data_6FOB # _entry.id 6FOB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6FOB pdb_00006fob 10.2210/pdb6fob/pdb WWPDB D_1200008672 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-16 2 'Structure model' 1 1 2018-06-27 3 'Structure model' 1 2 2021-02-24 4 'Structure model' 1 3 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' Advisory 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_assembly_gen 4 3 'Structure model' pdbx_struct_assembly_prop 5 3 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 9 4 'Structure model' pdbx_initial_refinement_model 10 4 'Structure model' pdbx_unobs_or_zero_occ_atoms # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_pdbx_struct_assembly.oligomeric_count' 5 3 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 6 3 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 7 3 'Structure model' '_pdbx_struct_assembly_prop.value' 8 4 'Structure model' '_database_2.pdbx_DOI' 9 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6FOB _pdbx_database_status.recvd_initial_deposition_date 2018-02-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Rochel, N.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Med. Chem.' _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 1520-4804 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 61 _citation.language ? _citation.page_first 4928 _citation.page_last 4937 _citation.title 'Aromatic-Based Design of Highly Active and Noncalcemic Vitamin D Receptor Agonists.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.8b00337 _citation.pdbx_database_id_PubMed 29733645 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gogoi, P.' 1 ? primary 'Seoane, S.' 2 ? primary 'Sigueiro, R.' 3 ? primary 'Guiberteau, T.' 4 ? primary 'Maestro, M.A.' 5 ? primary 'Perez-Fernandez, R.' 6 ? primary 'Rochel, N.' 7 ? primary 'Mourino, A.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Vitamin D3 receptor A' 33916.543 1 ? ? ? ? 2 polymer syn 'Nuclear receptor coactivator 1' 1776.072 1 ? ? ? ? 3 non-polymer syn '(1~{R},3~{S},5~{Z})-4-methylidene-5-[(~{E})-3-[3-(6-methyl-6-oxidanyl-heptyl)phenyl]dec-2-enylidene]cyclohexane-1,3-diol' 468.711 1 ? ? ? ? 4 water nat water 18.015 45 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'VDR-A,1,25-dihydroxyvitamin D3 receptor A,Nuclear receptor subfamily 1 group I member 1-A' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVREGPVTRSASRAASLHSLSDASSDSFNHSPESVDTKLNFSNLLM MYQDSGSPDSSEEDQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMS WSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQA YIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS ; ;HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVREGPVTRSASRAASLHSLSDASSDSFNHSPESVDTKLNFSNLLM MYQDSGSPDSSEEDQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMS WSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQA YIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS ; A ? 2 'polypeptide(L)' no no RHKILHRLLQEGSPS RHKILHRLLQEGSPS B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 '(1~{R},3~{S},5~{Z})-4-methylidene-5-[(~{E})-3-[3-(6-methyl-6-oxidanyl-heptyl)phenyl]dec-2-enylidene]cyclohexane-1,3-diol' DZW 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 MET n 1 3 LEU n 1 4 SER n 1 5 ASP n 1 6 GLU n 1 7 GLN n 1 8 MET n 1 9 GLN n 1 10 ILE n 1 11 ILE n 1 12 ASN n 1 13 SER n 1 14 LEU n 1 15 VAL n 1 16 GLU n 1 17 ALA n 1 18 HIS n 1 19 HIS n 1 20 LYS n 1 21 THR n 1 22 TYR n 1 23 ASP n 1 24 ASP n 1 25 SER n 1 26 TYR n 1 27 SER n 1 28 ASP n 1 29 PHE n 1 30 VAL n 1 31 ARG n 1 32 PHE n 1 33 ARG n 1 34 PRO n 1 35 PRO n 1 36 VAL n 1 37 ARG n 1 38 GLU n 1 39 GLY n 1 40 PRO n 1 41 VAL n 1 42 THR n 1 43 ARG n 1 44 SER n 1 45 ALA n 1 46 SER n 1 47 ARG n 1 48 ALA n 1 49 ALA n 1 50 SER n 1 51 LEU n 1 52 HIS n 1 53 SER n 1 54 LEU n 1 55 SER n 1 56 ASP n 1 57 ALA n 1 58 SER n 1 59 SER n 1 60 ASP n 1 61 SER n 1 62 PHE n 1 63 ASN n 1 64 HIS n 1 65 SER n 1 66 PRO n 1 67 GLU n 1 68 SER n 1 69 VAL n 1 70 ASP n 1 71 THR n 1 72 LYS n 1 73 LEU n 1 74 ASN n 1 75 PHE n 1 76 SER n 1 77 ASN n 1 78 LEU n 1 79 LEU n 1 80 MET n 1 81 MET n 1 82 TYR n 1 83 GLN n 1 84 ASP n 1 85 SER n 1 86 GLY n 1 87 SER n 1 88 PRO n 1 89 ASP n 1 90 SER n 1 91 SER n 1 92 GLU n 1 93 GLU n 1 94 ASP n 1 95 GLN n 1 96 GLN n 1 97 SER n 1 98 ARG n 1 99 LEU n 1 100 SER n 1 101 MET n 1 102 LEU n 1 103 PRO n 1 104 HIS n 1 105 LEU n 1 106 ALA n 1 107 ASP n 1 108 LEU n 1 109 VAL n 1 110 SER n 1 111 TYR n 1 112 SER n 1 113 ILE n 1 114 GLN n 1 115 LYS n 1 116 VAL n 1 117 ILE n 1 118 GLY n 1 119 PHE n 1 120 ALA n 1 121 LYS n 1 122 MET n 1 123 ILE n 1 124 PRO n 1 125 GLY n 1 126 PHE n 1 127 ARG n 1 128 ASP n 1 129 LEU n 1 130 THR n 1 131 ALA n 1 132 GLU n 1 133 ASP n 1 134 GLN n 1 135 ILE n 1 136 ALA n 1 137 LEU n 1 138 LEU n 1 139 LYS n 1 140 SER n 1 141 SER n 1 142 ALA n 1 143 ILE n 1 144 GLU n 1 145 ILE n 1 146 ILE n 1 147 MET n 1 148 LEU n 1 149 ARG n 1 150 SER n 1 151 ASN n 1 152 GLN n 1 153 SER n 1 154 PHE n 1 155 SER n 1 156 LEU n 1 157 GLU n 1 158 ASP n 1 159 MET n 1 160 SER n 1 161 TRP n 1 162 SER n 1 163 CYS n 1 164 GLY n 1 165 GLY n 1 166 PRO n 1 167 ASP n 1 168 PHE n 1 169 LYS n 1 170 TYR n 1 171 CYS n 1 172 ILE n 1 173 ASN n 1 174 ASP n 1 175 VAL n 1 176 THR n 1 177 LYS n 1 178 ALA n 1 179 GLY n 1 180 HIS n 1 181 THR n 1 182 LEU n 1 183 GLU n 1 184 LEU n 1 185 LEU n 1 186 GLU n 1 187 PRO n 1 188 LEU n 1 189 VAL n 1 190 LYS n 1 191 PHE n 1 192 GLN n 1 193 VAL n 1 194 GLY n 1 195 LEU n 1 196 LYS n 1 197 LYS n 1 198 LEU n 1 199 LYS n 1 200 LEU n 1 201 HIS n 1 202 GLU n 1 203 GLU n 1 204 GLU n 1 205 HIS n 1 206 VAL n 1 207 LEU n 1 208 LEU n 1 209 MET n 1 210 ALA n 1 211 ILE n 1 212 CYS n 1 213 LEU n 1 214 LEU n 1 215 SER n 1 216 PRO n 1 217 ASP n 1 218 ARG n 1 219 PRO n 1 220 GLY n 1 221 VAL n 1 222 GLN n 1 223 ASP n 1 224 HIS n 1 225 VAL n 1 226 ARG n 1 227 ILE n 1 228 GLU n 1 229 ALA n 1 230 LEU n 1 231 GLN n 1 232 ASP n 1 233 ARG n 1 234 LEU n 