data_6G7G # _entry.id 6G7G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6G7G pdb_00006g7g 10.2210/pdb6g7g/pdb WWPDB D_1200009455 ? ? BMRB 27439 ? 10.13018/BMR27439 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-03-06 2 'Structure model' 1 1 2019-03-20 3 'Structure model' 1 2 2019-05-08 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_database_proc 4 3 'Structure model' pdbx_nmr_software 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status 7 4 'Structure model' pdbx_nmr_spectrometer 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 11 5 'Structure model' pdbx_entry_details 12 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.name' 7 3 'Structure model' '_pdbx_nmr_software.name' 8 4 'Structure model' '_database_2.pdbx_DOI' 9 4 'Structure model' '_database_2.pdbx_database_accession' 10 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 11 4 'Structure model' '_pdbx_nmr_spectrometer.model' 12 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6G7G _pdbx_database_status.recvd_initial_deposition_date 2018-04-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 27439 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rajasekar, K.V.' 1 ? 'Coulthard, R.J.' 2 ? 'Ride, J.P.' 3 ? 'Ji, S.' 4 ? 'Winn, P.J.' 5 ? 'Wheeler, M.P.' 6 ? 'Hyde, E.I.' 7 ? 'Smith, L.J.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.J. _citation.journal_id_ASTM BIJOAK _citation.journal_id_CSD 0043 _citation.journal_id_ISSN 1470-8728 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 476 _citation.language ? _citation.page_first 809 _citation.page_last 826 _citation.title 'Structure of SPH (self-incompatibility protein homologue) proteins: a widespread family of small, highly stable, secreted proteins.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1042/BCJ20180828 _citation.pdbx_database_id_PubMed 30782970 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rajasekar, K.V.' 1 ? primary 'Ji, S.' 2 ? primary 'Coulthard, R.J.' 3 ? primary 'Ride, J.P.' 4 ? primary 'Reynolds, G.L.' 5 ? primary 'Winn, P.J.' 6 ? primary 'Wheeler, M.J.' 7 ? primary 'Hyde, E.I.' 8 ? primary 'Smith, L.J.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'S-protein homolog 15' _entity.formula_weight 13585.766 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AMGCKEIEIVIKNTLGPSRILQYHCRSGNTNVGVQYLNFKGTRIIKFKDDGTERSRWNCLFRQGINMKFFTEVEAYRPDL KHPLCGKRYELSARMDAIYFKMDERPPQPLNKWRS ; _entity_poly.pdbx_seq_one_letter_code_can ;AMGCKEIEIVIKNTLGPSRILQYHCRSGNTNVGVQYLNFKGTRIIKFKDDGTERSRWNCLFRQGINMKFFTEVEAYRPDL KHPLCGKRYELSARMDAIYFKMDERPPQPLNKWRS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 MET n 1 3 GLY n 1 4 CYS n 1 5 LYS n 1 6 GLU n 1 7 ILE n 1 8 GLU n 1 9 ILE n 1 10 VAL n 1 11 ILE n 1 12 LYS n 1 13 ASN n 1 14 THR n 1 15 LEU n 1 16 GLY n 1 17 PRO n 1 18 SER n 1 19 ARG n 1 20 ILE n 1 21 LEU n 1 22 GLN n 1 23 TYR n 1 24 HIS n 1 25 CYS n 1 26 ARG n 1 27 SER n 1 28 GLY n 1 29 ASN n 1 30 THR n 1 31 ASN n 1 32 VAL n 1 33 GLY n 1 34 VAL n 1 35 GLN n 1 36 TYR n 1 37 LEU n 1 38 ASN n 1 39 PHE n 1 40 LYS n 1 41 GLY n 1 42 THR n 1 43 ARG n 1 44 ILE n 1 45 ILE n 1 46 LYS n 1 47 PHE n 1 48 LYS n 1 49 ASP n 1 50 ASP n 1 51 GLY n 1 52 THR n 1 53 GLU n 1 54 ARG n 1 55 SER n 1 56 ARG n 1 57 TRP n 1 58 ASN n 1 59 CYS n 1 60 LEU n 1 61 PHE n 1 62 ARG n 1 63 GLN n 1 64 GLY n 1 65 ILE n 1 66 ASN n 