data_6G7S # _entry.id 6G7S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.366 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6G7S pdb_00006g7s 10.2210/pdb6g7s/pdb WWPDB D_1200009507 ? ? # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2023-02-15 _pdbx_database_PDB_obs_spr.pdb_id 6QMI _pdbx_database_PDB_obs_spr.replace_pdb_id 6G7S _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6G7S _pdbx_database_status.recvd_initial_deposition_date 2018-04-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Blaszczyk, M.' 1 ? 'Blundell, T.L.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Fragment linking applied to the discovery of Mycobacterium tuberculosis phosphopantetheine adenylyltransferase inhibitors' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Blaszczyk, M.' 1 ? primary 'El Bakali, J.' 2 ? primary 'Boland, J.A.' 3 ? primary 'Spry, C.' 4 ? primary 'Dias, M.' 5 ? primary 'Blundell, T.L.' 6 ? primary 'Abel, C.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6G7S _cell.details ? _cell.formula_units_Z ? _cell.length_a 97.951 _cell.length_a_esd ? _cell.length_b 97.951 _cell.length_b_esd ? _cell.length_c 112.729 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6G7S _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Phosphopantetheine adenylyltransferase' 17792.385 1 2.7.7.3 ? ? ? 2 non-polymer syn '3-indol-1-ylpropanoic acid' 189.211 1 ? ? ? ? 3 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133 1 ? ? ? ? 4 water nat water 18.015 39 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Dephospho-CoA pyrophosphorylase,Pantetheine-phosphate adenylyltransferase,PPAT' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVR SCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLNT ERT ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVR SCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLNT ERT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 THR n 1 5 GLY n 1 6 ALA n 1 7 VAL n 1 8 CYS n 1 9 PRO n 1 10 GLY n 1 11 SER n 1 12 PHE n 1 13 ASP n 1 14 PRO n 1 15 VAL n 1 16 THR n 1 17 LEU n 1 18 GLY n 1 19 HIS n 1 20 VAL n 1 21 ASP n 1 22 ILE n 1 23 PHE n 1 24 GLU n 1 25 ARG n 1 26 ALA n 1 27 ALA n 1 28 ALA n 1 29 GLN n 1 30 PHE n 1 31 ASP n 1 32 GLU n 1 33 VAL n 1 34 VAL n 1 35 VAL n 1 36 ALA n 1 37 ILE n 1 38 LEU n 1 39 VAL n 1 40 ASN n 1 41 PRO n 1 42 ALA n 1 43 LYS n 1 44 THR n 1 45 GLY n 1 46 MET n 1 47 PHE n 1 48 ASP n 1 49 LEU n 1 50 ASP n 1 51 GLU n 1 52 ARG n 1 53 ILE n 1 54 ALA n 1 55 MET n 1 56 VAL n 1 57 LYS n 1 58 GLU n 1 59 SER n 1 60 THR n 1 61 THR n 1 62 HIS n 1 63 LEU n 1 64 PRO n 1 65 ASN n 1 66 LEU n 1 67 ARG n 1 68 VAL n 1 69 GLN n 1 70 VAL n 1 71 GLY n 1 72 HIS n 1 73 GLY n 1 74 LEU n 1 75 VAL n 1 76 VAL n 1 77 ASP n 1 78 PHE n 1 79 VAL n 1 80 ARG n 1 81 SER n 1 82 CYS n 1 83 GLY n 1 84 MET n 1 85 THR n 1 86 ALA n 1 87 ILE n 1 88 VAL n 1 89 LYS n 1 90 GLY n 1 91 LEU n 1 92 ARG n 1 93 THR n 1 94 GLY n 1 95 THR n 1 96 ASP n 1 97 PHE n 1 98 GLU n 1 99 TYR n 1 100 GLU n 1 101 LEU n 1 102 GLN n 1 103 MET n 1 104 ALA n 1 105 GLN n 1 106 MET n 1 107 ASN n 1 108 LYS n 1 109 HIS n 1 110 ILE n 1 111 ALA n 1 112 GLY n 1 113 VAL n 1 114 ASP n 1 115 THR n 1 116 PHE n 1 117 PHE n 1 118 VAL n 1 119 ALA n 1 120 THR n 1 121 ALA n 1 122 PRO n 1 123 ARG n 1 124 TYR n 1 125 SER n 1 126 PHE n 1 127 VAL n 1 128 SER n 1 129 SER n 1 130 SER n 1 131 LEU n 1 132 ALA n 1 133 LYS n 1 134 GLU n 1 135 VAL n 1 136 ALA n 1 137 MET n 1 138 LEU n 1 139 GLY n 1 140 GLY n 1 141 ASP n 1 142 VAL n 1 143 SER n 1 144 GLU n 1 145 LEU n 1 146 LEU n 1 147 PRO n 1 148 GLU n 1 149 PRO n 1 150 VAL n 1 151 ASN n 1 152 ARG n 1 153 ARG n 1 154 LEU n 1 155 ARG n 1 156 ASP n 1 157 ARG n 1 158 LEU n 1 159 ASN n 1 160 THR n 1 161 GLU n 1 162 ARG n 1 163 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 163 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'coaD, kdtB, Rv2965c, MTCY349.22, u0002e' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code COAD_MYCTU _struct_ref.pdbx_db_accession P9WPA5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSC GMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLNTER T ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6G7S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 163 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P9WPA5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 161 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6G7S GLY A 1 ? UNP P9WPA5 ? ? 