1 235 CYS n 1 236 ASP n 1 237 VAL n 1 238 LEU n 1 239 GLN n 1 240 ALA n 1 241 TYR n 1 242 ILE n 1 243 ARG n 1 244 ILE n 1 245 GLN n 1 246 HIS n 1 247 PRO n 1 248 GLY n 1 249 GLY n 1 250 ARG n 1 251 LEU n 1 252 LEU n 1 253 TYR n 1 254 ALA n 1 255 LYS n 1 256 MET n 1 257 ILE n 1 258 GLN n 1 259 LYS n 1 260 LEU n 1 261 ALA n 1 262 ASP n 1 263 LEU n 1 264 ARG n 1 265 SER n 1 266 LEU n 1 267 ASN n 1 268 GLU n 1 269 GLU n 1 270 HIS n 1 271 SER n 1 272 LYS n 1 273 GLN n 1 274 TYR n 1 275 ARG n 1 276 SER n 1 277 LEU n 1 278 SER n 1 279 PHE n 1 280 GLN n 1 281 PRO n 1 282 GLU n 1 283 HIS n 1 284 SER n 1 285 MET n 1 286 GLN n 1 287 LEU n 1 288 THR n 1 289 PRO n 1 290 LEU n 1 291 VAL n 1 292 LEU n 1 293 GLU n 1 294 VAL n 1 295 PHE n 1 296 GLY n 1 297 SER n 1 298 GLU n 1 299 VAL n 1 300 SER n 2 1 ARG n 2 2 HIS n 2 3 LYS n 2 4 ILE n 2 5 LEU n 2 6 HIS n 2 7 ARG n 2 8 LEU n 2 9 LEU n 2 10 GLN n 2 11 GLU n 2 12 GLY n 2 13 SER n 2 14 PRO n 2 15 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 300 _entity_src_gen.gene_src_common_name Zebrafish _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'vdra, nr1i1a, vdr' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Danio rerio' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7955 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 15 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DZW non-polymer . '(1~{R},3~{S},5~{Z})-4-methylidene-5-[(~{E})-3-[3-(6-methyl-6-oxidanyl-heptyl)phenyl]dec-2-enylidene]cyclohexane-1,3-diol' ? 'C31 H48 O3' 468.711 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 154 ? ? ? A . n A 1 2 MET 2 155 155 MET MET A . n A 1 3 LEU 3 156 156 LEU LEU A . n A 1 4 SER 4 157 157 SER SER A . n A 1 5 ASP 5 158 158 ASP ASP A . n A 1 6 GLU 6 159 159 GLU GLU A . n A 1 7 GLN 7 160 160 GLN GLN A . n A 1 8 MET 8 161 161 MET MET A . n A 1 9 GLN 9 162 162 GLN GLN A . n A 1 10 ILE 10 163 163 ILE ILE A . n A 1 11 ILE 11 164 164 ILE ILE A . n A 1 12 ASN 12 165 165 ASN ASN A . n A 1 13 SER 13 166 166 SER SER A . n A 1 14 LEU 14 167 167 LEU LEU A . n A 1 15 VAL 15 168 168 VAL VAL A . n A 1 16 GLU 16 169 169 GLU GLU A . n A 1 17 ALA 17 170 170 ALA ALA A . n A 1 18 HIS 18 171 171 HIS HIS A . n A 1 19 HIS 19 172 172 HIS HIS A . n A 1 20 LYS 20 173 173 LYS LYS A . n A 1 21 THR 21 174 174 THR THR A . n A 1 22 TYR 22 175 175 TYR TYR A . n A 1 23 ASP 23 176 176 ASP ASP A . n A 1 24 ASP 24 177 177 ASP ASP A . n A 1 25 SER 25 178 178 SER SER A . n A 1 26 TYR 26 179 179 TYR TYR A . n A 1 27 SER 27 180 180 SER SER A . n A 1 28 ASP 28 181 181 ASP ASP A . n A 1 29 PHE 29 182 182 PHE PHE A . n A 1 30 VAL 30 183 183 VAL VAL A . n A 1 31 ARG 31 184 184 ARG ARG A . n A 1 32 PHE 32 185 185 PHE PHE A . n A 1 33 ARG 33 186 186 ARG ARG A . n A 1 34 PRO 34 187 187 PRO PRO A . n A 1 35 PRO 35 188 188 PRO PRO A . n A 1 36 VAL 36 189 189 VAL VAL A . n A 1 37 ARG 37 190 190 ARG ARG A . n A 1 38 GLU 38 191 ? ? ? A . n A 1 39 GLY 39 192 ? ? ? A . n A 1 40 PRO 40 193 ? ? ? A . n A 1 41 VAL 41 194 ? ? ? A . n A 1 42 THR 42 195 ? ? ? A . n A 1 43 ARG 43 196 ? ? ? A . n A 1 44 SER 44 197 ? ? ? A . n A 1 45 ALA 45 198 ? ? ? A . n A 1 46 SER 46 199 ? ? ? A . n A 1 47 ARG 47 200 ? ? ? A . n A 1 48 ALA 48 201 ? ? ? A . n A 1 49 ALA 49 202 ? ? ? A . n A 1 50 SER 50 203 ? ? ? A . n A 1 51 LEU 51 204 ? ? ? A . n A 1 52 HIS 52 205 ? ? ? A . n A 1 53 SER 53 206 ? ? ? A . n A 1 54 LEU 54 207 ? ? ? A . n A 1 55 SER 55 208 ? ? ? A . n A 1 56 ASP 56 209 ? ? ? A . n A 1 57 ALA 57 210 ? ? ? A . n A 1 58 SER 58 211 ? ? ? A . n A 1 59 SER 59 212 ? ? ? A . n A 1 60 ASP 60 213 ? ? ? A . n A 1 61 SER 61 214 ? ? ? A . n A 1 62 PHE 62 215 ? ? ? A . n A 1 63 ASN 63 216 ? ? ? A . n A 1 64 HIS 64 217 ? ? ? A . n A 1 65 SER 65 218 ? ? ? A . n A 1 66 PRO 66 219 ? ? ? A . n A 1 67 GLU 67 220 ? ? ? A . n A 1 68 SER 68 221 ? ? ? A . n A 1 69 VAL 69 222 ? ? ? A . n A 1 70 ASP 70 223 ? ? ? A . n A 1 71 THR 71 224 ? ? ? A . n A 1 72 LYS 72 225 ? ? ? A . n A 1 73 LEU 73 226 ? ? ? A . n A 1 74 ASN 74 227 ? ? ? A . n A 1 75 PHE 75 228 ? ? ? A . n A 1 76 SER 76 229 ? ? ? A . n A 1 77 ASN 77 230 ? ? ? A . n A 1 78 LEU 78 231 ? ? ? A . n A 1 79 LEU 79 232 ? ? ? A . n A 1 80 MET 80 233 ? ? ? A . n A 1 81 MET 81 234 ? ? ? A . n A 1 82 TYR 82 235 ? ? ? A . n A 1 83 GLN 83 236 ? ? ? A . n A 1 84 ASP 84 237 ? ? ? A . n A 1 85 SER 85 238 ? ? ? A . n A 1 86 GLY 86 239 ? ? ? A . n A 1 87 SER 87 240 ? ? ? A . n A 1 88 PRO 88 241 ? ? ? A . n A 1 89 ASP 89 242 ? ? ? A . n A 1 90 SER 90 243 ? ? ? A . n A 1 91 SER 91 244 ? ? ? A . n A 1 92 GLU 92 245 ? ? ? A . n A 1 93 GLU 93 246 ? ? ? A . n A 1 94 ASP 94 247 ? ? ? A . n A 1 95 GLN 95 248 ? ? ? A . n A 1 96 GLN 96 249 ? ? ? A . n A 1 97 SER 97 250 ? ? ? A . n A 1 98 ARG 98 251 251 ARG ARG A . n A 1 99 LEU 99 252 252 LEU LEU A . n A 1 100 SER 100 253 253 SER SER A . n A 1 101 MET 101 254 254 MET MET A . n A 1 102 LEU 102 255 255 LEU LEU A . n A 1 103 PRO 103 256 256 PRO PRO A . n A 1 104 HIS 104 257 257 HIS HIS A . n A 1 105 LEU 105 258 258 LEU LEU A . n A 1 106 ALA 106 259 259 ALA ALA A . n A 1 107 ASP 107 260 260 ASP ASP A . n A 1 108 LEU 108 261 261 LEU LEU A . n A 1 109 VAL 109 262 262 VAL VAL A . n A 1 110 SER 110 263 263 SER SER A . n A 1 111 TYR 111 264 264 TYR TYR A . n A 1 112 SER 112 265 265 SER SER A . n A 1 113 ILE 113 266 266 ILE ILE A . n A 1 114 GLN 114 267 267 GLN GLN A . n A 1 115 LYS 115 268 268 LYS LYS A . n A 1 116 VAL 116 269 269 VAL VAL A . n A 1 117 ILE 117 270 270 ILE ILE A . n A 1 118 GLY 118 271 271 GLY GLY A . n A 1 119 PHE 119 272 272 PHE PHE A . n A 1 120 ALA 120 273 273 ALA ALA A . n A 1 121 LYS 121 274 274 LYS LYS A . n A 1 122 MET 122 275 275 MET MET A . n A 1 123 ILE 123 276 276 ILE ILE A . n A 1 124 PRO 124 277 277 PRO PRO A . n A 1 125 GLY 125 278 278 GLY GLY A . n A 1 126 PHE 126 279 279 PHE PHE A . n A 1 127 ARG 127 280 280 ARG ARG A . n A 1 128 ASP 128 281 281 ASP ASP A . n A 1 129 LEU 129 282 282 LEU LEU A . n A 1 130 THR 130 