1 67 MET n 1 68 LYS n 1 69 PHE n 1 70 PHE n 1 71 THR n 1 72 GLU n 1 73 VAL n 1 74 GLU n 1 75 ALA n 1 76 TYR n 1 77 ARG n 1 78 PRO n 1 79 ASP n 1 80 LEU n 1 81 LYS n 1 82 HIS n 1 83 PRO n 1 84 LEU n 1 85 CYS n 1 86 GLY n 1 87 LYS n 1 88 ARG n 1 89 TYR n 1 90 GLU n 1 91 LEU n 1 92 SER n 1 93 ALA n 1 94 ARG n 1 95 MET n 1 96 ASP n 1 97 ALA n 1 98 ILE n 1 99 TYR n 1 100 PHE n 1 101 LYS n 1 102 MET n 1 103 ASP n 1 104 GLU n 1 105 ARG n 1 106 PRO n 1 107 PRO n 1 108 GLN n 1 109 PRO n 1 110 LEU n 1 111 ASN n 1 112 LYS n 1 113 TRP n 1 114 ARG n 1 115 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 115 _entity_src_gen.gene_src_common_name 'Mouse-ear cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SPH15, At5g39493, MUL8.19' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 MET 67 67 67 MET MET A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 TRP 113 113 113 TRP TRP A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 SER 115 115 115 SER SER A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6G7G _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6G7G _struct.title ;Structure of SPH (Self-Incompatibility Protein Homologue) proteins, a widespread family of small, highly stable, secreted proteins from plants ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6G7G _struct_keywords.text 'Self-Incompatibility Protein Homolog, Origami strain E coli, plant protein' _struct_keywords.pdbx_keywords 'PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SPH15_ARATH _struct_ref.pdbx_db_accession Q9FLY6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;CKEIEIVIKNTLGPSRILQYHCRSGNTNVGVQYLNFKGTRIIKFKDDGTERSRWNCLFRQGINMKFFTEVEAYRPDLKHP LCGKRYELSARMDAIYFKMDERPPQPLNKWRS ; _struct_ref.pdbx_align_begin 21 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6G7G _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 115 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9FLY6 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 132 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 115 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6G7G ALA A 1 ? UNP Q9FLY6 ? ? 'expression tag' 1 1 1 6G7G MET A 2 ? UNP Q9FLY6 ? ? 'expression tag' 2 2 1 6G7G GLY A 3 ? UNP Q9FLY6 ? ? 'expression tag' 3 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6910 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details AUC # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 85 SG ? ? A CYS 4 A CYS 85 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 25 A CYS 59 1_555 ? ? ? ? ? ? ? 2.035 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 4 ? CYS A 85 ? CYS A 4 ? 1_555 CYS A 85 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 25 ? CYS A 59 ? CYS A 25 ? 1_555 CYS A 59 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 42 ? LYS A 46 ? THR A 42 LYS A 46 AA1 2 GLU A 8 ? THR A 14 ? GLU A 8 THR A 14 AA1 3 GLU A 90 ? ARG A 94 ? GLU A 90 ARG A 94 AA2 1 VAL A 34 ? ASN A 38 ? VAL A 34 ASN A 38 AA2 2 ILE A 20 ? ARG A 26 ? ILE A 20 ARG A 26 AA2 3 ASN A 58 ? ARG A 62 ? ASN A 58 ARG A 62 AA2 4 THR A 71 ? GLU A 74 ? THR A 71 GLU A 74 AA3 1 ILE A 98 ? TYR A 99 ? ILE A 98 TYR A 99 AA3 2 PRO A 109 ? ASN A 111 ? PRO A 109 ASN A 111 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 45 ? O ILE A 45 N ILE A 9 ? N ILE A 9 AA1 2 3 N THR A 14 ? N THR A 14 O ALA A 93 ? O ALA A 93 AA2 1 2 O GLN A 35 ? O GLN A 35 N TYR A 23 ? N TYR A 23 AA2 2 3 N GLN A 22 ? N GLN A 22 O ARG A 62 ? O ARG A 62 AA2 3 4 N CYS A 59 ? N CYS A 59 O VAL A 73 ? O VAL A 73 AA3 1 2 N ILE A 98 ? N ILE A 98 O ASN A 111 ? O ASN A 111 # _pdbx_entry_details.entry_id 6G7G _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HH A TYR 76 ? ? HZ1 A LYS 87 ? ? 