data_6FS4 # _entry.id 6FS4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6FS4 pdb_00006fs4 10.2210/pdb6fs4/pdb WWPDB D_1200008786 ? ? BMRB 34237 ? 10.13018/BMR34237 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-10-03 2 'Structure model' 1 1 2019-05-29 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' pdbx_database_proc 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_ISSN' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation.year' 7 3 'Structure model' '_database_2.pdbx_DOI' 8 3 'Structure model' '_database_2.pdbx_database_accession' 9 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 10 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6FS4 _pdbx_database_status.recvd_initial_deposition_date 2018-02-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB 'NMR structure of Casocidin-II antimicrobial peptide in 60% TFE' 34237 unspecified PDB . 6FS5 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mercurio, F.A.' 1 ? 'Leone, M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Peptides _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 0196-9781 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 114 _citation.language ? _citation.page_first 50 _citation.page_last 58 _citation.title 'The antimicrobial peptides casocidins I and II: Solution structural studies in water and different membrane-mimetic environments.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.peptides.2018.09.004 _citation.pdbx_database_id_PubMed 30243923 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mercurio, F.A.' 1 ? primary 'Scaloni, A.' 2 ? primary 'Caira, S.' 3 ? primary 'Leone, M.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description Alpha-S2-casein _entity.formula_weight 3864.535 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Residues 166-196' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code TKLTEEEKNRLNFLKKISQRYQKFALPQYLK _entity_poly.pdbx_seq_one_letter_code_can TKLTEEEKNRLNFLKKISQRYQKFALPQYLK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 LYS n 1 3 LEU n 1 4 THR n 1 5 GLU n 1 6 GLU n 1 7 GLU n 1 8 LYS n 1 9 ASN n 1 10 ARG n 1 11 LEU n 1 12 ASN n 1 13 PHE n 1 14 LEU n 1 15 LYS n 1 16 LYS n 1 17 ILE n 1 18 SER n 1 19 GLN n 1 20 ARG n 1 21 TYR n 1 22 GLN n 1 23 LYS n 1 24 PHE n 1 25 ALA n 1 26 LEU n 1 27 PRO n 1 28 GLN n 1 29 TYR n 1 30 LEU n 1 31 LYS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 31 _pdbx_entity_src_syn.organism_scientific 'Bos taurus' _pdbx_entity_src_syn.organism_common_name Bovine _pdbx_entity_src_syn.ncbi_taxonomy_id 9913 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 2 2 THR THR A . n A 1 2 LYS 2 3 3 LYS LYS A . n A 1 3 LEU 3 4 4 LEU LEU A . n A 1 4 THR 4 5 5 THR THR A . n A 1 5 GLU 5 6 6 GLU GLU A . n A 1 6 GLU 6 7 7 GLU GLU A . n A 1 7 GLU 7 8 8 GLU GLU A . n A 1 8 LYS 8 9 9 LYS LYS A . n A 1 9 ASN 9 10 10 ASN ASN A . n A 1 10 ARG 10 11 11 ARG ARG A . n A 1 11 LEU 11 12 12 LEU LEU A . n A 1 12 ASN 12 13 13 ASN ASN A . n A 1 13 PHE 13 14 14 PHE PHE A . n A 1 14 LEU 14 