283 283 THR THR A . n A 1 131 ALA 131 284 284 ALA ALA A . n A 1 132 GLU 132 285 285 GLU GLU A . n A 1 133 ASP 133 286 286 ASP ASP A . n A 1 134 GLN 134 287 287 GLN GLN A . n A 1 135 ILE 135 288 288 ILE ILE A . n A 1 136 ALA 136 289 289 ALA ALA A . n A 1 137 LEU 137 290 290 LEU LEU A . n A 1 138 LEU 138 291 291 LEU LEU A . n A 1 139 LYS 139 292 292 LYS LYS A . n A 1 140 SER 140 293 293 SER SER A . n A 1 141 SER 141 294 294 SER SER A . n A 1 142 ALA 142 295 295 ALA ALA A . n A 1 143 ILE 143 296 296 ILE ILE A . n A 1 144 GLU 144 297 297 GLU GLU A . n A 1 145 ILE 145 298 298 ILE ILE A . n A 1 146 ILE 146 299 299 ILE ILE A . n A 1 147 MET 147 300 300 MET MET A . n A 1 148 LEU 148 301 301 LEU LEU A . n A 1 149 ARG 149 302 302 ARG ARG A . n A 1 150 SER 150 303 303 SER SER A . n A 1 151 ASN 151 304 304 ASN ASN A . n A 1 152 GLN 152 305 305 GLN GLN A . n A 1 153 SER 153 306 306 SER SER A . n A 1 154 PHE 154 307 307 PHE PHE A . n A 1 155 SER 155 308 308 SER SER A . n A 1 156 LEU 156 309 309 LEU LEU A . n A 1 157 GLU 157 310 310 GLU GLU A . n A 1 158 ASP 158 311 311 ASP ASP A . n A 1 159 MET 159 312 312 MET MET A . n A 1 160 SER 160 313 313 SER SER A . n A 1 161 TRP 161 314 314 TRP TRP A . n A 1 162 SER 162 315 315 SER SER A . n A 1 163 CYS 163 316 316 CYS CYS A . n A 1 164 GLY 164 317 317 GLY GLY A . n A 1 165 GLY 165 318 318 GLY GLY A . n A 1 166 PRO 166 319 319 PRO PRO A . n A 1 167 ASP 167 320 320 ASP ASP A . n A 1 168 PHE 168 321 321 PHE PHE A . n A 1 169 LYS 169 322 322 LYS LYS A . n A 1 170 TYR 170 323 323 TYR TYR A . n A 1 171 CYS 171 324 324 CYS CYS A . n A 1 172 ILE 172 325 325 ILE ILE A . n A 1 173 ASN 173 326 326 ASN ASN A . n A 1 174 ASP 174 327 327 ASP ASP A . n A 1 175 VAL 175 328 328 VAL VAL A . n A 1 176 THR 176 329 329 THR THR A . n A 1 177 LYS 177 330 330 LYS LYS A . n A 1 178 ALA 178 331 331 ALA ALA A . n A 1 179 GLY 179 332 332 GLY GLY A . n A 1 180 HIS 180 333 333 HIS HIS A . n A 1 181 THR 181 334 334 THR THR A . n A 1 182 LEU 182 335 335 LEU LEU A . n A 1 183 GLU 183 336 336 GLU GLU A . n A 1 184 LEU 184 337 337 LEU LEU A . n A 1 185 LEU 185 338 338 LEU LEU A . n A 1 186 GLU 186 339 339 GLU GLU A . n A 1 187 PRO 187 340 340 PRO PRO A . n A 1 188 LEU 188 341 341 LEU LEU A . n A 1 189 VAL 189 342 342 VAL VAL A . n A 1 190 LYS 190 343 343 LYS LYS A . n A 1 191 PHE 191 344 344 PHE PHE A . n A 1 192 GLN 192 345 345 GLN GLN A . n A 1 193 VAL 193 346 346 VAL VAL A . n A 1 194 GLY 194 347 347 GLY GLY A . n A 1 195 LEU 195 348 348 LEU LEU A . n A 1 196 LYS 196 349 349 LYS LYS A . n A 1 197 LYS 197 350 350 LYS LYS A . n A 1 198 LEU 198 351 351 LEU LEU A . n A 1 199 LYS 199 352 352 LYS LYS A . n A 1 200 LEU 200 353 353 LEU LEU A . n A 1 201 HIS 201 354 354 HIS HIS A . n A 1 202 GLU 202 355 355 GLU GLU A . n A 1 203 GLU 203 356 356 GLU GLU A . n A 1 204 GLU 204 357 357 GLU GLU A . n A 1 205 HIS 205 358 358 HIS HIS A . n A 1 206 VAL 206 359 359 VAL VAL A . n A 1 207 LEU 207 360 360 LEU LEU A . n A 1 208 LEU 208 361 361 LEU LEU A . n A 1 209 MET 209 362 362 MET MET A . n A 1 210 ALA 210 363 363 ALA ALA A . n A 1 211 ILE 211 364 364 ILE ILE A . n A 1 212 CYS 212 365 365 CYS CYS A . n A 1 213 LEU 213 366 366 LEU LEU A . n A 1 214 LEU 214 367 367 LEU LEU A . n A 1 215 SER 215 368 368 SER SER A . n A 1 216 PRO 216 369 369 PRO PRO A . n A 1 217 ASP 217 370 370 ASP ASP A . n A 1 218 ARG 218 371 371 ARG ARG A . n A 1 219 PRO 219 372 372 PRO PRO A . n A 1 220 GLY 220 373 373 GLY GLY A . n A 1 221 VAL 221 374 374 VAL VAL A . n A 1 222 GLN 222 375 375 GLN GLN A . n A 1 223 ASP 223 376 376 ASP ASP A . n A 1 224 HIS 224 377 377 HIS HIS A . n A 1 225 VAL 225 378 378 VAL VAL A . n A 1 226 ARG 226 379 379 ARG ARG A . n A 1 227 ILE 227 380 380 ILE ILE A . n A 1 228 GLU 228 381 381 GLU GLU A . n A 1 229 ALA 229 382 382 ALA ALA A . n A 1 230 LEU 230 383 383 LEU LEU A . n A 1 231 GLN 231 384 384 GLN GLN A . n A 1 232 ASP 232 385 385 ASP ASP A . n A 1 233 ARG 233 386 386 ARG ARG A . n A 1 234 LEU 234 387 387 LEU LEU A . n A 1 235 CYS 235 388 388 CYS CYS A . n A 1 236 ASP 236 389 389 ASP ASP A . n A 1 237 VAL 237 390 390 VAL VAL A . n A 1 238 LEU 238 391 391 LEU LEU A . n A 1 239 GLN 239 392 392 GLN GLN A . n A 1 240 ALA 240 393 393 ALA ALA A . n A 1 241 TYR 241 394 394 TYR TYR A . n A 1 242 ILE 242 395 395 ILE ILE A . n A 1 243 ARG 243 396 396 ARG ARG A . n A 1 244 ILE 244 397 397 ILE ILE A . n A 1 245 GLN 245 398 398 GLN GLN A . n A 1 246 HIS 246 399 399 HIS HIS A . n A 1 247 PRO 247 400 400 PRO PRO A . n A 1 248 GLY 248 401 401 GLY GLY A . n A 1 249 GLY 249 402 402 GLY GLY A . n A 1 250 ARG 250 403 403 ARG ARG A . n A 1 251 LEU 251 404 404 LEU LEU A . n A 1 252 LEU 252 405 405 LEU LEU A . n A 1 253 TYR 253 406 406 TYR TYR A . n A 1 254 ALA 254 407 407 ALA ALA A . n A 1 255 LYS 255 408 408 LYS LYS A . n A 1 256 MET 256 409 409 MET MET A . n A 1 257 ILE 257 410 410 ILE ILE A . n A 1 258 GLN 258 411 411 GLN GLN A . n A 1 259 LYS 259 412 412 LYS LYS A . n A 1 260 LEU 260 413 413 LEU LEU A . n A 1 261 ALA 261 414 414 ALA ALA A . n A 1 262 ASP 262 415 415 ASP ASP A . n A 1 263 LEU 263 416 416 LEU LEU A . n A 1 264 ARG 264 417 417 ARG ARG A . n A 1 265 SER 265 418 418 SER SER A . n A 1 266 LEU 266 419 419 LEU LEU A . n A 1 267 ASN 267 420 420 ASN ASN A . n A 1 268 GLU 268 421 421 GLU GLU A . n A 1 269 GLU 269 422 422 GLU GLU A . n A 1 270 HIS 270 423 423 HIS HIS A . n A 1 271 SER 271 424 424 SER SER A . n A 1 272 LYS 272 425 425 LYS LYS A . n A 1 273 GLN 273 426 426 GLN GLN A . n A 1 274 TYR 274 427 427 TYR TYR A . n A 1 275 ARG 275 428 428 ARG ARG A . n A 1 276 SER 276 429 429 SER SER A . n A 1 277 LEU 277 430 430 LEU LEU A . n A 1 278 SER 278 431 431 SER SER A . n A 1 279 PHE 279 432 432 PHE PHE A . n A 1 280 GLN 280 433 433 GLN GLN A . n A 1 281 PRO 281 434 434 PRO PRO A . n A 1 282 GLU 282 435 435 GLU GLU A . n A 1 283 HIS 283 436 436 HIS HIS A . n A 1 284 SER 284 437 437 SER SER A . n A 1 285 MET 285 438 