1.07 2 2 OH A TYR 76 ? ? HZ1 A LYS 87 ? ? 1.53 3 2 O A ASP 103 ? ? H A ARG 105 ? ? 1.53 4 3 HH A TYR 23 ? ? HE21 A GLN 35 ? ? 1.28 5 4 O A ARG 26 ? ? HG A SER 27 ? ? 1.57 6 5 HH A TYR 76 ? ? HB3 A PRO 83 ? ? 1.23 7 5 O A LYS 81 ? ? HH12 A ARG 88 ? ? 1.59 8 5 O A ARG 77 ? ? H A ASP 79 ? ? 1.59 9 6 OD2 A ASP 49 ? ? HZ2 A LYS 87 ? ? 1.57 10 6 OD1 A ASN 38 ? ? H A PHE 39 ? ? 1.60 11 7 O A GLY 51 ? ? HG1 A THR 52 ? ? 1.57 12 7 OD2 A ASP 79 ? ? HZ3 A LYS 87 ? ? 1.58 13 7 O A ARG 26 ? ? HG A SER 27 ? ? 1.58 14 8 O A ARG 26 ? ? HG A SER 27 ? ? 1.53 15 8 H2 A ALA 1 ? ? OD1 A ASP 49 ? ? 1.59 16 9 OE1 A GLU 90 ? ? HH21 A ARG 94 ? ? 1.60 17 10 HH A TYR 76 ? ? H A ARG 88 ? ? 0.48 18 10 OH A TYR 76 ? ? H A ARG 88 ? ? 1.29 19 10 HH A TYR 76 ? ? N A ARG 88 ? ? 1.31 20 10 O A ASP 79 ? ? H A LYS 81 ? ? 1.57 21 10 OH A TYR 76 ? ? N A ARG 88 ? ? 2.13 22 11 HH A TYR 76 ? ? HE2 A HIS 82 ? ? 0.77 23 12 O A ARG 26 ? ? HG A SER 27 ? ? 1.56 24 13 OD2 A ASP 50 ? ? HG1 A THR 52 ? ? 1.56 25 14 O A GLY 51 ? ? HG1 A THR 52 ? ? 1.58 26 15 O A GLY 51 ? ? HG1 A THR 52 ? ? 1.54 27 15 H1 A ALA 1 ? ? OD1 A ASP 49 ? ? 1.59 28 18 O A ASN 13 ? ? HG1 A THR 14 ? ? 1.56 29 18 O A LYS 12 ? ? H A ALA 93 ? ? 1.60 30 19 OD1 A ASP 79 ? ? HD1 A HIS 82 ? ? 1.54 31 19 HZ1 A LYS 5 ? ? OE2 A GLU 8 ? ? 1.59 32 19 O A ARG 26 ? ? HG A SER 27 ? ? 1.60 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 3 CE1 A PHE 61 ? ? CZ A PHE 61 ? ? 1.570 1.369 0.201 0.019 N 2 3 CZ A PHE 61 ? ? CE2 A PHE 61 ? ? 1.191 1.369 -0.178 0.019 N 3 3 CZ A PHE 70 ? ? CE2 A PHE 70 ? ? 1.504 1.369 0.135 0.019 N 4 6 CE1 A TYR 76 ? ? CZ A TYR 76 ? ? 1.466 1.381 0.085 0.013 N 5 6 CZ A TYR 76 ? ? CE2 A TYR 76 ? ? 1.290 1.381 -0.091 0.013 N 6 7 CE1 A PHE 61 ? ? CZ A PHE 61 ? ? 1.544 1.369 0.175 0.019 N 7 7 CZ A PHE 61 ? ? CE2 A PHE 61 ? ? 1.245 1.369 -0.124 0.019 N 8 8 CE1 A PHE 61 ? ? CZ A PHE 61 ? ? 1.652 1.369 0.283 0.019 N 9 8 CZ A PHE 61 ? ? CE2 A PHE 61 ? ? 1.152 1.369 -0.217 0.019 N 10 9 CE1 A PHE 47 ? ? CZ A PHE 47 ? ? 1.523 1.369 0.154 0.019 N 11 9 CZ A PHE 47 ? ? CE2 A PHE 47 ? ? 1.239 1.369 -0.130 0.019 N 12 9 CE1 A TYR 76 ? ? CZ A TYR 76 ? ? 1.291 1.381 -0.090 0.013 N 13 9 CZ A TYR 76 ? ? CE2 A TYR 76 ? ? 1.466 1.381 0.085 0.013 N 14 10 CE1 A TYR 36 ? ? CZ A TYR 36 ? ? 1.241 1.381 -0.140 0.013 N 15 10 CZ A TYR 36 ? ? CE2 A TYR 36 ? ? 1.530 1.381 0.149 0.013 N 16 10 CE1 A PHE 61 ? ? CZ A PHE 61 ? ? 1.604 1.369 0.235 0.019 N 17 10 CZ A PHE 61 ? ? CE2 A PHE 61 ? ? 1.184 1.369 -0.185 0.019 N 18 10 CE1 A TYR 76 ? ? CZ A TYR 76 ? ? 1.171 1.381 -0.210 0.013 N 19 10 CZ A TYR 76 ? ? CE2 A TYR 76 ? ? 1.600 1.381 0.219 0.013 N 20 11 CE1 A PHE 61 ? ? CZ A PHE 61 ? ? 1.560 1.369 0.191 0.019 N 21 11 CZ A PHE 61 ? ? CE2 A PHE 61 ? ? 1.213 1.369 -0.156 0.019 N 22 12 CZ A PHE 70 ? ? CE2 A PHE 70 ? ? 1.498 1.369 0.129 0.019 N 23 13 CE1 A PHE 61 ? ? CZ A PHE 61 ? ? 1.580 1.369 0.211 0.019 N 24 13 CZ A PHE 61 ? ? CE2 A PHE 61 ? ? 1.239 1.369 -0.130 0.019 N 25 14 CZ A PHE 47 ? ? CE2 A PHE 47 ? ? 