15 15 LEU LEU A . n A 1 15 LYS 15 16 16 LYS LYS A . n A 1 16 LYS 16 17 17 LYS LYS A . n A 1 17 ILE 17 18 18 ILE ILE A . n A 1 18 SER 18 19 19 SER SER A . n A 1 19 GLN 19 20 20 GLN GLN A . n A 1 20 ARG 20 21 21 ARG ARG A . n A 1 21 TYR 21 22 22 TYR TYR A . n A 1 22 GLN 22 23 23 GLN GLN A . n A 1 23 LYS 23 24 24 LYS LYS A . n A 1 24 PHE 24 25 25 PHE PHE A . n A 1 25 ALA 25 26 26 ALA ALA A . n A 1 26 LEU 26 27 27 LEU LEU A . n A 1 27 PRO 27 28 28 PRO PRO A . n A 1 28 GLN 28 29 29 GLN GLN A . n A 1 29 TYR 29 30 30 TYR TYR A . n A 1 30 LEU 30 31 31 LEU LEU A . n A 1 31 LYS 31 32 32 LYS LYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6FS4 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6FS4 _struct.title 'NMR structure of Casocidin-II antimicrobial peptide in 60% TFE' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6FS4 _struct_keywords.text 'Antimicrobial peptide, TFE, ANTIMICROBIAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CASA2_BOVIN _struct_ref.pdbx_db_accession P02663 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TKLTEEEKNRLNFLKKISQRYQKFALPQYLK _struct_ref.pdbx_align_begin 166 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6FS4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02663 _struct_ref_seq.db_align_beg 166 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 196 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 32 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3580 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id LYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 2 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 19 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 3 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 20 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 26 ? ? 179.23 -42.39 2 1 LEU A 27 ? ? 61.69 80.18 3 1 GLN A 29 ? ? -47.65 -70.84 4 2 LYS A 3 ? ? -179.55 -34.40 5 2 ALA A 26 ? ? 179.82 -35.92 6 2 PRO A 28 ? ? -69.74 78.08 7 2 GLN A 29 ? ? -164.00 44.74 8 2 TYR A 30 ? ? -172.43 -36.29 9 2 LEU A 31 ? ? 59.49 96.99 10 3 LYS A 3 ? ? -179.57 -34.35 11 3 ALA A 26 ? ? -178.54 -37.78 12 3 LEU A 27 ? ? 51.55 76.25 13 3 TYR A 30 ? ? 62.46 -83.59 14 4 LEU A 4 ? ? -157.68 -58.05 15 4 ALA A 26 ? ? -178.31 -35.05 16 4 LEU A 27 ? ? 49.00 76.30 17 4 TYR A 30 ? ? -94.87 -74.67 18 5 LEU A 4 ? ? -157.72 -50.57 19 5 ALA A 26 ? ? -178.79 -41.72 20 5 LEU A 27 ? ? 63.47 72.98 21 6 LYS A 3 ? ? -179.59 -34.42 22 6 GLN A 23 ? ? -140.49 11.93 23 6 ALA A 26 ? ? 179.55 -33.72 24 6 PRO A 28 ? ? -69.76 75.75 25 6 GLN A 29 ? ? -147.97 17.47 26 7 ALA A 26 ? ? -179.99 -43.22 27 7 LEU A 27 ? ? 63.52 70.10 28 7 PRO A 28 ? ? -69.71 76.87 29 7 GLN A 29 ? ? -162.49 25.92 30 7 TYR A 30 ? ? -68.23 -179.92 31 8 LEU A 4 ? ? -161.68 -60.58 32 8 GLN A 23 ? ? -146.58 14.47 33 8 LYS A 24 ? ? -130.64 -37.86 34 8 ALA A 26 ? ? 179.60 -33.39 35 8 LEU A 27 ? ? 53.15 73.23 36 8 PRO A 28 ? ? -69.86 75.39 37 8 GLN A 29 ? ? -152.96 83.52 38 9 LYS A 3 ? ? -179.53 -34.36 39 9 ALA A 26 ? ? -175.50 -45.42 40 9 TYR A 30 ? ? 