438 MET MET A . n A 1 286 GLN 286 439 439 GLN GLN A . n A 1 287 LEU 287 440 440 LEU LEU A . n A 1 288 THR 288 441 441 THR THR A . n A 1 289 PRO 289 442 442 PRO PRO A . n A 1 290 LEU 290 443 443 LEU LEU A . n A 1 291 VAL 291 444 444 VAL VAL A . n A 1 292 LEU 292 445 445 LEU LEU A . n A 1 293 GLU 293 446 446 GLU GLU A . n A 1 294 VAL 294 447 447 VAL VAL A . n A 1 295 PHE 295 448 448 PHE PHE A . n A 1 296 GLY 296 449 449 GLY GLY A . n A 1 297 SER 297 450 450 SER SER A . n A 1 298 GLU 298 451 451 GLU ALA A . n A 1 299 VAL 299 452 452 VAL ALA A . n A 1 300 SER 300 453 ? ? ? A . n B 2 1 ARG 1 687 ? ? ? B . n B 2 2 HIS 2 688 688 HIS HIS B . n B 2 3 LYS 3 689 689 LYS LYS B . n B 2 4 ILE 4 690 690 ILE ILE B . n B 2 5 LEU 5 691 691 LEU LEU B . n B 2 6 HIS 6 692 692 HIS HIS B . n B 2 7 ARG 7 693 693 ARG ARG B . n B 2 8 LEU 8 694 694 LEU LEU B . n B 2 9 LEU 9 695 695 LEU LEU B . n B 2 10 GLN 10 696 696 GLN ALA B . n B 2 11 GLU 11 697 ? ? ? B . n B 2 12 GLY 12 698 ? ? ? B . n B 2 13 SER 13 699 ? ? ? B . n B 2 14 PRO 14 700 ? ? ? B . n B 2 15 SER 15 701 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 DZW 1 501 1 DZW LX5 A . D 4 HOH 1 601 28 HOH HOH A . D 4 HOH 2 602 38 HOH HOH A . D 4 HOH 3 603 13 HOH HOH A . D 4 HOH 4 604 18 HOH HOH A . D 4 HOH 5 605 6 HOH HOH A . D 4 HOH 6 606 2 HOH HOH A . D 4 HOH 7 607 45 HOH HOH A . D 4 HOH 8 608 4 HOH HOH A . D 4 HOH 9 609 33 HOH HOH A . D 4 HOH 10 610 7 HOH HOH A . D 4 HOH 11 611 14 HOH HOH A . D 4 HOH 12 612 9 HOH HOH A . D 4 HOH 13 613 32 HOH HOH A . D 4 HOH 14 614 26 HOH HOH A . D 4 HOH 15 615 35 HOH HOH A . D 4 HOH 16 616 25 HOH HOH A . D 4 HOH 17 617 37 HOH HOH A . D 4 HOH 18 618 20 HOH HOH A . D 4 HOH 19 619 34 HOH HOH A . D 4 HOH 20 620 43 HOH HOH A . D 4 HOH 21 621 1 HOH HOH A . D 4 HOH 22 622 24 HOH HOH A . D 4 HOH 23 623 21 HOH HOH A . D 4 HOH 24 624 3 HOH HOH A . D 4 HOH 25 625 36 HOH HOH A . D 4 HOH 26 626 31 HOH HOH A . D 4 HOH 27 627 27 HOH HOH A . D 4 HOH 28 628 12 HOH HOH A . D 4 HOH 29 629 42 HOH HOH A . D 4 HOH 30 630 15 HOH HOH A . D 4 HOH 31 631 17 HOH HOH A . D 4 HOH 32 632 40 HOH HOH A . D 4 HOH 33 633 39 HOH HOH A . D 4 HOH 34 634 5 HOH HOH A . D 4 HOH 35 635 10 HOH HOH A . D 4 HOH 36 636 8 HOH HOH A . D 4 HOH 37 637 46 HOH HOH A . D 4 HOH 38 638 30 HOH HOH A . D 4 HOH 39 639 19 HOH HOH A . D 4 HOH 40 640 41 HOH HOH A . D 4 HOH 41 641 11 HOH HOH A . D 4 HOH 42 642 44 HOH HOH A . D 4 HOH 43 643 16 HOH HOH A . E 4 HOH 1 801 29 HOH HOH B . E 4 HOH 2 802 23 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 451 ? CG ? A GLU 298 CG 2 1 Y 1 A GLU 451 ? CD ? A GLU 298 CD 3 1 Y 1 A GLU 451 ? OE1 ? A GLU 298 OE1 4 1 Y 1 A GLU 451 ? OE2 ? A GLU 298 OE2 5 1 Y 1 A VAL 452 ? CG1 ? A VAL 299 CG1 6 1 Y 1 A VAL 452 ? CG2 ? A VAL 299 CG2 7 1 Y 0 B LYS 689 ? CG ? B LYS 3 CG 8 1 Y 0 B LYS 689 ? CD ? B LYS 3 CD 9 1 Y 0 B LYS 689 ? CE ? B LYS 3 CE 10 1 Y 0 B LYS 689 ? NZ ? B LYS 3 NZ 11 1 Y 1 B GLN 696 ? CG ? B GLN 10 CG 12 1 Y 1 B GLN 696 ? CD ? B GLN 10 CD 13 1 Y 1 B GLN 696 ? OE1 ? B GLN 10 OE1 14 1 Y 1 B GLN 696 ? NE2 ? B GLN 10 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.2 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6FOB _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.220 _cell.length_a_esd ? _cell.length_b 66.220 _cell.length_b_esd ? _cell.length_c 264.200 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6FOB _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6FOB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.49 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'BisTris pH 6.5, 1.6 M lithium sulfate and 50 mM magnesium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-01-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0721 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0721 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 1' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate 67.11 _reflns.entry_id 6FOB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.75 _reflns.d_resolution_low 25 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9781 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.115 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.75 _reflns_shell.d_res_low 2.85 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 74.9 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value 0.272 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -14.4465 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -14.4465 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 28.8931 _refine.B_iso_max ? _refine.B_iso_mean 79.90 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.9244 _refine.correlation_coeff_Fo_to_Fc_free 0.9062 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6FOB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.75 _refine.ls_d_res_low 24.03 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9117 _refine.ls_number_reflns_R_free 476 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.33 _refine.ls_percent_reflns_R_free 5.22 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1788 _refine.ls_R_factor_R_free 0.2288 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1758 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2HC4 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.304 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.314 _refine.pdbx_overall_SU_R_Blow_DPI 3.954 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.763 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 6FOB _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.315 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1982 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.number_atoms_solvent 45 _refine_hist.number_atoms_total 2061 _refine_hist.d_res_high 2.75 _refine_hist.d_res_low 24.03 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 2059 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.13 ? 