1.502 1.369 0.133 0.019 N 26 15 CE1 A TYR 36 ? ? CZ A TYR 36 ? ? 1.252 1.381 -0.129 0.013 N 27 15 CZ A TYR 36 ? ? CE2 A TYR 36 ? ? 1.526 1.381 0.145 0.013 N 28 15 CE1 A PHE 61 ? ? CZ A PHE 61 ? ? 1.555 1.369 0.186 0.019 N 29 15 CZ A PHE 61 ? ? CE2 A PHE 61 ? ? 1.248 1.369 -0.121 0.019 N 30 15 CE1 A TYR 99 ? ? CZ A TYR 99 ? ? 1.490 1.381 0.109 0.013 N 31 15 CZ A TYR 99 ? ? CE2 A TYR 99 ? ? 1.262 1.381 -0.119 0.013 N 32 16 CZ A PHE 70 ? ? CE2 A PHE 70 ? ? 1.487 1.369 0.118 0.019 N 33 17 CZ A PHE 70 ? ? CE2 A PHE 70 ? ? 1.491 1.369 0.122 0.019 N 34 18 CZ A TYR 23 ? ? CE2 A TYR 23 ? ? 1.494 1.381 0.113 0.013 N 35 18 CE1 A PHE 70 ? ? CZ A PHE 70 ? ? 1.506 1.369 0.137 0.019 N 36 20 CE1 A PHE 39 ? ? CZ A PHE 39 ? ? 1.495 1.369 0.126 0.019 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 10 OH A TYR 76 ? ? CZ A TYR 76 ? ? CE2 A TYR 76 ? ? 101.45 120.10 -18.65 2.70 N 2 10 CZ A TYR 76 ? ? CE2 A TYR 76 ? ? CD2 A TYR 76 ? ? 113.95 119.80 -5.85 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 4 ? ? 68.07 -178.28 2 1 THR A 14 ? ? 179.61 85.89 3 1 VAL A 32 ? ? -128.40 -59.45 4 1 PHE A 39 ? ? -57.57 98.58 5 1 LYS A 40 ? ? -130.90 -63.59 6 1 ASP A 49 ? ? -75.28 42.17 7 1 THR A 52 ? ? -77.32 -130.43 8 1 SER A 55 ? ? -161.53 9.34 9 1 ARG A 56 ? ? 36.14 -153.81 10 1 ILE A 65 ? ? 173.15 -162.45 11 1 ASN A 66 ? ? -63.93 -167.08 12 1 LYS A 68 ? ? 30.11 -95.95 13 1 PRO A 78 ? ? -82.67 35.58 14 1 LEU A 84 ? ? -96.79 -117.51 15 1 CYS A 85 ? ? 64.23 -86.01 16 1 MET A 95 ? ? -21.21 -47.29 17 1 ASP A 96 ? ? -86.88 -76.80 18 1 ASP A 103 ? ? -126.74 -168.97 19 2 THR A 14 ? ? -173.44 88.95 20 2 LYS A 40 ? ? -179.45 -60.69 21 2 ASP A 49 ? ? 57.19 -161.46 22 2 ASP A 50 ? ? 50.98 75.05 23 2 THR A 52 ? ? 58.69 130.11 24 2 SER A 55 ? ? -167.72 -115.37 25 2 ARG A 56 ? ? 168.02 -139.05 26 2 ILE A 65 ? ? -162.51 -83.69 27 2 ASN A 66 ? ? -112.37 -152.10 28 2 THR A 71 ? ? -174.65 149.59 29 2 PRO A 78 ? ? -50.18 88.82 30 2 CYS A 85 ? ? -146.55 -67.36 31 2 MET A 95 ? ? 49.59 -66.67 32 2 MET A 102 ? ? -53.18 93.13 33 2 GLU A 104 ? ? 43.43 -37.43 34 2 PRO A 109 ? ? -60.36 98.34 35 2 TRP A 113 ? ? -45.23 152.98 36 3 VAL A 32 ? ? -106.46 -65.88 37 3 ASP A 50 ? ? -111.21 -92.65 38 3 ARG A 56 ? ? 38.69 -152.36 39 3 ASN A 66 ? ? -55.93 -145.54 40 3 PHE A 69 ? ? -169.27 104.95 41 3 THR A 71 ? ? 170.01 144.90 42 3 ARG A 77 ? ? -154.19 88.25 43 3 CYS A 85 ? ? -169.35 -11.72 44 3 MET A 95 ? ? -12.67 -65.09 45 3 GLU A 104 ? ? 68.53 -2.35 46 3 ASN A 111 ? ? 177.26 105.85 47 3 TRP A 113 ? ? -68.03 92.36 48 3 ARG A 114 ? ? 30.42 -147.78 49 4 CYS A 4 ? ? -174.64 22.47 50 4 THR A 14 ? ? -158.09 74.85 51 4 PRO A 17 ? ? -39.55 116.41 52 4 SER A 27 ? ? 178.13 95.07 53 4 ASN A 29 ? ? -155.93 -6.17 54 4 VAL A 32 ? ? -140.34 -61.14 55 4 LYS A 40 ? ? -163.06 -51.50 56 4 ASP A 49 ? ? -100.14 71.39 57 4 GLN A 63 ? ? -145.34 24.46 58 4 ILE A 65 ? ? 37.03 -103.52 59 4 ASN A 66 ? ? -112.44 -156.65 60 4 CYS A 85 ? ? 179.61 -21.59 61 4 MET A 95 ? ? -23.18 -51.38 62 4 GLU A 104 ? ? 67.78 -5.43 63 4 PRO A 109 ? ? -53.12 106.21 64 5 MET A 2 ? ? -73.82 -74.31 65 5 GLU A 6 ? ? -54.00 104.96 66 5 THR A 14 ? ? -168.37 86.87 67 5 ASN A 29 ? ? -176.00 23.95 68 5 VAL A 32 ? ? -121.62 -64.84 69 5 LYS A 40 ? ? -160.12 -54.45 70 5 ASP A 49 ? ? -179.88 -168.20 71 5 ASP A 50 ? ? -166.20 21.30 72 5 SER A 55 ? ? -156.21 -89.07 73 5 ARG A 56 ? ? 57.75 119.22 74 5 GLN A 63 ? ? 