'expression tag' -1 1 1 6G7S SER A 2 ? UNP P9WPA5 ? ? 'expression tag' 0 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DMS non-polymer . 'DIMETHYL SULFOXIDE' ? 'C2 H6 O S' 78.133 EQ5 non-polymer . '3-indol-1-ylpropanoic acid' ? 'C11 H11 N O2' 189.211 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6G7S _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.92 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'MPD, CoHexamine Chloride, Cacodylate/Tris' _exptl_crystal_grow.pdbx_pH_range 6.5-8.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-07-02 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6G7S _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.771 _reflns.d_resolution_low 67.781 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 20447 _reflns.number_obs 20447 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.500 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.059 _reflns.pdbx_netI_over_av_sigmaI 5.500 _reflns.pdbx_netI_over_sigmaI 27.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.064 _reflns.pdbx_Rpim_I_all 0.015 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 398075 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.772 1.870 ? 0.500 ? ? ? ? 2956 100.000 ? ? ? ? 1.486 ? ? ? ? ? ? ? ? 19.800 1.486 ? ? ? 1.569 0.352 ? 1 1 ? ? 1.870 1.980 ? 1.000 ? ? ? ? 2797 100.000 ? ? ? ? 0.769 ? ? ? ? ? ? ? ? 20.300 0.769 ? ? ? 0.807 0.179 ? 2 1 ? ? 1.980 2.120 ? 2.000 ? ? ? ? 2634 100.000 ? ? ? ? 0.361 ? ? ? ? ? ? ? ? 19.800 0.361 ? ? ? 0.377 0.084 ? 3 1 ? ? 2.120 2.290 ? 3.800 ? ? ? ? 2446 100.000 ? ? ? ? 0.190 ? ? ? ? ? ? ? ? 19.900 0.190 ? ? ? 0.199 0.044 ? 4 1 ? ? 2.290 2.500 ? 6.000 ? ? ? ? 2262 100.000 ? ? ? ? 0.122 ? ? ? ? ? ? ? ? 20.300 0.122 ? ? ? 0.128 0.028 ? 5 1 ? ? 2.500 2.800 ? 8.900 ? ? ? ? 2058 100.000 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 19.500 0.079 ? ? ? 0.084 0.019 ? 6 1 ? ? 2.800 3.230 ? 12.000 ? ? ? ? 1830 100.000 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 18.900 0.054 ? ? ? 0.059 0.014 ? 7 1 ? ? 3.230 3.960 ? 12.900 ? ? ? ? 1544 100.000 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 18.200 0.046 ? ? ? 0.050 0.012 ? 8 1 ? ? 3.960 5.600 ? 14.300 ? ? ? ? 1214 100.000 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 17.800 0.042 ? ? ? 0.045 0.010 ? 9 1 ? ? 5.600 67.781 ? 11.200 ? ? ? ? 706 100.000 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 16.400 0.044 ? ? ? 0.049 0.012 ? 10 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 131.230 _refine.B_iso_mean 47.1400 _refine.B_iso_min 21.300 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6G7S _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.7710 _refine.ls_d_res_low 67.7810 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20446 _refine.ls_number_reflns_R_free 1046 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9900 _refine.ls_percent_reflns_R_free 5.1200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1931 _refine.ls_R_factor_R_free 0.2206 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1917 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1TFU _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.5800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.7710 _refine_hist.d_res_low 67.7810 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 1231 _refine_hist.pdbx_number_residues_total 151 _refine_hist.pdbx_B_iso_mean_ligand 74.07 _refine_hist.pdbx_B_iso_mean_solvent 42.86 _refine_hist.pdbx_number_atoms_protein 1158 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1195 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.192 ? 1615 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.074 ? 186 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 210 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.653 ? 435 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7711 1.8645 2887 . 157 2730 100.0000 . . . 0.2957 0.0000 0.2716 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 1.8645 1.9813 2893 . 