2774 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 753 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 49 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 301 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2059 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.45 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 20.12 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 260 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 2519 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.75 _refine_ls_shell.d_res_low 3.07 _refine_ls_shell.number_reflns_all 2191 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 106 _refine_ls_shell.number_reflns_R_work 2085 _refine_ls_shell.percent_reflns_obs 82.83 _refine_ls_shell.percent_reflns_R_free 4.84 _refine_ls_shell.R_factor_all 0.2056 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2644 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2026 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6FOB _struct.title 'Vitamin D receptor complex 5' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6FOB _struct_keywords.text 'GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP VDRA_DANRE Q9PTN2 ? 1 ;LSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVREGPVTRSASRAASLHSLSDASSDSFNHSPESVDTKLNFSNLLMMY QDSGSPDSSEEDQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSWS CGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQAYI RIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS ; 156 2 PDB 6FOB 6FOB ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6FOB A 3 ? 300 ? Q9PTN2 156 ? 453 ? 156 453 2 2 6FOB B 1 ? 15 ? 6FOB 687 ? 701 ? 687 701 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6FOB HIS A 1 ? UNP Q9PTN2 ? ? 'expression tag' 154 1 1 6FOB MET A 2 ? UNP Q9PTN2 ? ? 'expression tag' 155 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3910 ? 1 MORE -34 ? 1 'SSA (A^2)' 21720 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+1/6 0.5000000000 -0.8660254038 0.0000000000 33.1100000000 -0.8660254038 -0.5000000000 0.0000000000 57.3482022386 0.0000000000 0.0000000000 -1.0000000000 44.0333333333 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 4 ? TYR A 22 ? SER A 157 TYR A 175 1 ? 19 HELX_P HELX_P2 AA2 TYR A 26 ? PHE A 32 ? TYR A 179 PHE A 185 5 ? 7 HELX_P HELX_P3 AA3 MET A 101 ? LYS A 121 ? MET A 254 LYS A 274 1 ? 21 HELX_P HELX_P4 AA4 THR A 130 ? SER A 150 ? THR A 283 SER A 303 1 ? 21 HELX_P HELX_P5 AA5 CYS A 171 ? LYS A 177 ? CYS A 324 LYS A 330 1 ? 7 HELX_P HELX_P6 AA6 THR A 181 ? LEU A 198 ? THR A 334 LEU A 351 1 ? 18 HELX_P HELX_P7 AA7 HIS A 201 ? LEU A 214 ? HIS A 354 LEU A 367 1 ? 14 HELX_P HELX_P8 AA8 VAL A 225 ? HIS A 246 ? VAL A 378 HIS A 399 1 ? 22 HELX_P HELX_P9 AA9 LEU A 251 ? PHE A 279 ? LEU A 404 PHE A 432 1 ? 29 HELX_P HELX_P10 AB1 GLN A 280 ? MET A 285 ? GLN A 433 MET A 438 1 ? 6 HELX_P HELX_P11 AB2 THR A 288 ? GLY A 296 ? THR A 441 GLY A 449 1 ? 9 HELX_P HELX_P12 AB3 LYS B 3 ? LEU B 9 ? LYS B 689 LEU B 695 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 154 ? SER A 155 ? PHE A 307 SER A 308 AA1 2 SER A 160 ? SER A 162 ? SER A 313 SER A 315 AA1 3 LYS A 169 ? TYR A 170 ? LYS A 322 TYR A 323 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 155 ? N SER A 308 O SER A 160 ? O SER A 313 AA1 2 3 N TRP A 161 ? N TRP A 314 O TYR A 170 ? O TYR A 323 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id DZW _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 16 _struct_site.details 'binding site for residue DZW A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 TYR A 22 ? TYR A 175 . ? 1_555 ? 2 AC1 16 MET A 101 ? MET A 254 . ? 1_555 ? 3 AC1 16 LEU A 105 ? LEU A 258 . ? 1_555 ? 4 AC1 16 SER A 112 ? SER A 265 . ? 1_555 ? 5 AC1 16 ILE A 146 ? ILE A 299 . ? 1_555 ? 6 AC1 16 MET A 147 ? MET A 300 . ? 1_555 ? 7 AC1 16 ARG A 149 ? ARG A 302 . ? 1_555 ? 8 AC1 16 SER A 150 ? SER A 303 . ? 1_555 ? 9 AC1 16 SER A 153 ? SER A 306 . ? 1_555 ? 10 AC1 16 TRP A 161 ? TRP A 314 . ? 1_555 ? 11 AC1 16 CYS A 163 ? CYS A 316 . ? 1_555 ? 12 AC1 16 TYR A 170 ? TYR A 323 . ? 1_555 ? 13 AC1 16 HIS A 180 ? HIS A 333 . ? 1_555 ? 14 AC1 16 HIS A 270 ? HIS A 423 . ? 1_555 ? 15 AC1 16 TYR A 274 ? TYR A 427 . ? 1_555 ? 16 AC1 16 PHE A 295 ? PHE A 448 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 352 ? ? 38.47 52.26 2 1 ASP A 370 ? ? -68.73 64.67 3 1 HIS A 377 ? ? -67.28 3.31 4 1 LEU B 695 ? ? -85.69 31.58 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 8.7724 _pdbx_refine_tls.origin_y 37.0993 _pdbx_refine_tls.origin_z 42.3750 _pdbx_refine_tls.T[1][1] -0.1312 _pdbx_refine_tls.T[2][2] -0.0911 _pdbx_refine_tls.T[3][3] -0.2229 _pdbx_refine_tls.T[1][2] 0.1217 _pdbx_refine_tls.T[1][3] -0.0796 _pdbx_refine_tls.T[2][3] -0.0498 _pdbx_refine_tls.L[1][1] 2.1289 _pdbx_refine_tls.L[2][2] 3.4135 _pdbx_refine_tls.L[3][3] 5.4896 _pdbx_refine_tls.L[1][2] -0.7267 _pdbx_refine_tls.L[1][3] 0.4729 _pdbx_refine_tls.L[2][3] 2.4266 _pdbx_refine_tls.S[1][1] -0.2488 _pdbx_refine_tls.S[1][2] -0.5520 _pdbx_refine_tls.S[1][3] 0.0120 _pdbx_refine_tls.S[2][1] 0.5545 _pdbx_refine_tls.S[2][2] 0.2885 _pdbx_refine_tls.S[2][3] -0.1002 _pdbx_refine_tls.S[3][1] 0.4364 _pdbx_refine_tls.S[3][2] -0.0592 _pdbx_refine_tls.S[3][3] -0.0397 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|* }' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 154 ? A HIS 1 2 1 Y 1 A GLU 191 ? A GLU 38 3 1 Y 1 A GLY 192 ? A GLY 39 4 1 Y 1 A PRO 193 ? A PRO 40 5 1 Y 1 A VAL 194 ? A VAL 41 6 1 Y 1 A THR 195 ? A THR 42 7 1 Y 1 A ARG 196 ? A ARG 43 8 1 Y 1 A SER 197 ? A SER 44 9 1 Y 1 A ALA 198 ? A ALA 45 10 1 Y 1 A SER 199 ? A SER 46 11 1 Y 1 A ARG 200 ? A ARG 47 12 1 Y 1 A ALA 201 ? A ALA 48 13 1 Y 1 A ALA 202 ? A ALA 49 14 1 Y 1 A SER 203 ? A SER 50 15 1 Y 1 A LEU 204 ? A LEU 51 16 1 Y 1 A HIS 205 ? A HIS 52 17 1 Y 1 A SER 206 ? A SER 53 18 1 Y 1 A LEU 207 ? A LEU 54 19 1 Y 1 A SER 208 ? A SER 55 20 1 Y 1 A ASP 209 ? A ASP 56 21 1 Y 1 A ALA 210 ? A ALA 57 22 1 Y 1 A SER 