data_6FZK # _entry.id 6FZK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6FZK pdb_00006fzk 10.2210/pdb6fzk/pdb WWPDB D_1200009116 ? ? BMRB 34246 ? 10.13018/BMR34246 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-02-20 2 'Structure model' 1 1 2019-05-08 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_nmr_software 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_database_status 4 3 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_nmr_software.name' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6FZK _pdbx_database_status.recvd_initial_deposition_date 2018-03-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Crystal Structure of the Full-Length Transglycosylase PBP1b from Escherichia coli' 3FWL unspecified PDB 'E. coli PBP1b in complex with acyl-CENTA and moenomycin' 5HLD unspecified PDB 'E. coli PBP1b in complex with acyl-aztreonam and moenomycin' 5HLB unspecified PDB 'E. coli PBP1b in complex with acyl-cephalexin and moenomycin' 5HLA unspecified BMRB 'NMR structure of UB2H, regulatory domain of PBP1b from E. Coli' 34246 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Simorre, J.P.' 1 ? 'Maya Martinez, R.C.' 2 ? 'Bougault, C.' 3 ? 'Egan, A.J.F.' 4 ? 'Vollmer, W.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Mol. Microbiol.' _citation.journal_id_ASTM MOMIEE _citation.journal_id_CSD 2007 _citation.journal_id_ISSN 1365-2958 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 110 _citation.language ? _citation.page_first 335 _citation.page_last 356 _citation.title 'Induced conformational changes activate the peptidoglycan synthase PBP1B.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/mmi.14082 _citation.pdbx_database_id_PubMed 30044025 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Egan, A.J.F.' 1 ? primary 'Maya-Martinez, R.' 2 ? primary 'Ayala, I.' 3 ? primary 'Bougault, C.M.' 4 ? primary 'Banzhaf, M.' 5 ? primary 'Breukink, E.' 6 ? primary 'Vollmer, W.' 7 ? primary 'Simorre, J.P.' 8 0000-0002-7943-1342 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Penicillin-binding protein 1B' _entity.formula_weight 13183.969 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.4.1.129,3.4.16.4 _entity.pdbx_mutation ? _entity.pdbx_fragment 'PBP1b (108-200)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PBP1b,Murein polymerase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKE GQVRARLTFDGDHLATIVNMENNRQFGFFRLDPR ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKE GQVRARLTFDGDHLATIVNMENNRQFGFFRLDPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 GLY n 1 23 ARG n 1 24 MET n 1 25 VAL n 1 26 ASN n 1 27 LEU n 1 28 GLU n 1 29 PRO n 1 30 ASP n 1 31 MET n 1 32 THR n 1 33 ILE n 1 34 SER n 1 35 LYS n 1 36 ASN n 1 37 GLU n 1 38 MET n 1 39 VAL n 1 40 LYS n 1 41 LEU n 1 42 LEU n 1 43 GLU n 1 44 ALA n 1 45 THR n 1 46 GLN n 1 47 TYR n 1 48 ARG n 1 49 GLN n 1 50 VAL n 1 51 SER n 1 52 LYS n 1 53 MET n 1 54 THR n 1 55 ARG n 1 56 PRO n 1 57 GLY n 1 58 GLU n 1 59 PHE n 1 60 THR n 1 61 VAL n 1 62 GLN n 1 63 ALA n 1 64 ASN n 1 65 SER n 1 66 ILE n 1 67 