67.63 87.32 75 5 ILE A 65 ? ? -158.71 -53.10 76 5 ASN A 66 ? ? -110.70 -152.26 77 5 PHE A 69 ? ? 75.42 106.33 78 5 THR A 71 ? ? 172.26 173.65 79 5 PRO A 78 ? ? -61.20 50.90 80 5 LYS A 81 ? ? -68.62 8.28 81 5 HIS A 82 ? ? -40.46 156.90 82 5 LYS A 87 ? ? -169.19 -165.26 83 5 MET A 95 ? ? -16.87 -51.96 84 5 GLU A 104 ? ? 68.68 -14.80 85 6 SER A 18 ? ? 65.42 65.68 86 6 ASN A 29 ? ? -168.27 -25.71 87 6 VAL A 32 ? ? -173.54 109.54 88 6 ASP A 50 ? ? 64.00 91.43 89 6 ARG A 56 ? ? -174.23 -177.38 90 6 GLN A 63 ? ? -152.47 30.23 91 6 ILE A 65 ? ? -158.02 -64.08 92 6 ASN A 66 ? ? -109.98 -149.48 93 6 TYR A 76 ? ? -160.79 100.93 94 6 PRO A 78 ? ? -48.32 105.90 95 6 LEU A 84 ? ? -145.80 -68.96 96 6 CYS A 85 ? ? -175.34 -61.93 97 6 ARG A 94 ? ? 41.39 9.02 98 6 MET A 95 ? ? -37.18 -27.88 99 6 ASP A 96 ? ? 159.43 67.56 100 6 ALA A 97 ? ? 86.33 -177.81 101 6 GLU A 104 ? ? 59.74 -37.65 102 6 PRO A 109 ? ? -58.18 99.58 103 7 GLU A 6 ? ? -57.73 105.18 104 7 THR A 14 ? ? -155.57 78.65 105 7 ASN A 29 ? ? -172.79 -31.10 106 7 LYS A 48 ? ? -178.08 60.13 107 7 ASP A 50 ? ? -165.52 -117.20 108 7 THR A 52 ? ? 60.50 144.56 109 7 GLU A 53 ? ? -75.22 40.91 110 7 SER A 55 ? ? -177.99 -24.05 111 7 ARG A 56 ? ? 71.89 -74.36 112 7 GLN A 63 ? ? -146.58 -66.62 113 7 ILE A 65 ? ? 40.99 -97.68 114 7 ASN A 66 ? ? -113.23 -152.69 115 7 PHE A 69 ? ? -176.56 -170.45 116 7 PHE A 70 ? ? 83.48 152.11 117 7 GLU A 74 ? ? -63.55 95.55 118 7 LEU A 84 ? ? 165.92 -75.22 119 7 CYS A 85 ? ? 177.83 -62.16 120 7 GLU A 90 ? ? -164.85 116.19 121 7 MET A 95 ? ? -13.93 -55.44 122 7 ASP A 96 ? ? -97.06 -62.29 123 7 GLU A 104 ? ? 155.68 57.04 124 7 ARG A 105 ? ? 54.24 174.63 125 7 PRO A 106 ? ? -37.39 147.71 126 8 MET A 2 ? ? 66.59 -81.37 127 8 CYS A 4 ? ? 63.63 -173.23 128 8 THR A 14 ? ? -176.35 63.47 129 8 SER A 27 ? ? 178.68 98.80 130 8 ASN A 29 ? ? 68.23 -0.74 131 8 VAL A 32 ? ? -121.76 -71.76 132 8 ASP A 49 ? ? 62.83 -12.74 133 8 ASP A 50 ? ? -80.00 -77.61 134 8 THR A 52 ? ? 58.05 174.14 135 8 SER A 55 ? ? 179.06 -86.94 136 8 ARG A 56 ? ? 172.68 153.46 137 8 GLN A 63 ? ? -152.15 -140.47 138 8 ILE A 65 ? ? -148.43 -60.28 139 8 ASN A 66 ? ? -111.37 -151.29 140 8 LYS A 68 ? ? -75.62 -168.01 141 8 ALA A 75 ? ? -64.52 -74.87 142 8 PRO A 78 ? ? -35.60 -20.60 143 8 ASP A 79 ? ? -50.60 -171.48 144 8 LEU A 80 ? ? -48.24 8.53 145 8 CYS A 85 ? ? -140.43 -23.07 146 8 MET A 95 ? ? -18.72 -55.60 147 8 PHE A 100 ? ? -159.12 73.99 148 8 PRO A 109 ? ? -52.29 105.49 149 9 THR A 14 ? ? -170.01 84.25 150 9 ASN A 29 ? ? 75.01 -20.00 151 9 VAL A 32 ? ? -163.22 101.63 152 9 ASP A 50 ? ? -164.59 107.73 153 9 THR A 52 ? ? 42.99 -136.91 154 9 GLU A 53 ? ? 26.99 54.18 155 9 SER A 55 ? ? 75.54 -55.42 156 9 ARG A 56 ? ? 68.44 156.78 157 9 GLN A 63 ? ? -167.90 99.26 158 9 ILE A 65 ? ? -149.38 -78.03 159 9 ASN A 66 ? ? -112.26 -151.27 160 9 PHE A 69 ? ? -152.48 44.35 161 9 LEU A 84 ? ? 166.61 169.92 162 9 CYS A 85 ? ? -165.20 -16.20 163 9 MET A 95 ? ? -20.87 -55.48 164 9 ASP A 103 ? ? -123.99 -168.61 165 9 ARG A 105 ? ? -146.68 -38.97 166 9 TRP A 113 ? ? -56.23 101.29 167 9 ARG A 114 ? ? 44.86 125.95 168 10 THR A 14 ? ? -168.42 74.55 169 10 ASN A 29 ? ? 169.94 -43.95 170 10 ASP A 49 ? ? -160.69 103.33 171 10 GLU A 53 ? ? -99.63 53.01 172 10 ARG A 56 ? ? 