211 ? A SER 58 23 1 Y 1 A SER 212 ? A SER 59 24 1 Y 1 A ASP 213 ? A ASP 60 25 1 Y 1 A SER 214 ? A SER 61 26 1 Y 1 A PHE 215 ? A PHE 62 27 1 Y 1 A ASN 216 ? A ASN 63 28 1 Y 1 A HIS 217 ? A HIS 64 29 1 Y 1 A SER 218 ? A SER 65 30 1 Y 1 A PRO 219 ? A PRO 66 31 1 Y 1 A GLU 220 ? A GLU 67 32 1 Y 1 A SER 221 ? A SER 68 33 1 Y 1 A VAL 222 ? A VAL 69 34 1 Y 1 A ASP 223 ? A ASP 70 35 1 Y 1 A THR 224 ? A THR 71 36 1 Y 1 A LYS 225 ? A LYS 72 37 1 Y 1 A LEU 226 ? A LEU 73 38 1 Y 1 A ASN 227 ? A ASN 74 39 1 Y 1 A PHE 228 ? A PHE 75 40 1 Y 1 A SER 229 ? A SER 76 41 1 Y 1 A ASN 230 ? A ASN 77 42 1 Y 1 A LEU 231 ? A LEU 78 43 1 Y 1 A LEU 232 ? A LEU 79 44 1 Y 1 A MET 233 ? A MET 80 45 1 Y 1 A MET 234 ? A MET 81 46 1 Y 1 A TYR 235 ? A TYR 82 47 1 Y 1 A GLN 236 ? A GLN 83 48 1 Y 1 A ASP 237 ? A ASP 84 49 1 Y 1 A SER 238 ? A SER 85 50 1 Y 1 A GLY 239 ? A GLY 86 51 1 Y 1 A SER 240 ? A SER 87 52 1 Y 1 A PRO 241 ? A PRO 88 53 1 Y 1 A ASP 242 ? A ASP 89 54 1 Y 1 A SER 243 ? A SER 90 55 1 Y 1 A SER 244 ? A SER 91 56 1 Y 1 A GLU 245 ? A GLU 92 57 1 Y 1 A GLU 246 ? A GLU 93 58 1 Y 1 A ASP 247 ? A ASP 94 59 1 Y 1 A GLN 248 ? A GLN 95 60 1 Y 1 A GLN 249 ? A GLN 96 61 1 Y 1 A SER 250 ? A SER 97 62 1 Y 1 A SER 453 ? A SER 300 63 1 Y 1 B ARG 687 ? B ARG 1 64 1 Y 1 B GLU 697 ? B GLU 11 65 1 Y 1 B GLY 698 ? B GLY 12 66 1 Y 1 B SER 699 ? B SER 13 67 1 Y 1 B PRO 700 ? B PRO 14 68 1 Y 1 B SER 701 ? B SER 15 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DZW C1 C N N 88 DZW C2 C N N 89 DZW C3 C N N 90 DZW C4 C N N 91 DZW C5 C N N 92 DZW C6 C N N 93 DZW C7 C N N 94 DZW C8 C N N 95 DZW O9 O N N 96 DZW C10 C N N 97 DZW C11 C N N 98 DZW C12 C N N 99 DZW C13 C N N 100 DZW C14 C N N 101 DZW C15 C N N 102 DZW C16 C N N 103 DZW C17 C N N 104 DZW C18 C Y N 105 DZW C19 C Y N 106 DZW C20 C Y N 107 DZW C21 C Y N 108 DZW C22 C Y N 109 DZW C23 C Y N 110 DZW C24 C N N 111 DZW C25 C N N 112 DZW C26 C N N 113 DZW C27 C N N 114 DZW C28 C N N 115 DZW C29 C N S 116 DZW O30 O N N 117 DZW C31 C N N 118 DZW C32 C N R 119 DZW O33 O N N 120 DZW C34 C N N 121 DZW H1 H N N 122 DZW H2 H N N 123 DZW H3 H N N 124 DZW H4 H N N 125 DZW H5 H N N 126 DZW H6 H N N 127 DZW H7 H N N 128 DZW H8 H N N 129 DZW H9 H N N 130 DZW H10 H N N 131 DZW H11 H N N 132 DZW H12 H N N 133 DZW H13 H N N 134 DZW H14 H N N 135 DZW H15 H N N 136 DZW H16 H N N 137 DZW H17 H N N 138 DZW H18 H N N 139 DZW H19 H N N 140 DZW H20 H N N 141 DZW H21 H N N 142 DZW H22 H N N 143 DZW H23 H N N 144 DZW H24 H N N 145 DZW H25 H N N 146 DZW H26 H N N 147 DZW H27 H N N 148 DZW H28 H N N 149 DZW H29 H N N 150 DZW H30 H N N 151 DZW H31 H N N 152 DZW H32 H N N 153 DZW H33 H N N 154 DZW H34 H N N 155 DZW H35 H N N 156 DZW H36 H N N 157 DZW H37 H N N 158 DZW H38 H N N 159 DZW H39 H N N 160 DZW H40 H N N 161 DZW H41 H N N 162 DZW H42 H N N 163 DZW H43 H N N 164 DZW H44 H N N 165 DZW H45 H N N 166 DZW H46 H N N 167 DZW H47 H N N 168 DZW H48 H N N 169 GLN N N N N 170 GLN CA C N S 171 GLN C C N N 172 GLN O O N N 173 GLN CB C N N 174 GLN CG C N N 175 GLN CD C N N 176 GLN OE1 O N N 177 GLN NE2 N N N 178 GLN OXT O N N 179 GLN H H N N 180 GLN H2 H N N 181 GLN HA H N N 182 GLN HB2 H N N 183 GLN HB3 H N N 184 GLN HG2 H N N 185 GLN HG3 H N N 186 GLN HE21 H N N 187 GLN HE22 H N N 188 GLN HXT H N N 189 GLU N N N N 190 GLU CA C N S 191 GLU C C N N 192 GLU O O N N 193 GLU CB C N N 194 GLU CG C N N 195 GLU CD C N N 196 GLU OE1 O N N 197 GLU OE2 O N N 198 GLU OXT O N N 199 GLU H H N N 200 GLU H2 H N N 201 GLU HA H N N 202 GLU HB2 H N N 203 GLU HB3 H N N 204 GLU HG2 H N N 205 GLU HG3 H N N 206 GLU HE2 H N N 207 GLU HXT H N N 208 GLY N N N N 209 GLY CA C N N 210 GLY C C N N 211 GLY O O N N 212 GLY OXT O N N 213 GLY H H N N 214 GLY H2 H N N 215 GLY HA2 H N N 216 GLY HA3 H N N 217 GLY HXT H N N 218 HIS N N N N 219 HIS CA C N S 220 HIS C C N N 221 HIS O O N N 222 HIS CB C N N 223 HIS CG C Y N 224 HIS ND1 N Y N 225 HIS CD2 C Y N 226 HIS CE1 C Y N 227 HIS NE2 N Y N 228 HIS OXT O N N 229 HIS H H N N 230 HIS H2 H N N 231 HIS HA H N N 232 HIS HB2 H N N 233 HIS HB3 H N N 234 HIS HD1 H N N 235 HIS HD2 H N N 236 HIS HE1 H N N 237 HIS HE2 H N N 238 HIS HXT H N N 239 HOH O O N N 240 HOH H1 H N N 241 HOH H2 H N N 242 ILE N N N N 243 ILE CA C N S 244 ILE C C N N 245 ILE O O N N 246 ILE CB C N S 247 ILE CG1 C N N 248 ILE CG2 C N N 249 ILE CD1 C N N 250 ILE OXT O N N 251 ILE H H N N 252 ILE H2 H N N 253 ILE HA H N N 254 ILE HB H N N 255 ILE HG12 H N N 256 ILE HG13 H N N 257 ILE HG21 H N N 258 ILE HG22 H N N 259 ILE HG23 H N N 260 ILE HD11 H N N 261 ILE HD12 H N N 262 ILE HD13 H N N 263 ILE HXT H N N 264 LEU N N N N 265 LEU CA C N S 266 LEU C C N N 267 LEU O O N N 268 LEU CB C N N 269 LEU CG C N N 270 LEU CD1 C N N 271 LEU CD2 C N N 272 LEU OXT O N N 273 LEU H H N N 274 LEU H2 H N N 275 LEU HA H N N 276 LEU HB2 H N N 277 LEU HB3 H N N 278 LEU HG H N N 279 LEU HD11 H N N 280 LEU HD12 H N N 281 LEU HD13 H N N 282 LEU HD21 H N N 283 LEU HD22 H N N 284 LEU HD23 H N N 285 LEU HXT H N N 286 LYS N N N N 287 LYS CA C N S 288 LYS C C N N 289 LYS O O N N 290 LYS CB C N N 291 LYS CG C N N 292 LYS CD C N N 293 LYS CE C N N 294 LYS NZ N N N 295 LYS OXT O N N 296 LYS H H N N 297 LYS H2 H N N 298 LYS HA H N N 299 LYS HB2 H N N 300 LYS HB3 H N N 301 LYS HG2 H N N 302 LYS HG3 H N N 303 LYS HD2 H N N 304 LYS HD3 H N N 305 LYS HE2 H N N 306 LYS HE3 H N N 307 LYS HZ1 H N N 308 LYS HZ2 H N N 309 LYS HZ3 H N N 310 LYS HXT H N N 311 MET N N N N 312 MET CA C N S 313 MET C C N N 314 MET O O N N 315 MET CB C N N 316 MET CG C N N 317 MET SD S N N 318 MET CE C N N 319 MET OXT O N N 320 MET H H N N 321 MET H2 H N N 322 MET HA H N N 323 MET HB2 H N N 324 MET HB3 H N N 325 MET HG2 H N N 326 MET HG3 H N N 327 MET HE1 H N N 328 MET HE2 H N N 329 MET HE3 H N N 330 MET HXT H N N 331 PHE N N N N 332 PHE CA C N S 333 PHE C C N N 334 PHE O O N N 335 PHE CB C N N 336 PHE CG C Y N 337 PHE CD1 C Y N 338 PHE CD2 C Y N 339 PHE CE1 C Y N 340 PHE CE2 C Y N 341 PHE CZ C Y