GLU n 1 68 MET n 1 69 ILE n 1 70 ARG n 1 71 ARG n 1 72 PRO n 1 73 PHE n 1 74 ASP n 1 75 PHE n 1 76 PRO n 1 77 ASP n 1 78 SER n 1 79 LYS n 1 80 GLU n 1 81 GLY n 1 82 GLN n 1 83 VAL n 1 84 ARG n 1 85 ALA n 1 86 ARG n 1 87 LEU n 1 88 THR n 1 89 PHE n 1 90 ASP n 1 91 GLY n 1 92 ASP n 1 93 HIS n 1 94 LEU n 1 95 ALA n 1 96 THR n 1 97 ILE n 1 98 VAL n 1 99 ASN n 1 100 MET n 1 101 GLU n 1 102 ASN n 1 103 ASN n 1 104 ARG n 1 105 GLN n 1 106 PHE n 1 107 GLY n 1 108 PHE n 1 109 PHE n 1 110 ARG n 1 111 LEU n 1 112 ASP n 1 113 PRO n 1 114 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 114 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'mrcB, pbpF, ponB, b0149, JW0145' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 87 87 MET MET A . n A 1 2 GLY 2 88 88 GLY GLY A . n A 1 3 SER 3 89 89 SER SER A . n A 1 4 SER 4 90 90 SER SER A . n A 1 5 HIS 5 91 91 HIS HIS A . n A 1 6 HIS 6 92 92 HIS HIS A . n A 1 7 HIS 7 93 93 HIS HIS A . n A 1 8 HIS 8 94 94 HIS HIS A . n A 1 9 HIS 9 95 95 HIS HIS A . n A 1 10 HIS 10 96 96 HIS HIS A . n A 1 11 SER 11 97 97 SER SER A . n A 1 12 SER 12 98 98 SER SER A . n A 1 13 GLY 13 99 99 GLY GLY A . n A 1 14 LEU 14 100 100 LEU LEU A . n A 1 15 VAL 15 101 101 VAL VAL A . n A 1 16 PRO 16 102 102 PRO PRO A . n A 1 17 ARG 17 103 103 ARG ARG A . n A 1 18 GLY 18 104 104 GLY GLY A . n A 1 19 SER 19 105 105 SER SER A . n A 1 20 HIS 20 106 106 HIS HIS A . n A 1 21 MET 21 107 107 MET MET A . n A 1 22 GLY 22 108 108 GLY GLY A . n A 1 23 ARG 23 109 109 ARG ARG A . n A 1 24 MET 24 110 110 MET MET A . n A 1 25 VAL 25 111 111 VAL VAL A . n A 1 26 ASN 26 112 112 ASN ASN A . n A 1 27 LEU 27 113 113 LEU LEU A . n A 1 28 GLU 28 114 114 GLU GLU A . n A 1 29 PRO 29 115 115 PRO PRO A . n A 1 30 ASP 30 116 116 ASP ASP A . n A 1 31 MET 31 117 117 MET MET A . n A 1 32 THR 32 118 118 THR THR A . n A 1 33 ILE 33 119 119 ILE ILE A . n A 1 34 SER 34 120 120 SER SER A . n A 1 35 LYS 35 121 121 LYS LYS A . n A 1 36 ASN 36 122 122 ASN ASN A . n A 1 37 GLU 37 123 123 GLU GLU A . n A 1 38 MET 38 124 124 MET MET A . n A 1 39 VAL 39 125 125 VAL VAL A . n A 1 40 LYS 40 126 126 LYS LYS A . n A 1 41 LEU 41 127 127 LEU LEU A . n A 1 42 LEU 42 128 128 LEU LEU A . n A 1 43 GLU 43 129 129 GLU GLU A . n A 1 44 ALA 44 130 130 ALA ALA A . n A 1 45 THR 45 131 131 THR THR A . n A 1 46 GLN 46 132 132 GLN GLN A . n A 1 47 TYR 47 133 133 TYR TYR A . n A 1 48 ARG 48 134 134 ARG ARG A . n A 1 49 GLN 49 135 135 GLN GLN A . n A 1 50 VAL 50 136 136 VAL VAL A . n A 1 51 SER 51 137 137 SER SER A . n A 1 52 LYS 52 138 138 LYS LYS A . n A 1 53 MET 53 139 139 MET MET A . n A 1 54 THR 54 140 140 THR THR A . n A 1 55 ARG 55 141 141 ARG ARG A . n A 1 56 PRO 56 142 142 PRO PRO A . n A 1 57 GLY 57 143 143 GLY GLY A . n A 1 58 GLU 58 144 144 GLU GLU A . n A 1 59 PHE 59 145 145 PHE PHE A . n A 1 60 THR 60 146 146 THR THR A . n A 1 61 VAL 61 147 147 VAL VAL A . n A 1 62 GLN 62 148 148 GLN GLN A . n A 1 63 ALA 63 149 149 ALA ALA A . n A 1 64 ASN 64 150 150 ASN ASN A . n A 1 65 SER 65 151 151 SER SER A . n A 1 66 ILE 66 152 152 ILE ILE A . n