64.28 -80.65 41 10 ALA A 26 ? ? -178.85 -33.80 42 10 PRO A 28 ? ? -69.75 75.24 43 10 GLN A 29 ? ? -149.01 23.37 44 11 LEU A 4 ? ? -136.32 -48.21 45 11 ALA A 26 ? ? -179.84 -43.04 46 11 LEU A 27 ? ? 62.98 80.27 47 11 TYR A 30 ? ? -173.87 -34.69 48 12 ALA A 26 ? ? 177.26 -56.68 49 12 LEU A 27 ? ? 64.79 66.94 50 12 PRO A 28 ? ? -69.81 76.14 51 12 GLN A 29 ? ? -149.91 21.87 52 13 GLN A 23 ? ? -141.55 12.42 53 13 ALA A 26 ? ? 179.22 -34.42 54 13 PRO A 28 ? ? -69.78 78.21 55 13 LEU A 31 ? ? 47.45 27.60 56 14 LYS A 3 ? ? -156.62 -75.08 57 14 GLN A 23 ? ? -140.18 12.15 58 14 ALA A 26 ? ? 179.38 -33.76 59 14 PRO A 28 ? ? -69.67 77.62 60 14 TYR A 30 ? ? -142.89 -45.61 61 15 LYS A 3 ? ? -179.58 -34.42 62 15 GLN A 23 ? ? -143.83 11.20 63 15 ALA A 26 ? ? 174.38 -33.53 64 15 GLN A 29 ? ? 70.31 40.08 65 16 GLN A 23 ? ? -143.85 12.90 66 16 ALA A 26 ? ? 178.31 -41.67 67 16 LEU A 27 ? ? 61.18 73.96 68 16 PRO A 28 ? ? -69.75 71.99 69 16 GLN A 29 ? ? -177.11 -43.00 70 16 TYR A 30 ? ? 61.41 -85.12 71 17 ALA A 26 ? ? -169.17 -37.93 72 17 LEU A 27 ? ? 63.37 67.70 73 18 LEU A 4 ? ? 73.89 -64.02 74 18 ALA A 26 ? ? -179.53 -34.42 75 18 LEU A 27 ? ? 51.51 81.88 76 18 PRO A 28 ? ? -69.76 77.97 77 18 GLN A 29 ? ? -156.10 -44.28 78 19 ALA A 26 ? ? 179.22 -34.28 79 19 PRO A 28 ? ? -69.76 77.93 80 20 ALA A 26 ? ? 179.51 -33.74 81 20 PRO A 28 ? ? -69.76 80.75 82 20 GLN A 29 ? ? -179.23 62.34 # _pdbx_nmr_ensemble.entry_id 6FS4 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6FS4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.2 mM Casocidin II, trifluoroethanol/water' _pdbx_nmr_sample_details.solvent_system trifluoroethanol/water _pdbx_nmr_sample_details.label TFE60 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'Casocidin II' _pdbx_nmr_exptl_sample.concentration 1.2 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 2.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength null _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D DQF-COSY' 1 isotropic # _pdbx_nmr_refine.entry_id 6FS4 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection VNMR ? Varian 3 'chemical shift assignment' XEASY ? 'Bartels et al.' 2 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 ILE N N N N 97 ILE CA C N S 98 ILE C C N N 99 ILE O O N N 100 ILE CB C N S 101 ILE CG1 C N N 102 ILE CG2 C N N 103 ILE CD1 C N N 104 ILE OXT O N N 105 ILE H H N N 106 ILE H2 H N N 107 ILE HA H N N 108 ILE HB H N N 109 ILE HG12 H N N 110 ILE HG13 H N N 111 ILE HG21 H N N 112 ILE HG22 H N N 113 ILE HG23 H N N 114 ILE HD11 H N N 115 ILE HD12 H N N 116 ILE HD13 H N N 117 ILE HXT H N N 118 LEU N N N N 119 LEU CA C N S 120 LEU C C N N 121 LEU O O N N 122 LEU CB C N N 123 LEU CG C N N 124 LEU CD1 C N N 125 LEU CD2 C N N 126 LEU OXT O N N 127 LEU H H N N 128 LEU H2 H N N 129 LEU HA H N N 130 LEU HB2 H N N 131 LEU HB3 H N N 132 LEU HG H N N 133 LEU HD11 H N N 134 LEU HD12 H N N 135 LEU HD13 H N N 136 LEU HD21 H N N 137 LEU HD22 H N N 138 LEU HD23 H N N 139 LEU HXT H N N 140 LYS N N N N 141 LYS CA C N S 142 LYS C C N