N 342 PHE OXT O N N 343 PHE H H N N 344 PHE H2 H N N 345 PHE HA H N N 346 PHE HB2 H N N 347 PHE HB3 H N N 348 PHE HD1 H N N 349 PHE HD2 H N N 350 PHE HE1 H N N 351 PHE HE2 H N N 352 PHE HZ H N N 353 PHE HXT H N N 354 PRO N N N N 355 PRO CA C N S 356 PRO C C N N 357 PRO O O N N 358 PRO CB C N N 359 PRO CG C N N 360 PRO CD C N N 361 PRO OXT O N N 362 PRO H H N N 363 PRO HA H N N 364 PRO HB2 H N N 365 PRO HB3 H N N 366 PRO HG2 H N N 367 PRO HG3 H N N 368 PRO HD2 H N N 369 PRO HD3 H N N 370 PRO HXT H N N 371 SER N N N N 372 SER CA C N S 373 SER C C N N 374 SER O O N N 375 SER CB C N N 376 SER OG O N N 377 SER OXT O N N 378 SER H H N N 379 SER H2 H N N 380 SER HA H N N 381 SER HB2 H N N 382 SER HB3 H N N 383 SER HG H N N 384 SER HXT H N N 385 THR N N N N 386 THR CA C N S 387 THR C C N N 388 THR O O N N 389 THR CB C N R 390 THR OG1 O N N 391 THR CG2 C N N 392 THR OXT O N N 393 THR H H N N 394 THR H2 H N N 395 THR HA H N N 396 THR HB H N N 397 THR HG1 H N N 398 THR HG21 H N N 399 THR HG22 H N N 400 THR HG23 H N N 401 THR HXT H N N 402 TRP N N N N 403 TRP CA C N S 404 TRP C C N N 405 TRP O O N N 406 TRP CB C N N 407 TRP CG C Y N 408 TRP CD1 C Y N 409 TRP CD2 C Y N 410 TRP NE1 N Y N 411 TRP CE2 C Y N 412 TRP CE3 C Y N 413 TRP CZ2 C Y N 414 TRP CZ3 C Y N 415 TRP CH2 C Y N 416 TRP OXT O N N 417 TRP H H N N 418 TRP H2 H N N 419 TRP HA H N N 420 TRP HB2 H N N 421 TRP HB3 H N N 422 TRP HD1 H N N 423 TRP HE1 H N N 424 TRP HE3 H N N 425 TRP HZ2 H N N 426 TRP HZ3 H N N 427 TRP HH2 H N N 428 TRP HXT H N N 429 TYR N N N N 430 TYR CA C N S 431 TYR C C N N 432 TYR O O N N 433 TYR CB C N N 434 TYR CG C Y N 435 TYR CD1 C Y N 436 TYR CD2 C Y N 437 TYR CE1 C Y N 438 TYR CE2 C Y N 439 TYR CZ C Y N 440 TYR OH O N N 441 TYR OXT O N N 442 TYR H H N N 443 TYR H2 H N N 444 TYR HA H N N 445 TYR HB2 H N N 446 TYR HB3 H N N 447 TYR HD1 H N N 448 TYR HD2 H N N 449 TYR HE1 H N N 450 TYR HE2 H N N 451 TYR HH H N N 452 TYR HXT H N N 453 VAL N N N N 454 VAL CA C N S 455 VAL C C N N 456 VAL O O N N 457 VAL CB C N N 458 VAL CG1 C N N 459 VAL CG2 C N N 460 VAL OXT O N N 461 VAL H H N N 462 VAL H2 H N N 463 VAL HA H N N 464 VAL HB H N N 465 VAL HG11 H N N 466 VAL HG12 H N N 467 VAL HG13 H N N 468 VAL HG21 H N N 469 VAL HG22 H N N 470 VAL HG23 H N N 471 VAL HXT H N N 472 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DZW C12 C10 sing N N 83 DZW C1 C2 sing N N 84 DZW C10 C11 sing N N 85 DZW C10 O9 sing N N 86 DZW C10 C13 sing N N 87 DZW C2 C3 sing N N 88 DZW C13 C14 sing N N 89 DZW C3 C4 sing N N 90 DZW C14 C15 sing N N 91 DZW C4 C5 sing N N 92 DZW C15 C16 sing N N 93 DZW C5 C6 sing N N 94 DZW C16 C17 sing N N 95 DZW C28 C27 doub N N 96 DZW C6 C7 sing N N 97 DZW C27 C26 sing N N 98 DZW C27 C29 sing N N 99 DZW C34 C26 sing N N 100 DZW C34 C32 sing N N 101 DZW O30 C29 sing N N 102 DZW C17 C18 sing N N 103 DZW C31 C29 sing N N 104 DZW C31 C32 sing N N 105 DZW C26 C25 doub N Z 106 DZW C32 O33 sing N N 107 DZW C19 C18 doub Y N 108 DZW C19 C23 sing Y N 109 DZW C25 C24 sing N N 110 DZW C7 C8 sing N N 111 DZW C18 C20 sing Y N 112 DZW C24 C8 doub N E 113 DZW C8 C23 sing N N 114 DZW C23 C22 doub Y N 115 DZW C20 C21 doub Y N 116 DZW C22 C21 sing Y N 117 DZW C1 H1 sing N N 118 DZW C1 H2 sing N N 119 DZW C1 H3 sing N N 120 DZW C2 H4 sing N N 121 DZW C2 H5 sing N N 122 DZW C3 H6 sing N N 123 DZW C3 H7 sing N N 124 DZW C4 H8 sing N N 125 DZW C4 H9 sing N N 126 DZW C5 H10 sing N N 127 DZW C5 H11 sing N N 128 DZW C6 H12 sing N N 129 DZW C6 H13 sing N N 130 DZW C7 H14 sing N N 131 DZW C7 H15 sing N N 132 DZW O9 H16 sing N N 133 DZW C11 H17 sing N N 134 DZW C11 H18 sing N N 135 DZW C11 H19 sing N N 136 DZW C12 H20 sing N N 137 DZW C12 H21 sing N N 138 DZW C12 H22 sing N N 139 DZW C13 H23 sing N N 140 DZW C13 H24 sing N N 141 DZW C14 H25 sing N N 142 DZW C14 H26 sing N N 143 DZW C15 H27 sing N N 144 DZW C15 H28 sing N N 145 DZW C16 H29 sing N N 146 DZW C16 H30 sing N N 147 DZW C17 H31 sing N N 148 DZW C17 H32 sing N N 149 DZW C19 H33 sing N N 150 DZW C20 H34 sing N N 151 DZW C21 H35 sing N N 152 DZW C22 H36 sing N N 153 DZW C24 H37 sing N N 154 DZW C25 H38 sing N N 155 DZW C28 H39 sing N N 156 DZW C28 H40 sing N N 157 DZW C29 H41 sing N N 158 DZW O30 H42 sing N N 159 DZW C31 H43 sing N N 160 DZW C31 H44 sing N N 161 DZW C32 H45 sing N N 162 DZW O33 H46 sing N N 163 DZW C34 H47 sing N N 164 DZW C34 H48 sing N N 165 GLN N CA sing N N 166 GLN N H sing N N 167 GLN N H2 sing N N 168 GLN CA C sing N N 169 GLN CA CB sing N N 170 GLN CA HA sing N N 171 GLN C O doub N N 172 GLN C OXT sing N N 173 GLN CB CG sing N N 174 GLN CB HB2 sing N N 175 GLN CB HB3 sing N N 176 GLN CG CD sing N N 177 GLN CG HG2 sing N N 178 GLN CG HG3 sing N N 179 GLN CD OE1 doub N N 180 GLN CD NE2 sing N N 181 GLN NE2 HE21 sing N N 182 GLN NE2 HE22 sing N N 183 GLN OXT HXT sing N N 184 GLU N CA sing N N 185 GLU N H sing N N 186 GLU N H2 sing N N 187 GLU CA C sing N N 188 GLU CA CB sing N N 189 GLU CA HA sing N N 190 GLU C O doub N N 191 GLU C OXT sing N N 192 GLU CB CG sing N N 193 GLU CB HB2 sing N N 194 GLU CB HB3 sing N N 195 GLU CG CD sing N N 196 GLU CG HG2 sing N N 197 GLU CG HG3 sing N N 198 GLU CD OE1 doub N N 199 GLU CD OE2 sing N N 200 GLU OE2 HE2 sing N N 201 GLU OXT HXT sing N N 202 GLY N CA sing N N 203 GLY N H sing N N 204 GLY N H2 sing N N 205 GLY CA C sing N N 206 GLY CA HA2 sing N N 207 GLY CA HA3 sing N N 208 GLY C O doub N N 209 GLY C OXT sing N N 210 GLY OXT HXT sing N N 211 HIS N CA sing N N 212 HIS N H sing N N 213 HIS N H2 sing N N 214 HIS CA C sing N N 215 HIS CA CB sing N N 216 HIS CA HA sing N N 217 HIS C O doub N N 218 HIS C OXT sing N N 219 HIS CB CG sing N N 220 HIS CB HB2 sing N N 221 HIS CB HB3 sing N N 222 HIS CG ND1 sing Y N 223 HIS CG CD2 doub Y N 224 HIS ND1 CE1 doub Y N 225 HIS ND1 HD1 sing N N 226 HIS CD2 NE2 sing Y N 227 HIS CD2 HD2 sing N N 228 HIS CE1 NE2 sing Y N 229 HIS CE1 HE1 sing N N 230 HIS NE2 HE2 sing N N 231 HIS OXT HXT sing N N 