A 1 67 GLU 67 153 153 GLU GLU A . n A 1 68 MET 68 154 154 MET MET A . n A 1 69 ILE 69 155 155 ILE ILE A . n A 1 70 ARG 70 156 156 ARG ARG A . n A 1 71 ARG 71 157 157 ARG ARG A . n A 1 72 PRO 72 158 158 PRO PRO A . n A 1 73 PHE 73 159 159 PHE PHE A . n A 1 74 ASP 74 160 160 ASP ASP A . n A 1 75 PHE 75 161 161 PHE PHE A . n A 1 76 PRO 76 162 162 PRO PRO A . n A 1 77 ASP 77 163 163 ASP ASP A . n A 1 78 SER 78 164 164 SER SER A . n A 1 79 LYS 79 165 165 LYS LYS A . n A 1 80 GLU 80 166 166 GLU GLU A . n A 1 81 GLY 81 167 167 GLY GLY A . n A 1 82 GLN 82 168 168 GLN GLN A . n A 1 83 VAL 83 169 169 VAL VAL A . n A 1 84 ARG 84 170 170 ARG ARG A . n A 1 85 ALA 85 171 171 ALA ALA A . n A 1 86 ARG 86 172 172 ARG ARG A . n A 1 87 LEU 87 173 173 LEU LEU A . n A 1 88 THR 88 174 174 THR THR A . n A 1 89 PHE 89 175 175 PHE PHE A . n A 1 90 ASP 90 176 176 ASP ASP A . n A 1 91 GLY 91 177 177 GLY GLY A . n A 1 92 ASP 92 178 178 ASP ASP A . n A 1 93 HIS 93 179 179 HIS HIS A . n A 1 94 LEU 94 180 180 LEU LEU A . n A 1 95 ALA 95 181 181 ALA ALA A . n A 1 96 THR 96 182 182 THR THR A . n A 1 97 ILE 97 183 183 ILE ILE A . n A 1 98 VAL 98 184 184 VAL VAL A . n A 1 99 ASN 99 185 185 ASN ASN A . n A 1 100 MET 100 186 186 MET MET A . n A 1 101 GLU 101 187 187 GLU GLU A . n A 1 102 ASN 102 188 188 ASN ASN A . n A 1 103 ASN 103 189 189 ASN ASN A . n A 1 104 ARG 104 190 190 ARG ARG A . n A 1 105 GLN 105 191 191 GLN GLN A . n A 1 106 PHE 106 192 192 PHE PHE A . n A 1 107 GLY 107 193 193 GLY GLY A . n A 1 108 PHE 108 194 194 PHE PHE A . n A 1 109 PHE 109 195 195 PHE PHE A . n A 1 110 ARG 110 196 196 ARG ARG A . n A 1 111 LEU 111 197 197 LEU LEU A . n A 1 112 ASP 112 198 198 ASP ASP A . n A 1 113 PRO 113 199 199 PRO PRO A . n A 1 114 ARG 114 200 200 ARG ARG A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6FZK _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6FZK _struct.title 'NMR structure of UB2H, regulatory domain of PBP1b from E. coli' _struct.pdbx_model_details 'Regulatory domain of Penicillin-Binding Protein' _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6FZK _struct_keywords.text 'UB2H domain of PBP1b, regulatory domain, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PBPB_ECOLI _struct_ref.pdbx_db_accession P02919 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHLATIVNME NNRQFGFFRLDPR ; _struct_ref.pdbx_align_begin 108 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6FZK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02919 _struct_ref_seq.db_align_beg 108 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 200 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 108 _struct_ref_seq.pdbx_auth_seq_align_end 200 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6FZK MET A 1 ? UNP P02919 ? ? 'initiating methionine' 87 1 1 6FZK GLY A 2 ? UNP P02919 ? ? 'expression tag' 88 2 1 6FZK SER A 3 ? UNP P02919 ? ? 'expression tag' 89 3 1 6FZK SER A 4 ? UNP P02919 ? ? 'expression tag' 90 4 1 6FZK HIS A 5 ? UNP P02919 ? ? 'expression tag' 91 5 1 6FZK HIS A 6 ? UNP P02919 ? ? 