437 VAL N CA sing N N 438 VAL N H sing N N 439 VAL N H2 sing N N 440 VAL CA C sing N N 441 VAL CA CB sing N N 442 VAL CA HA sing N N 443 VAL C O doub N N 444 VAL C OXT sing N N 445 VAL CB CG1 sing N N 446 VAL CB CG2 sing N N 447 VAL CB HB sing N N 448 VAL CG1 HG11 sing N N 449 VAL CG1 HG12 sing N N 450 VAL CG1 HG13 sing N N 451 VAL CG2 HG21 sing N N 452 VAL CG2 HG22 sing N N 453 VAL CG2 HG23 sing N N 454 VAL OXT HXT sing N N 455 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'French National Research Agency' France ANR-13-BSV8-0024-01 1 'Spanish Ministry of Economy and Competitiveness' Spain SAF2015-69221-R 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2HC4 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6FO8 _atom_sites.fract_transf_matrix[1][1] 0.014995 _atom_sites.fract_transf_matrix[1][2] 0.008657 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017314 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003780 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_