49.45 -150.42 173 10 ILE A 65 ? ? -147.26 -70.35 174 10 ASN A 66 ? ? -110.43 -150.37 175 10 THR A 71 ? ? -170.94 138.06 176 10 GLU A 74 ? ? -64.69 90.52 177 10 PRO A 78 ? ? -60.51 11.37 178 10 LEU A 80 ? ? -9.21 21.73 179 10 LYS A 81 ? ? -58.77 1.90 180 10 HIS A 82 ? ? -42.17 162.30 181 10 PRO A 83 ? ? -35.11 119.18 182 10 LEU A 84 ? ? -172.65 -163.47 183 10 MET A 95 ? ? -11.45 -58.12 184 10 ASP A 96 ? ? -91.23 -64.52 185 10 GLU A 104 ? ? 151.25 -29.71 186 11 GLU A 8 ? ? -121.79 -164.12 187 11 THR A 14 ? ? -169.69 75.75 188 11 PHE A 47 ? ? -171.68 131.17 189 11 THR A 52 ? ? 58.75 -163.29 190 11 SER A 55 ? ? 60.93 -5.07 191 11 ARG A 56 ? ? 64.13 168.46 192 11 GLN A 63 ? ? -146.89 59.15 193 11 ASN A 66 ? ? -105.04 72.95 194 11 PHE A 69 ? ? 68.13 146.56 195 11 PHE A 70 ? ? 72.76 170.18 196 11 GLU A 74 ? ? -68.04 -176.20 197 11 ALA A 75 ? ? -117.52 -76.06 198 11 PRO A 78 ? ? -81.39 42.23 199 11 MET A 95 ? ? -8.56 -63.93 200 11 ASP A 96 ? ? -90.78 -60.07 201 11 MET A 102 ? ? -167.58 78.22 202 11 PRO A 109 ? ? -56.13 103.33 203 11 ARG A 114 ? ? 50.88 -172.21 204 12 SER A 18 ? ? 70.70 33.37 205 12 SER A 27 ? ? 179.18 102.20 206 12 ASN A 31 ? ? -59.26 106.32 207 12 PHE A 47 ? ? -165.75 117.89 208 12 ASP A 49 ? ? -169.02 -151.56 209 12 SER A 55 ? ? 59.08 72.46 210 12 ARG A 56 ? ? -170.63 144.93 211 12 GLN A 63 ? ? -91.86 36.82 212 12 ASN A 66 ? ? -63.36 -149.72 213 12 MET A 67 ? ? -61.33 1.78 214 12 HIS A 82 ? ? -35.41 99.57 215 12 LEU A 84 ? ? 72.20 -99.31 216 12 LYS A 87 ? ? -162.34 -166.63 217 12 ARG A 94 ? ? 47.33 -4.90 218 12 MET A 95 ? ? -37.79 -27.64 219 12 ASP A 96 ? ? 150.61 84.25 220 12 ALA A 97 ? ? 66.85 -164.10 221 12 ASP A 103 ? ? -126.20 -169.55 222 12 GLU A 104 ? ? -96.26 -85.62 223 12 PRO A 106 ? ? -53.41 -162.83 224 12 PRO A 107 ? ? -12.34 130.66 225 12 PRO A 109 ? ? -33.02 111.20 226 13 LYS A 5 ? ? -52.75 170.33 227 13 THR A 14 ? ? -48.91 -93.35 228 13 SER A 18 ? ? 63.49 86.73 229 13 ARG A 19 ? ? -175.80 32.15 230 13 SER A 27 ? ? -172.03 96.69 231 13 ASN A 29 ? ? -162.36 39.74 232 13 LYS A 40 ? ? 177.16 -35.23 233 13 ASP A 50 ? ? 72.09 -52.68 234 13 THR A 52 ? ? -89.60 -116.43 235 13 GLN A 63 ? ? -145.45 -73.82 236 13 PHE A 70 ? ? 83.19 132.71 237 13 LEU A 80 ? ? -56.67 1.24 238 13 PRO A 83 ? ? -37.27 118.33 239 13 LEU A 84 ? ? -114.61 -167.05 240 13 CYS A 85 ? ? -120.78 -57.37 241 13 MET A 95 ? ? 9.37 -66.16 242 13 PRO A 109 ? ? -59.62 106.18 243 14 THR A 14 ? ? -173.68 105.08 244 14 PRO A 17 ? ? -28.62 124.14 245 14 SER A 18 ? ? 75.73 -89.97 246 14 ARG A 19 ? ? 32.16 95.55 247 14 ASN A 29 ? ? -172.15 -44.16 248 14 LYS A 40 ? ? 73.76 34.91 249 14 ASP A 50 ? ? -108.25 56.89 250 14 THR A 52 ? ? 62.97 128.03 251 14 SER A 55 ? ? -163.87 67.01 252 14 ARG A 56 ? ? -55.79 -176.64 253 14 GLN A 63 ? ? -165.18 -28.30 254 14 ILE A 65 ? ? -174.25 -164.72 255 14 ASN A 66 ? ? -51.98 -145.40 256 14 MET A 67 ? ? -42.50 -16.20 257 14 LYS A 68 ? ? 88.17 137.10 258 14 PHE A 69 ? ? -93.94 -88.34 259 14 PHE A 70 ? ? 76.91 151.63 260 14 TYR A 76 ? ? -162.85 99.87 261 14 LYS A 87 ? ? -176.31 122.84 262 14 ARG A 88 ? ? -160.54 99.45 263 14 ARG A 94 ? ? 68.26 -132.65 264 14 MET A 95 ? ? 47.59 28.66 265 14 ALA A 97 ? ? -178.18 -154.69 266 14 MET A 102 ? ? -51.91 104.53 267 14 GLN A 108 ? ? -177.35 -176.41 268 14 PRO A 109 ? ? -59.56 90.28 269 14 ASN A 111 ? ? -168.29 -161.70 270 14 ARG A 114 ? ? 46.23 168.56 271 15 THR A 14 ? ? -160.15 76.71 272 15 VAL A 32 ? ? -131.72 -59.75 273 15 LYS A 40 ? ? 