'expression tag' 92 6 1 6FZK HIS A 7 ? UNP P02919 ? ? 'expression tag' 93 7 1 6FZK HIS A 8 ? UNP P02919 ? ? 'expression tag' 94 8 1 6FZK HIS A 9 ? UNP P02919 ? ? 'expression tag' 95 9 1 6FZK HIS A 10 ? UNP P02919 ? ? 'expression tag' 96 10 1 6FZK SER A 11 ? UNP P02919 ? ? 'expression tag' 97 11 1 6FZK SER A 12 ? UNP P02919 ? ? 'expression tag' 98 12 1 6FZK GLY A 13 ? UNP P02919 ? ? 'expression tag' 99 13 1 6FZK LEU A 14 ? UNP P02919 ? ? 'expression tag' 100 14 1 6FZK VAL A 15 ? UNP P02919 ? ? 'expression tag' 101 15 1 6FZK PRO A 16 ? UNP P02919 ? ? 'expression tag' 102 16 1 6FZK ARG A 17 ? UNP P02919 ? ? 'expression tag' 103 17 1 6FZK GLY A 18 ? UNP P02919 ? ? 'expression tag' 104 18 1 6FZK SER A 19 ? UNP P02919 ? ? 'expression tag' 105 19 1 6FZK HIS A 20 ? UNP P02919 ? ? 'expression tag' 106 20 1 6FZK MET A 21 ? UNP P02919 ? ? 'expression tag' 107 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7840 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id MET _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 38 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id THR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 45 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id MET _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 124 _struct_conf.end_auth_comp_id THR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 131 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 58 ? VAL A 61 ? GLU A 144 VAL A 147 AA1 2 SER A 65 ? ILE A 69 ? SER A 151 ILE A 155 AA1 3 ARG A 84 ? ASP A 90 ? ARG A 170 ASP A 176 AA1 4 HIS A 93 ? ASN A 99 ? HIS A 179 ASN A 185 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 60 ? N THR A 146 O GLU A 67 ? O GLU A 153 AA1 2 3 N ILE A 66 ? N ILE A 152 O LEU A 87 ? O LEU A 173 AA1 3 4 N ASP A 90 ? N ASP A 176 O HIS A 93 ? O HIS A 179 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASN 185 ? ? H A ASN 189 ? ? 1.58 2 3 O A ASN 185 ? ? H A ASN 189 ? ? 1.56 3 3 O A THR 146 ? ? H A GLU 153 ? ? 1.58 4 4 O A ASN 185 ? ? H A ASN 189 ? ? 1.53 5 4 O A ILE 183 ? ? H A PHE 192 ? ? 1.59 6 5 O A ASN 185 ? ? H A ASN 189 ? ? 1.56 7 7 O A ASN 185 ? ? H A ASN 189 ? ? 1.59 8 7 O A ILE 183 ? ? H A PHE 192 ? ? 1.59 9 8 O A ASN 185 ? ? H A ASN 189 ? ? 1.53 10 9 HH A TYR 133 ? ? HG13 A VAL 136 ? ? 1.30 11 9 O A LEU 113 ? ? H A PHE 195 ? ? 1.57 12 9 O A ASN 185 ? ? H A ASN 189 ? ? 1.60 13 10 O A LEU 113 ? ? H A PHE 195 ? ? 1.53 14 10 O A GLU 144 ? ? H A ILE 155 ? ? 1.60 15 11 O A ILE 183 ? ? H A PHE 192 ? ? 1.53 16 12 O A ASN 185 ? ? H A ASN 189 ? ? 1.57 17 13 O A ASN 185 ? ? H A ASN 189 ? ? 1.57 18 13 O A ILE 183 ? ? H A PHE 192 ? ? 1.58 19 14 O A ASN 185 ? ? H A ASN 189 ? ? 1.56 20 16 O A ILE 183 ? ? H A PHE 192 ? ? 1.59 21 17 O A ILE 183 ? ? H A PHE 192 ? ? 1.55 22 17 O A ASN 185 ? ? H A ASN 189 ? ? 1.57 23 17 HZ2 A LYS 126 ? ? OE1 A GLU 129 ? ? 1.57 24 18 O A LEU 113 ? ? H A PHE 195 ? ? 1.59 25 19 O A ASN 185 ? ? H A ASN 189 ? ? 1.60 26 20 O A ASN 185 ? ? H A ASN 189 ? ? 1.58 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 2 CE1 A TYR 133 ? ? CZ A TYR 133 ? ? 