N 143 LYS O O N N 144 LYS CB C N N 145 LYS CG C N N 146 LYS CD C N N 147 LYS CE C N N 148 LYS NZ N N N 149 LYS OXT O N N 150 LYS H H N N 151 LYS H2 H N N 152 LYS HA H N N 153 LYS HB2 H N N 154 LYS HB3 H N N 155 LYS HG2 H N N 156 LYS HG3 H N N 157 LYS HD2 H N N 158 LYS HD3 H N N 159 LYS HE2 H N N 160 LYS HE3 H N N 161 LYS HZ1 H N N 162 LYS HZ2 H N N 163 LYS HZ3 H N N 164 LYS HXT H N N 165 PHE N N N N 166 PHE CA C N S 167 PHE C C N N 168 PHE O O N N 169 PHE CB C N N 170 PHE CG C Y N 171 PHE CD1 C Y N 172 PHE CD2 C Y N 173 PHE CE1 C Y N 174 PHE CE2 C Y N 175 PHE CZ C Y N 176 PHE OXT O N N 177 PHE H H N N 178 PHE H2 H N N 179 PHE HA H N N 180 PHE HB2 H N N 181 PHE HB3 H N N 182 PHE HD1 H N N 183 PHE HD2 H N N 184 PHE HE1 H N N 185 PHE HE2 H N N 186 PHE HZ H N N 187 PHE HXT H N N 188 PRO N N N N 189 PRO CA C N S 190 PRO C C N N 191 PRO O O N N 192 PRO CB C N N 193 PRO CG C N N 194 PRO CD C N N 195 PRO OXT O N N 196 PRO H H N N 197 PRO HA H N N 198 PRO HB2 H N N 199 PRO HB3 H N N 200 PRO HG2 H N N 201 PRO HG3 H N N 202 PRO HD2 H N N 203 PRO HD3 H N N 204 PRO HXT H N N 205 SER N N N N 206 SER CA C N S 207 SER C C N N 208 SER O O N N 209 SER CB C N N 210 SER OG O N N 211 SER OXT O N N 212 SER H H N N 213 SER H2 H N N 214 SER HA H N N 215 SER HB2 H N N 216 SER HB3 H N N 217 SER HG H N N 218 SER HXT H N N 219 THR N N N N 220 THR CA C N S 221 THR C C N N 222 THR O O N N 223 THR CB C N R 224 THR OG1 O N N 225 THR CG2 C N N 226 THR OXT O N N 227 THR H H N N 228 THR H2 H N N 229 THR HA H N N 230 THR HB H N N 231 THR HG1 H N N 232 THR HG21 H N N 233 THR HG22 H N N 234 THR HG23 H N N 235 THR HXT H N N 236 TYR N N N N 237 TYR CA C N S 238 TYR C C N N 239 TYR O O N N 240 TYR CB C N N 241 TYR CG C Y N 242 TYR CD1 C Y N 243 TYR CD2 C Y N 244 TYR CE1 C Y N 245 TYR CE2 C Y N 246 TYR CZ C Y N 247 TYR OH O N N 248 TYR OXT O N N 249 TYR H H N N 250 TYR H2 H N N 251 TYR HA H N N 252 TYR HB2 H N N 253 TYR HB3 H N N 254 TYR HD1 H N N 255 TYR HD2 H N N 256 TYR HE1 H N N 257 TYR HE2 H N N 258 TYR HH H N N 259 TYR HXT H N N 260 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 ILE N CA sing N N 92 ILE N H sing N N 93 ILE N H2 sing N N 94 ILE CA C sing N N 95 ILE CA CB sing N N 96 ILE CA HA sing N N 97 ILE C O doub N N 98 ILE C OXT sing N N 99 ILE CB CG1 sing N N 100 ILE CB CG2 sing N N 101 ILE CB HB sing N N 102 ILE CG1 CD1 sing N N 103 ILE CG1 HG12 sing N N 104 ILE CG1 HG13 sing N N 105 ILE CG2 HG21 sing N N 106 ILE CG2 HG22 sing N N 107 ILE CG2 HG23 sing N N 108 ILE CD1 HD11 sing N N 109 ILE CD1 HD12 sing N N 110 ILE CD1 HD13 sing N N 111 ILE OXT HXT sing N N 112 LEU N CA sing N N 113 LEU N H sing N N 114 LEU N H2 sing N N 115 LEU CA C sing N N 116 LEU CA CB sing N N 117 LEU CA HA sing N N 118 LEU C O doub N N 119 LEU C OXT sing N N 120 LEU CB CG sing N N 121 LEU CB HB2 sing N N 122 LEU CB HB3 sing N N 123 LEU CG CD1 sing N N 124 LEU CG CD2 sing N N 125 LEU CG HG sing N N 126 LEU CD1 HD11 sing N N 127 LEU CD1 HD12 sing N N 128 LEU CD1 HD13 sing N N 129 LEU CD2 HD21 sing N N 130 LEU CD2 