175.40 -33.92 274 15 LYS A 48 ? ? -150.27 80.14 275 15 ASP A 49 ? ? -151.73 -94.55 276 15 ASP A 50 ? ? 162.74 127.45 277 15 THR A 52 ? ? 67.39 -167.20 278 15 ARG A 56 ? ? -154.41 -78.53 279 15 ILE A 65 ? ? 31.49 -106.18 280 15 ASN A 66 ? ? -113.85 -157.44 281 15 PHE A 69 ? ? 60.53 74.15 282 15 ALA A 75 ? ? -147.46 -62.23 283 15 LEU A 80 ? ? -20.06 -64.33 284 15 LEU A 84 ? ? 69.64 124.35 285 15 CYS A 85 ? ? -150.71 -154.22 286 15 MET A 95 ? ? -23.69 -47.29 287 15 ASP A 96 ? ? -92.98 -62.32 288 15 GLU A 104 ? ? 65.64 -20.68 289 16 MET A 2 ? ? -160.27 -57.28 290 16 LYS A 5 ? ? -24.26 148.90 291 16 THR A 14 ? ? -170.13 91.66 292 16 SER A 18 ? ? 43.97 81.64 293 16 VAL A 32 ? ? -108.76 -65.35 294 16 PHE A 39 ? ? -66.45 99.33 295 16 LYS A 40 ? ? -127.31 -50.50 296 16 ASP A 50 ? ? -169.98 109.43 297 16 THR A 52 ? ? -128.46 -159.20 298 16 GLN A 63 ? ? -160.89 -38.38 299 16 ASN A 66 ? ? -110.24 -160.73 300 16 ALA A 75 ? ? -113.25 70.86 301 16 LEU A 80 ? ? -91.83 -62.03 302 16 LEU A 84 ? ? 61.71 -74.08 303 16 MET A 95 ? ? -17.02 -55.71 304 16 ASP A 96 ? ? -85.21 -72.11 305 16 ASP A 103 ? ? -129.01 -169.97 306 16 PRO A 106 ? ? -46.16 153.39 307 16 ARG A 114 ? ? 53.54 141.48 308 17 MET A 2 ? ? -154.75 -65.06 309 17 GLU A 6 ? ? -59.66 95.51 310 17 THR A 14 ? ? -175.31 103.29 311 17 ARG A 26 ? ? -160.10 118.79 312 17 ASN A 29 ? ? -179.60 -33.04 313 17 LYS A 40 ? ? 77.58 -21.25 314 17 ASP A 50 ? ? -152.73 31.74 315 17 SER A 55 ? ? -55.30 -88.84 316 17 ARG A 56 ? ? 77.31 146.75 317 17 GLN A 63 ? ? -154.62 -53.70 318 17 ILE A 65 ? ? 162.36 144.86 319 17 ASN A 66 ? ? -112.91 69.77 320 17 PHE A 70 ? ? 77.17 149.76 321 17 TYR A 76 ? ? -177.34 108.12 322 17 LEU A 84 ? ? 177.64 171.16 323 17 CYS A 85 ? ? -111.65 -148.32 324 17 ARG A 94 ? ? 62.78 -132.18 325 17 ALA A 97 ? ? -175.53 -155.66 326 17 GLU A 104 ? ? 75.83 -22.85 327 17 PRO A 109 ? ? -62.09 95.77 328 18 CYS A 4 ? ? 70.39 147.67 329 18 THR A 14 ? ? 79.60 132.25 330 18 SER A 18 ? ? 53.50 79.51 331 18 ARG A 19 ? ? -161.14 111.49 332 18 ASN A 29 ? ? 61.77 -21.30 333 18 VAL A 32 ? ? -117.89 -74.37 334 18 VAL A 34 ? ? -118.04 -169.58 335 18 LYS A 40 ? ? -167.92 -48.01 336 18 LYS A 48 ? ? -153.23 46.85 337 18 ASP A 49 ? ? -150.89 35.99 338 18 THR A 52 ? ? -110.46 -153.58 339 18 SER A 55 ? ? -76.13 40.87 340 18 GLN A 63 ? ? -175.60 52.70 341 18 ILE A 65 ? ? 55.66 -171.30 342 18 ASN A 66 ? ? -67.32 -149.37 343 18 LYS A 68 ? ? 170.17 93.16 344 18 PRO A 78 ? ? -67.90 0.81 345 18 LEU A 84 ? ? -85.48 -88.23 346 18 LYS A 87 ? ? -165.68 -168.19 347 18 MET A 95 ? ? -2.52 -53.41 348 18 GLU A 104 ? ? 68.14 -37.11 349 18 PRO A 109 ? ? -59.02 105.01 350 18 ARG A 114 ? ? 68.03 179.25 351 19 LYS A 5 ? ? -53.98 174.94 352 19 ILE A 7 ? ? 158.57 177.25 353 19 THR A 14 ? ? -171.50 87.45 354 19 PRO A 17 ? ? -21.74 131.80 355 19 SER A 18 ? ? 81.86 69.69 356 19 SER A 27 ? ? -178.29 93.97 357 19 ASN A 29 ? ? 68.24 -2.04 358 19 VAL A 32 ? ? -171.39 98.20 359 19 LYS A 40 ? ? -164.57 -56.75 360 19 LYS A 48 ? ? -172.14 -159.60 361 19 ASP A 49 ? ? 0.97 112.62 362 19 THR A 52 ? ? 58.49 122.63 363 19 ARG A 56 ? ? 71.02 -163.42 364 19 GLN A 63 ? ? -178.60 61.17 365 19 ILE A 65 ? ? -164.45 -64.64 366 19 ASN A 66 ? ? -110.94 -150.21 367 19 PHE A 69 ? ? 69.16 -166.36 368 19 PHE A 70 ? ? 71.94 155.13 369 19 TYR A 76 ? ? 