1.532 1.381 0.151 0.013 N 2 2 CZ A TYR 133 ? ? CE2 A TYR 133 ? ? 1.240 1.381 -0.141 0.013 N 3 4 CE1 A PHE 175 ? ? CZ A PHE 175 ? ? 1.489 1.369 0.120 0.019 N 4 5 CE1 A TYR 133 ? ? CZ A TYR 133 ? ? 1.497 1.381 0.116 0.013 N 5 5 CZ A TYR 133 ? ? CE2 A TYR 133 ? ? 1.256 1.381 -0.125 0.013 N 6 6 CE1 A TYR 133 ? ? CZ A TYR 133 ? ? 1.485 1.381 0.104 0.013 N 7 6 CZ A TYR 133 ? ? CE2 A TYR 133 ? ? 1.261 1.381 -0.120 0.013 N 8 8 CE1 A PHE 192 ? ? CZ A PHE 192 ? ? 1.494 1.369 0.125 0.019 N 9 9 CE1 A TYR 133 ? ? CZ A TYR 133 ? ? 1.510 1.381 0.129 0.013 N 10 9 CZ A TYR 133 ? ? CE2 A TYR 133 ? ? 1.256 1.381 -0.125 0.013 N 11 10 CE1 A TYR 133 ? ? CZ A TYR 133 ? ? 1.496 1.381 0.115 0.013 N 12 10 CZ A TYR 133 ? ? CE2 A TYR 133 ? ? 1.255 1.381 -0.126 0.013 N 13 12 CE1 A TYR 133 ? ? CZ A TYR 133 ? ? 1.497 1.381 0.116 0.013 N 14 12 CZ A TYR 133 ? ? CE2 A TYR 133 ? ? 1.258 1.381 -0.123 0.013 N 15 13 CE1 A TYR 133 ? ? CZ A TYR 133 ? ? 1.469 1.381 0.088 0.013 N 16 13 CZ A TYR 133 ? ? CE2 A TYR 133 ? ? 1.280 1.381 -0.101 0.013 N 17 13 CE1 A PHE 159 ? ? CZ A PHE 159 ? ? 1.489 1.369 0.120 0.019 N 18 14 CE1 A TYR 133 ? ? CZ A TYR 133 ? ? 1.471 1.381 0.090 0.013 N 19 14 CZ A TYR 133 ? ? CE2 A TYR 133 ? ? 1.282 1.381 -0.099 0.013 N 20 16 CE1 A TYR 133 ? ? CZ A TYR 133 ? ? 1.493 1.381 0.112 0.013 N 21 16 CZ A TYR 133 ? ? CE2 A TYR 133 ? ? 1.256 1.381 -0.125 0.013 N 22 16 CE1 A PHE 192 ? ? CZ A PHE 192 ? ? 1.492 1.369 0.123 0.019 N 23 18 CE1 A TYR 133 ? ? CZ A TYR 133 ? ? 1.506 1.381 0.125 0.013 N 24 18 CZ A TYR 133 ? ? CE2 A TYR 133 ? ? 1.242 1.381 -0.139 0.013 N 25 18 CE1 A PHE 192 ? ? CZ A PHE 192 ? ? 1.483 1.369 0.114 0.019 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 92 ? ? -91.00 -158.12 2 1 SER A 98 ? ? -68.07 97.74 3 1 ARG A 103 ? ? 74.42 -32.10 4 1 ARG A 109 ? ? -17.26 90.25 5 1 PRO A 115 ? ? -34.14 139.00 6 1 ASP A 116 ? ? 77.22 35.56 7 1 THR A 140 ? ? -161.57 97.89 8 1 GLN A 148 ? ? -142.61 -60.80 9 1 ALA A 149 ? ? -108.92 -92.43 10 1 ASN A 189 ? ? 73.86 33.91 11 1 PHE A 192 ? ? -106.44 -166.02 12 2 HIS A 96 ? ? -55.41 107.07 13 2 SER A 105 ? ? 72.89 -44.19 14 2 HIS A 106 ? ? -83.28 43.10 15 2 ARG A 109 ? ? -53.08 94.85 16 2 PRO A 115 ? ? -34.77 146.30 17 2 THR A 118 ? ? -101.81 79.33 18 2 GLN A 148 ? ? -99.18 -74.99 19 2 ALA A 149 ? ? -173.62 -46.59 20 2 ASP A 160 ? ? -110.90 76.93 21 2 ASN A 189 ? ? 75.53 36.47 22 2 PHE A 192 ? ? -116.91 -166.79 23 3 HIS A 93 ? ? 62.16 89.77 24 3 HIS A 96 ? ? 69.35 -85.56 25 3 PRO A 115 ? ? -35.76 130.83 26 3 ASP A 116 ? ? 73.71 45.47 27 3 ALA A 149 ? ? 72.65 -50.05 28 3 ASN A 189 ? ? 78.20 32.15 29 4 HIS A 93 ? ? -88.23 37.66 30 4 HIS A 94 ? ? 69.86 90.83 31 4 SER A 98 ? ? -69.53 82.20 32 4 ARG A 103 ? ? -67.39 96.11 33 4 SER A 105 ? ? 64.02 -74.39 34 4 MET A 107 ? ? -73.39 -79.20 35 4 ARG A 109 ? ? 14.15 80.74 36 4 ASN A 112 ? ? -160.10 106.73 37 4 PRO A 115 ? ? -36.75 129.03 38 4 ASP A 116 ? ? 75.41 50.10 39 4 ALA A 149 ? ? -163.36 -60.73 40 4 ARG A 156 ? ? -68.24 92.97 41 4 ASN A 189 ? ? 75.48 32.02 42 4 PRO A 199 ? ? -44.91 172.04 43 5 SER A 90 ? ? -104.00 73.09 44 5 HIS A 91 ? ? 