HD22 sing N N 131 LEU CD2 HD23 sing N N 132 LEU OXT HXT sing N N 133 LYS N CA sing N N 134 LYS N H sing N N 135 LYS N H2 sing N N 136 LYS CA C sing N N 137 LYS CA CB sing N N 138 LYS CA HA sing N N 139 LYS C O doub N N 140 LYS C OXT sing N N 141 LYS CB CG sing N N 142 LYS CB HB2 sing N N 143 LYS CB HB3 sing N N 144 LYS CG CD sing N N 145 LYS CG HG2 sing N N 146 LYS CG HG3 sing N N 147 LYS CD CE sing N N 148 LYS CD HD2 sing N N 149 LYS CD HD3 sing N N 150 LYS CE NZ sing N N 151 LYS CE HE2 sing N N 152 LYS CE HE3 sing N N 153 LYS NZ HZ1 sing N N 154 LYS NZ HZ2 sing N N 155 LYS NZ HZ3 sing N N 156 LYS OXT HXT sing N N 157 PHE N CA sing N N 158 PHE N H sing N N 159 PHE N H2 sing N N 160 PHE CA C sing N N 161 PHE CA CB sing N N 162 PHE CA HA sing N N 163 PHE C O doub N N 164 PHE C OXT sing N N 165 PHE CB CG sing N N 166 PHE CB HB2 sing N N 167 PHE CB HB3 sing N N 168 PHE CG CD1 doub Y N 169 PHE CG CD2 sing Y N 170 PHE CD1 CE1 sing Y N 171 PHE CD1 HD1 sing N N 172 PHE CD2 CE2 doub Y N 173 PHE CD2 HD2 sing N N 174 PHE CE1 CZ doub Y N 175 PHE CE1 HE1 sing N N 176 PHE CE2 CZ sing Y N 177 PHE CE2 HE2 sing N N 178 PHE CZ HZ sing N N 179 PHE OXT HXT sing N N 180 PRO N CA sing N N 181 PRO N CD sing N N 182 PRO N H sing N N 183 PRO CA C sing N N 184 PRO CA CB sing N N 185 PRO CA HA sing N N 186 PRO C O doub N N 187 PRO C OXT sing N N 188 PRO CB CG sing N N 189 PRO CB HB2 sing N N 190 PRO CB HB3 sing N N 191 PRO CG CD sing N N 192 PRO CG HG2 sing N N 193 PRO CG HG3 sing N N 194 PRO CD HD2 sing N N 195 PRO CD HD3 sing N N 196 PRO OXT HXT sing N N 197 SER N CA sing N N 198 SER N H sing N N 199 SER N H2 sing N N 200 SER CA C sing N N 201 SER CA CB sing N N 202 SER CA HA sing N N 203 SER C O doub N N 204 SER C OXT sing N N 205 SER CB OG sing N N 206 SER CB HB2 sing N N 207 SER CB HB3 sing N N 208 SER OG HG sing N N 209 SER OXT HXT sing N N 210 THR N CA sing N N 211 THR N H sing N N 212 THR N H2 sing N N 213 THR CA C sing N N 214 THR CA CB sing N N 215 THR CA HA sing N N 216 THR C O doub N N 217 THR C OXT sing N N 218 THR CB OG1 sing N N 219 THR CB CG2 sing N N 220 THR CB HB sing N N 221 THR OG1 HG1 sing N N 222 THR CG2 HG21 sing N N 223 THR CG2 HG22 sing N N 224 THR CG2 HG23 sing N N 225 THR OXT HXT sing N N 226 TYR N CA sing N N 227 TYR N H sing N N 228 TYR N H2 sing N N 229 TYR CA C sing N N 230 TYR CA CB sing N N 231 TYR CA HA sing N N 232 TYR C O doub N N 233 TYR C OXT sing N N 234 TYR CB CG sing N N 235 TYR CB HB2 sing N N 236 TYR CB HB3 sing N N 237 TYR CG CD1 doub Y N 238 TYR CG CD2 sing Y N 239 TYR CD1 CE1 sing Y N 240 TYR CD1 HD1 sing N N 241 TYR CD2 CE2 doub Y N 242 TYR CD2 HD2 sing N N 243 TYR CE1 CZ doub Y N 244 TYR CE1 HE1 sing N N 245 TYR CE2 CZ sing Y N 246 TYR CE2 HE2 sing N N 247 TYR CZ OH sing N N 248 TYR OH HH sing N N 249 TYR OXT HXT sing N N 250 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model UNITY _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details 'Cold probe' # _atom_sites.entry_id 6FS4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_