179.84 137.09 370 19 PRO A 78 ? ? -57.96 97.37 371 19 CYS A 85 ? ? 176.48 -38.04 372 19 MET A 95 ? ? -17.45 -58.47 373 19 GLU A 104 ? ? 73.87 -16.21 374 20 MET A 2 ? ? -125.46 -71.94 375 20 THR A 14 ? ? -169.84 95.91 376 20 SER A 27 ? ? -179.41 97.35 377 20 ASN A 29 ? ? -142.10 -94.47 378 20 VAL A 32 ? ? -145.74 -19.86 379 20 LYS A 40 ? ? 52.54 95.85 380 20 GLU A 53 ? ? -96.17 49.24 381 20 GLN A 63 ? ? 175.14 147.22 382 20 ILE A 65 ? ? -117.82 -81.27 383 20 ASN A 66 ? ? -110.86 -150.81 384 20 PHE A 69 ? ? -165.75 -169.46 385 20 PHE A 70 ? ? 74.59 165.37 386 20 ALA A 75 ? ? -62.94 -70.59 387 20 TYR A 76 ? ? -161.56 110.47 388 20 LEU A 84 ? ? 52.73 -162.51 389 20 CYS A 85 ? ? 58.39 -5.62 390 20 LYS A 87 ? ? -117.72 -146.65 391 20 MET A 95 ? ? -19.59 -54.76 392 20 ALA A 97 ? ? 101.59 177.49 393 20 PHE A 100 ? ? -147.90 51.85 394 20 GLU A 104 ? ? 150.29 -41.71 395 20 ARG A 105 ? ? 174.10 -25.10 396 20 PRO A 106 ? ? -52.95 -176.15 397 20 PRO A 107 ? ? -42.31 -174.47 398 20 PRO A 109 ? ? -46.78 106.68 399 20 ARG A 114 ? ? 47.02 -163.60 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 2 MET A 102 ? ? ASP A 103 ? ? 145.91 2 6 ARG A 94 ? ? MET A 95 ? ? 145.52 3 9 LYS A 5 ? ? GLU A 6 ? ? 147.99 4 11 ASN A 66 ? ? MET A 67 ? ? 149.02 5 14 THR A 14 ? ? LEU A 15 ? ? 147.62 6 15 PRO A 78 ? ? ASP A 79 ? ? 148.11 7 17 ASN A 66 ? ? MET A 67 ? ? 149.13 8 20 GLY A 86 ? ? LYS A 87 ? ? -148.20 9 20 LYS A 87 ? ? ARG A 88 ? ? -144.34 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 6 TYR A 76 ? ? 0.050 'SIDE CHAIN' 2 7 PHE A 61 ? ? 0.064 'SIDE CHAIN' 3 8 PHE A 61 ? ? 0.078 'SIDE CHAIN' 4 10 TYR A 76 ? ? 0.067 'SIDE CHAIN' 5 13 PHE A 61 ? ? 0.093 'SIDE CHAIN' 6 15 TYR A 36 ? ? 0.063 'SIDE CHAIN' 7 15 PHE A 61 ? ? 0.079 'SIDE CHAIN' 8 18 TYR A 23 ? ? 0.089 'SIDE CHAIN' 9 18 PHE A 39 ? ? 0.082 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 6G7G _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6G7G _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.3 mM [U-13C; U-15N] Sph15, 95% H2O/5% D2O' '95% H2O/5% D2O' Sample_1 solution ? 2 '1 mM [U-13C; U-15N] Sph15, 95% H2O/5% D2O' '95% H2O/5% D2O' Sample_2 solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Sph15 0.3 ? mM '[U-13C; U-15N]' 2 Sph15 1 ? mM '[U-13C; U-15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.01 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 0.005 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label Sph15 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCACB' 1 isotropic 2 1 1 '3D HN(COCA)CB' 1 isotropic 3 1 1 '3D HNCO' 1 isotropic 4 1 1 '3D HNCA' 1 isotropic 5 1 1 '3D HNCACO' 1 isotropic 11 1 1 '3D HBHA(CO)NH' 1 isotropic 10 1 1 '3D HCCH-COSY' 1 isotropic 9 1 2 '3D HCCH-TOCSY' 1 isotropic 8 1 2 '3D 1H-15N TOCSY' 2 isotropic 7 1 2 '3D 1H-15N NOESY' 2 isotropic 6 1 2 '3D 1H-13C NOESY' 3 isotropic # _pdbx_nmr_refine.entry_id 6G7G _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger A. T. et.al.' 2 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'peak picking' 'CcpNmr Analysis' ? CCPN # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Wellcome Trust' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 099185/Z/12/Z _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 500 ? 2 INOVA ? Varian 800 ? 3 AVANCE ? Bruker 600 ? # _atom_sites.entry_id 6G7G _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_