67.20 108.83 45 5 HIS A 94 ? ? -101.58 54.29 46 5 ARG A 103 ? ? -152.46 48.31 47 5 MET A 107 ? ? -102.57 55.87 48 5 ARG A 109 ? ? 10.31 80.28 49 5 PRO A 115 ? ? -34.27 149.79 50 5 ASP A 116 ? ? 70.55 31.26 51 5 THR A 118 ? ? -106.51 76.61 52 5 ALA A 149 ? ? 58.56 -88.39 53 5 PRO A 158 ? ? -39.95 132.63 54 5 SER A 164 ? ? -162.70 107.85 55 5 PHE A 192 ? ? -116.46 -169.34 56 6 SER A 98 ? ? 61.36 -171.17 57 6 LEU A 100 ? ? -118.70 -97.46 58 6 ARG A 103 ? ? -152.64 36.34 59 6 SER A 105 ? ? 66.30 -78.28 60 6 ASN A 112 ? ? -164.22 111.60 61 6 PRO A 115 ? ? -35.33 144.91 62 6 ALA A 149 ? ? 71.54 -54.34 63 6 ARG A 156 ? ? -65.52 91.27 64 6 SER A 164 ? ? -161.65 100.56 65 6 ASN A 189 ? ? 77.31 31.82 66 7 SER A 90 ? ? -62.91 -70.76 67 7 MET A 107 ? ? 66.45 -86.88 68 7 ARG A 109 ? ? 14.21 79.45 69 7 ASN A 112 ? ? -160.01 109.90 70 7 PRO A 115 ? ? -35.43 137.66 71 7 ASP A 116 ? ? 72.20 47.57 72 7 THR A 118 ? ? -102.70 77.74 73 7 THR A 140 ? ? -162.31 98.58 74 7 ALA A 149 ? ? -152.39 -61.22 75 7 ARG A 156 ? ? -68.22 97.14 76 7 ASN A 189 ? ? 77.02 33.13 77 8 HIS A 91 ? ? -103.87 42.30 78 8 HIS A 92 ? ? -131.30 -78.45 79 8 HIS A 93 ? ? 55.50 77.52 80 8 HIS A 94 ? ? 64.15 90.12 81 8 HIS A 106 ? ? 72.46 -55.52 82 8 MET A 107 ? ? 73.84 -31.07 83 8 ARG A 109 ? ? -15.38 82.61 84 8 PRO A 115 ? ? -35.43 130.49 85 8 THR A 140 ? ? -160.57 99.33 86 8 ALA A 149 ? ? 72.91 -47.04 87 8 ASN A 189 ? ? 73.97 32.82 88 9 SER A 89 ? ? 48.43 80.44 89 9 HIS A 92 ? ? 69.44 -62.14 90 9 ARG A 103 ? ? 72.54 -55.99 91 9 SER A 105 ? ? -130.00 -57.91 92 9 MET A 107 ? ? 67.38 -80.83 93 9 ASN A 112 ? ? -162.51 119.99 94 9 PRO A 115 ? ? -35.78 131.98 95 9 ASP A 116 ? ? 72.76 50.03 96 9 GLN A 148 ? ? -132.36 -74.69 97 9 ALA A 149 ? ? -155.05 -50.33 98 9 ASP A 160 ? ? -110.72 74.79 99 9 ASN A 189 ? ? 75.39 31.83 100 10 HIS A 91 ? ? 74.35 -59.97 101 10 HIS A 94 ? ? -93.05 -90.04 102 10 HIS A 95 ? ? 51.01 81.81 103 10 LEU A 100 ? ? 63.05 -80.16 104 10 VAL A 101 ? ? -125.09 -56.36 105 10 MET A 107 ? ? 63.64 -153.87 106 10 ASN A 112 ? ? -163.02 109.75 107 10 LEU A 113 ? ? -104.02 77.38 108 10 PRO A 115 ? ? -34.04 130.25 109 10 ASP A 116 ? ? 77.72 39.22 110 10 GLN A 148 ? ? -111.02 -77.47 111 10 ALA A 149 ? ? -176.73 -34.43 112 10 ASP A 160 ? ? -103.36 73.78 113 10 ASN A 189 ? ? 70.09 35.47 114 11 HIS A 92 ? ? -82.01 39.31 115 11 HIS A 96 ? ? -110.20 56.51 116 11 LEU A 100 ? ? -101.68 41.91 117 11 VAL A 101 ? ? -164.69 119.06 118 11 ARG A 103 ? ? 62.26 61.22 119 11 PRO A 115 ? ? -35.12 133.68 120 11 ASP A 116 ? ? 74.74 47.06 121 11 THR A 140 ? ? -161.68 98.56 122 11 GLN A 148 ? ? -109.62 -68.20 123 11 ALA A 149 ? ? -156.60 -53.65 124 11 ARG A 156 ? ? -68.05 91.02 125 11 ASN A 189 ? ? 73.47 36.47 126 12 LEU A 100 ? ? 65.99 102.29 127 12 ARG A 103 ? ? -146.87 44.67 128 12 MET A 107 ? ? -133.23 -74.22 129 12 PRO A 115 ? ? -33.53 142.90 130 12 ASP A 116 ? ? 72.10 40.06 131 12 GLN A 148 ? ? -133.71 -77.06 132 12 ALA A 149 ? ? -147.44 -57.45 133 12 ARG A 157 ? ? -43.78 98.41 134 12 SER A 164 ? ? -161.20 103.99 135 12 ASN A 189 ? ? 