232 HOH O H1 sing N N 233 HOH O H2 sing N N 234 ILE N CA sing N N 235 ILE N H sing N N 236 ILE N H2 sing N N 237 ILE CA C sing N N 238 ILE CA CB sing N N 239 ILE CA HA sing N N 240 ILE C O doub N N 241 ILE C OXT sing N N 242 ILE CB CG1 sing N N 243 ILE CB CG2 sing N N 244 ILE CB HB sing N N 245 ILE CG1 CD1 sing N N 246 ILE CG1 HG12 sing N N 247 ILE CG1 HG13 sing N N 248 ILE CG2 HG21 sing N N 249 ILE CG2 HG22 sing N N 250 ILE CG2 HG23 sing N N 251 ILE CD1 HD11 sing N N 252 ILE CD1 HD12 sing N N 253 ILE CD1 HD13 sing N N 254 ILE OXT HXT sing N N 255 LEU N CA sing N N 256 LEU N H sing N N 257 LEU N H2 sing N N 258 LEU CA C sing N N 259 LEU CA CB sing N N 260 LEU CA HA sing N N 261 LEU C O doub N N 262 LEU C OXT sing N N 263 LEU CB CG sing N N 264 LEU CB HB2 sing N N 265 LEU CB HB3 sing N N 266 LEU CG CD1 sing N N 267 LEU CG CD2 sing N N 268 LEU CG HG sing N N 269 LEU CD1 HD11 sing N N 270 LEU CD1 HD12 sing N N 271 LEU CD1 HD13 sing N N 272 LEU CD2 HD21 sing N N 273 LEU CD2 HD22 sing N N 274 LEU CD2 HD23 sing N N 275 LEU OXT HXT sing N N 276 LYS N CA sing N N 277 LYS N H sing N N 278 LYS N H2 sing N N 279 LYS CA C sing N N 280 LYS CA CB sing N N 281 LYS CA HA sing N N 282 LYS C O doub N N 283 LYS C OXT sing N N 284 LYS CB CG sing N N 285 LYS CB HB2 sing N N 286 LYS CB HB3 sing N N 287 LYS CG CD sing N N 288 LYS CG HG2 sing N N 289 LYS CG HG3 sing N N 290 LYS CD CE sing N N 291 LYS CD HD2 sing N N 292 LYS CD HD3 sing N N 293 LYS CE NZ sing N N 294 LYS CE HE2 sing N N 295 LYS CE HE3 sing N N 296 LYS NZ HZ1 sing N N 297 LYS NZ HZ2 sing N N 298 LYS NZ HZ3 sing N N 299 LYS OXT HXT sing N N 300 MET N CA sing N N 301 MET N H sing N N 302 MET N H2 sing N N 303 MET CA C sing N N 304 MET CA CB sing N N 305 MET CA HA sing N N 306 MET C O doub N N 307 MET C OXT sing N N 308 MET CB CG sing N N 309 MET CB HB2 sing N N 310 MET CB HB3 sing N N 311 MET CG SD sing N N 312 MET CG HG2 sing N N 313 MET CG HG3 sing N N 314 MET SD CE sing N N 315 MET CE HE1 sing N N 316 MET CE HE2 sing N N 317 MET CE HE3 sing N N 318 MET OXT HXT sing N N 319 PHE N CA sing N N 320 PHE N H sing N N 321 PHE N H2 sing N N 322 PHE CA C sing N N 323 PHE CA CB sing N N 324 PHE CA HA sing N N 325 PHE C O doub N N 326 PHE C OXT sing N N 327 PHE CB CG sing N N 328 PHE CB HB2 sing N N 329 PHE CB HB3 sing N N 330 PHE CG CD1 doub Y N 331 PHE CG CD2 sing Y N 332 PHE CD1 CE1 sing Y N 333 PHE CD1 HD1 sing N N 334 PHE CD2 CE2 doub Y N 335 PHE CD2 HD2 sing N N 336 PHE CE1 CZ doub Y N 337 PHE CE1 HE1 sing N N 338 PHE CE2 CZ sing Y N 339 PHE CE2 HE2 sing N N 340 PHE CZ HZ sing N N 341 PHE OXT HXT sing N N 342 PRO N CA sing N N 343 PRO N CD sing N N 344 PRO N H sing N N 345 PRO CA C sing N N 346 PRO CA CB sing N N 347 PRO CA HA sing N N 348 PRO C O doub N N 349 PRO C OXT sing N N 350 PRO CB CG sing N N 351 PRO CB HB2 sing N N 352 PRO CB HB3 sing N N 353 PRO CG CD sing N N 354 PRO CG HG2 sing N N 355 PRO CG HG3 sing N N 356 PRO CD HD2 sing N N 357 PRO CD HD3 sing N N 358 PRO OXT HXT sing N N 359 SER N CA sing N N 360 SER N H sing N N 361 SER N H2 sing N N 362 SER CA C sing N N 363 SER CA CB sing N N 364 SER CA HA sing N N 365 SER C O doub N N 366 SER C OXT sing N N 367 SER CB OG sing N N 368 SER CB HB2 sing N N 369 SER CB HB3 sing N N 370 SER OG HG sing N N 371 SER OXT HXT sing N N 372 THR N CA sing N N 373 THR N H sing N N 374 THR N H2 sing N N 375 THR CA C sing N N 376 THR CA CB sing N N 377 THR CA HA sing N N 378 THR C O doub N N 379 THR C OXT sing N N 380 THR CB OG1 sing N N 381 THR CB CG2 sing N N 382 THR CB HB sing N N 383 THR OG1 HG1 sing N N 384 THR CG2 HG21 sing N N 385 THR CG2 HG22 sing N N 386 THR CG2 HG23 sing N N 387 THR OXT HXT sing N N 388 TRP N CA sing N N 389 TRP N H sing N N 390 TRP N H2 sing N N 391 TRP CA C sing N N 392 TRP CA CB sing N N 393 TRP CA HA sing N N 394 TRP C O doub N N 395 TRP C OXT sing N N 396 TRP CB CG sing N N 397 TRP CB HB2 sing N N 398 TRP CB HB3 sing N N 399 TRP CG CD1 doub Y N 400 TRP CG CD2 sing Y N 401 TRP CD1 NE1 sing Y N 402 TRP CD1 HD1 sing N N 403 TRP CD2 CE2 doub Y N 404 TRP CD2 CE3 sing Y N 405 TRP NE1 CE2 sing Y N 406 TRP NE1 HE1 sing N N 407 TRP CE2 CZ2 sing Y N 408 TRP CE3 CZ3 doub Y N 409 TRP CE3 HE3 sing N N 410 TRP CZ2 CH2 doub Y N 411 TRP CZ2 HZ2 sing N N 412 TRP CZ3 CH2 sing Y N 413 TRP CZ3 HZ3 sing N N 414 TRP CH2 HH2 sing N N 415 TRP OXT HXT sing N N 416 TYR N CA sing N N 417 TYR N H sing N N 418 TYR N H2 sing N N 419 TYR CA C sing N N 420 TYR CA CB sing N N 421 TYR CA HA sing N N 422 TYR C O doub N N 423 TYR C OXT sing N N 424 TYR CB CG sing N N 425 TYR CB HB2 sing N N 426 TYR CB HB3 sing N N 427 TYR CG CD1 doub Y N 428 TYR CG CD2 sing Y N 429 TYR CD1 CE1 sing Y N 430 TYR CD1 HD1 sing N N 431 TYR CD2 CE2 doub Y N 432 TYR CD2 HD2 sing N N 433 TYR CE1 CZ doub Y N 434 TYR CE1 HE1 sing N N 435 TYR CE2 CZ sing Y N 436 TYR CE2 HE2 sing N N 437 TYR CZ OH sing N N 438 TYR OH HH sing N N 439 TYR OXT HXT sing N N 440 VAL N CA sing N N 441 VAL N H sing N N 442 VAL N H2 sing N N 443 VAL CA C sing N N 444 VAL CA CB sing N N 445 VAL CA HA sing N N 446 VAL C O doub N N 447 VAL C OXT sing N N 448 VAL CB CG1 sing N N 449 VAL CB CG2 sing N N 450 VAL CB HB sing N N 451 VAL CG1 HG11 sing N N 452 VAL CG1 HG12 sing N N 453 VAL CG1 HG13 sing N N 454 VAL CG2 HG21 sing N N 455 VAL CG2 HG22 sing N N 456 VAL CG2 HG23 sing N N 457 VAL OXT HXT sing N N 458 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'French National Research Agency' France ANR-13-BSV8-0024-01 1 'Spanish Ministry of Economy and Competitiveness' Spain SAF2015-69221-R 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2HC4 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6FOB _atom_sites.fract_transf_matrix[1][1] 0.015101 _atom_sites.fract_transf_matrix[1][2] 0.008719 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017437 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003785 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_