75.56 32.59 136 12 PHE A 192 ? ? -105.74 -166.45 137 13 SER A 97 ? ? 63.86 94.53 138 13 LEU A 100 ? ? 74.70 -54.65 139 13 PRO A 102 ? ? -78.45 48.92 140 13 ARG A 109 ? ? -26.97 106.98 141 13 ASN A 112 ? ? -163.08 109.06 142 13 PRO A 115 ? ? -36.59 128.88 143 13 ASP A 116 ? ? 71.94 50.84 144 13 THR A 140 ? ? -162.50 100.36 145 13 ALA A 149 ? ? -158.65 -69.30 146 13 SER A 164 ? ? -162.03 104.03 147 13 ASN A 189 ? ? 75.72 31.77 148 14 ASN A 112 ? ? -161.10 108.35 149 14 PRO A 115 ? ? -33.68 125.87 150 14 ASP A 116 ? ? 77.62 48.62 151 14 ALA A 149 ? ? 71.38 -54.51 152 15 HIS A 94 ? ? -163.52 110.43 153 15 HIS A 95 ? ? 63.74 -152.72 154 15 HIS A 106 ? ? -120.35 -80.52 155 15 ARG A 109 ? ? 14.18 88.71 156 15 PRO A 115 ? ? -30.48 138.44 157 15 ASP A 116 ? ? 76.05 40.98 158 15 GLN A 148 ? ? -106.89 -72.33 159 15 ALA A 149 ? ? -160.61 -53.97 160 15 PHE A 192 ? ? -100.75 -165.73 161 16 SER A 89 ? ? -152.93 37.57 162 16 HIS A 92 ? ? -130.34 -33.84 163 16 HIS A 106 ? ? 68.60 -18.00 164 16 ASN A 112 ? ? -160.01 107.75 165 16 PRO A 115 ? ? -35.90 127.79 166 16 ASP A 116 ? ? 75.74 43.83 167 16 GLN A 148 ? ? -106.25 -75.82 168 16 ALA A 149 ? ? -157.68 -58.06 169 16 ASP A 160 ? ? -108.33 73.49 170 16 SER A 164 ? ? -161.19 99.63 171 16 ASN A 189 ? ? 74.28 36.17 172 17 HIS A 91 ? ? -169.80 -78.32 173 17 HIS A 92 ? ? 53.04 -164.08 174 17 HIS A 94 ? ? 65.80 -82.69 175 17 HIS A 95 ? ? 69.78 131.44 176 17 LEU A 100 ? ? -92.21 -61.88 177 17 SER A 105 ? ? 61.41 -80.99 178 17 PRO A 115 ? ? -33.63 129.74 179 17 ASP A 116 ? ? 79.61 44.01 180 17 THR A 140 ? ? -162.92 100.21 181 17 ALA A 149 ? ? -168.97 -63.95 182 17 SER A 164 ? ? -160.57 101.47 183 17 ASN A 189 ? ? 76.19 33.29 184 18 SER A 89 ? ? 69.23 -72.26 185 18 HIS A 106 ? ? -135.23 -50.39 186 18 ARG A 109 ? ? -35.51 96.83 187 18 ASN A 112 ? ? -162.44 109.59 188 18 PRO A 115 ? ? -35.11 126.61 189 18 ASP A 116 ? ? 75.90 49.61 190 18 GLN A 148 ? ? -144.20 -70.18 191 18 ALA A 149 ? ? -135.28 -67.46 192 18 ASN A 189 ? ? 76.28 34.47 193 19 HIS A 91 ? ? -152.32 59.90 194 19 HIS A 95 ? ? -58.54 -74.92 195 19 VAL A 101 ? ? 37.40 88.70 196 19 HIS A 106 ? ? -95.74 49.30 197 19 MET A 107 ? ? 65.46 98.08 198 19 ARG A 109 ? ? -20.32 93.21 199 19 ASN A 112 ? ? -161.01 110.72 200 19 PRO A 115 ? ? -31.49 144.22 201 19 ASP A 116 ? ? 78.05 36.61 202 19 THR A 140 ? ? -160.64 99.79 203 19 GLN A 148 ? ? 78.05 75.56 204 19 ALA A 149 ? ? -177.85 -94.37 205 19 ASP A 160 ? ? -69.10 77.90 206 19 SER A 164 ? ? -161.27 111.79 207 19 GLN A 168 ? ? -53.16 -176.19 208 19 PHE A 192 ? ? -106.85 -166.56 209 20 HIS A 91 ? ? 62.13 71.99 210 20 HIS A 93 ? ? -138.88 -155.87 211 20 HIS A 94 ? ? 71.54 -77.95 212 20 HIS A 95 ? ? -147.29 -74.33 213 20 HIS A 96 ? ? -135.76 -58.86 214 20 HIS A 106 ? ? 64.35 78.17 215 20 PRO A 115 ? ? -29.04 144.02 216 20 ASP A 116 ? ? 74.68 37.66 217 20 THR A 140 ? ? -160.89 99.15 218 20 GLN A 148 ? ? -111.53 -80.78 219 20 ALA A 149 ? ? -151.09 -54.84 220 20 ASN A 189 ? ? 80.72 28.57 221 20 PHE A 192 ? ? -103.27 -166.67 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 MET A 139 ? ? THR A 140 ? ? 149.40 2 1 PHE A 192 ? ? GLY A 193 ? ? -149.26 3 3 PHE A 192 ? ? GLY A 193 ? ? 148.00 4 4 PHE A 192 ? ? GLY A 193 ? ? 146.77 5 6 GLY A 193 ? ? PHE A 194 ? ? 145.09 6 7 PHE A 192 ? ? GLY A 193 ? ? 145.78 7 8 PHE A 192 ? ? GLY A 193 ? ? 148.34 8 9 PHE A 192 ? ? GLY A 193 ? ? 145.47 9 10 PHE A 192 ? ? GLY A 193 ? ? 147.14 10 11 PHE A 192 ? ? GLY A 193 ? ? 144.92 11 12 PHE A 192 ? ? GLY A 193 ? ? -147.68 12 13 PHE A 192 ? ? GLY A 193 ? ? 145.52 13 14 PHE A 192 ? ? GLY A 193 ? ? 145.94 14 15 PHE A 192 ? ? GLY A 193 ? ? -148.26 15 16 PHE A 192 ? ? GLY A 193 ? ? 146.59 16 17 PHE A 192 ? ? GLY A 193 ? ? 145.18 17 18 PHE A 192 ? ? GLY A 193 ? ? 146.04 18 19 PHE A 192 ? ? GLY A 193 ? ? -149.89 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 2 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 133 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.055 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 6FZK _pdbx_nmr_ensemble.conformers_calculated_total_number 750 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 20 _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6FZK _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '500 uM [U-13C; U-15N] UB2H, 450 uM [U-99% 15N] UB2H, 100 uM not label UB2H_Lys-Oxyl, 90% H2O and 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O and 10% D2O' _pdbx_nmr_sample_details.label '15N-13C sample' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'UB2H double label' 500 ? uM '[U-13C; U-15N]' 1 'UB2H single label' 450 ? uM '[U-99% 15N]' 1 UB2H_Lys-Oxyl 100 ? uM 'not label' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'General condition' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 13 1 1 '2D 1H-15N HSQC' 3 isotropic 2 1 1 '3D HNCO' 2 isotropic 3 1 1 '3D HN(CA)CO' 2 isotropic 4 1 1 '3D BESTROSY-HNCACB' 3 isotropic 5 1 1 '3D BESTROSY-HN(CO)CACB' 3 isotropic 6 1 1 '2D 1H-13C HSQC aliphatic' 2 isotropic 7 1 1 '2D 1H-13C HSQC aromatic' 2 isotropic 8 1 1 '3D HCCH-TOCSY' 2 isotropic 9 1 1 '3D HCCH-TOCSY' 2 isotropic 10 1 1 '3D 1H-15N NOESY' 4 isotropic 11 1 1 '3D 1H-13C NOESY aliphatic' 4 isotropic 12 1 1 '3D 1H-13C NOESY aromatic' 4 isotropic # _pdbx_nmr_refine.entry_id 6FZK _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' ARIA 2.3 'Rieping W., Habeck M., Bardiaux B., Bernard A , Nilges M.' 2 refinement CNS 1.2 'Brunger, Adams, Clore, Gros, Nilges and Read' 3 'data analysis' 'CcpNmr Analysis' 2.4 CCPN 4 'data analysis' TALOS+ ? 'Yang Shen, Frank Delaglio, Gabriel Cornilescu, and Ad Bax' 5 'structure calculation' UNIO 2.0.2 'Torsten Herrmann' 6 'data analysis' NMRDraw ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 7 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # _pdbx_audit_support.funding_organization 'French National Research Agency' _pdbx_audit_support.country France _pdbx_audit_support.grant_number '60- 60900-98-207' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 700 ? 3 'AVANCE III' ? Bruker 850 ? 4 'AVANCE III' ? Bruker 950 ? # _atom_sites.entry_id 6FZK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_