143 2750 100.0000 . . . 0.2564 0.0000 0.2304 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 1.9813 2.1343 2895 . 161 2734 100.0000 . . . 0.2326 0.0000 0.2016 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.1343 2.3491 2893 . 149 2744 100.0000 . . . 0.2266 0.0000 0.1840 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.3491 2.6890 2917 . 154 2763 100.0000 . . . 0.2608 0.0000 0.2003 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.6890 3.3879 2936 . 143 2793 100.0000 . . . 0.2275 0.0000 0.2012 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.3879 67.8308 3025 . 139 2886 100.0000 . . . 0.1964 0.0000 0.1791 . . . . . . 7 . . . # _struct.entry_id 6G7S _struct.title ;Phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis in complex with 3-(1H-indol-1-yl)propanoic acid at 1.7A resolution. ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6G7S _struct_keywords.text 'CoaD, PPAT, Transferase, Complex' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 16 ? PHE A 30 ? THR A 14 PHE A 28 1 ? 15 HELX_P HELX_P2 AA2 ASP A 48 ? THR A 60 ? ASP A 46 THR A 58 1 ? 13 HELX_P HELX_P3 AA3 LEU A 74 ? CYS A 82 ? LEU A 72 CYS A 80 1 ? 9 HELX_P HELX_P4 AA4 ASP A 96 ? GLY A 112 ? ASP A 94 GLY A 110 1 ? 17 HELX_P HELX_P5 AA5 ALA A 121 ? SER A 125 ? ALA A 119 SER A 123 5 ? 5 HELX_P HELX_P6 AA6 SER A 128 ? LEU A 138 ? SER A 126 LEU A 136 1 ? 11 HELX_P HELX_P7 AA7 VAL A 142 ? LEU A 146 ? VAL A 140 LEU A 144 5 ? 5 HELX_P HELX_P8 AA8 PRO A 147 ? ARG A 157 ? PRO A 145 ARG A 155 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 13 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 11 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 14 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 12 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.98 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 66 ? VAL A 70 ? LEU A 64 VAL A 68 AA1 2 GLU A 32 ? ILE A 37 ? GLU A 30 ILE A 35 AA1 3 GLY A 5 ? GLY A 10 ? GLY A 3 GLY A 8 AA1 4 ALA A 86 ? LEU A 91 ? ALA A 84 LEU A 89 AA1 5 ASP A 114 ? ALA A 119 ? ASP A 112 ALA A 117 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ARG A 67 ? O ARG A 65 N VAL A 35 ? N VAL A 33 AA1 2 3 O VAL A 34 ? O VAL A 32 N CYS A 8 ? N CYS A 6 AA1 3 4 N VAL A 7 ? N VAL A 5 O VAL A 88 ? O VAL A 86 AA1 4 5 N ILE A 87 ? N ILE A 85 O PHE A 116 ? O PHE A 114 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EQ5 201 ? 9 'binding site for residue EQ5 A 201' AC2 Software A DMS 202 ? 2 'binding site for residue DMS A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 PRO A 9 ? PRO A 7 . ? 1_555 ? 2 AC1 9 GLY A 10 ? GLY A 8 . ? 1_555 ? 3 AC1 9 SER A 11 ? SER A 9 . ? 1_555 ? 4 AC1 9 PHE A 12 ? PHE A 10 . ? 1_555 ? 5 AC1 9 HIS A 19 ? HIS A 17 . ? 1_555 ? 6 AC1 9 ILE A 22 ? ILE A 20 . ? 1_555 ? 7 AC1 9 GLY A 90 ? GLY A 88 . ? 1_555 ? 8 AC1 9 ARG A 92 ? ARG A 90 . ? 1_555 ? 9 AC1 9 THR A 120 ? THR A 118 . ? 1_555 ? 10 AC2 2 HOH D . ? HOH A 336 . ? 2_675 ? 11 AC2 2 HOH D . ? HOH A 336 . ? 1_555 ? # _atom_sites.entry_id 6G7S _atom_sites.fract_transf_matrix[1][1] 0.010209 _atom_sites.fract_transf_matrix[1][2] 0.005894 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011789 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008871 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 SER 2 0 ? ? ? A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 THR 4 2 2 THR THR A . n A 1 5 GLY 5 3 3 GLY GLY A . n A 1 6 ALA 6 4 4 ALA ALA A . n A 1 7 VAL 7 5 5 VAL VAL A . n A 1 8 CYS 8 6 6 CYS CYS A . n A 1 9 PRO 9 7 7 PRO PRO A . n A 1 10 GLY 10 8 8 GLY GLY A . n A 1 11 SER 11 9 9 SER SER A . n A 1 12 PHE 12 10 10 PHE PHE A . n A 1 13 ASP 13 11 11 ASP ASP A . n A 1 14 PRO 14 12 12 PRO PRO A . n A 1 15 VAL 15 13 13 VAL VAL A . n A 1 16 THR 16 14 14 THR THR A . n A 1 17 LEU 17 15 15 LEU LEU A . n A 1 18 GLY 18 16 16 GLY GLY A . n A 1 19 HIS 19 17 17 HIS HIS A . n A 1 20 VAL 20 18 18 VAL VAL A . n A 1 21 ASP 21 19 19 ASP ASP A . n A 1 22 ILE 22 20 20 ILE ILE A . n A 1 23 PHE 23 21 21 PHE PHE A . n A 1 24 GLU 24 22 22 GLU GLU A . n A 1 25 ARG 25 23 23 ARG ARG A . n A 1 26 ALA 26 24 24 ALA ALA A . n A 1 27 ALA 27 25 25 ALA ALA A . n A 1 28 ALA 28 26 26 ALA ALA A . n A 1 29 GLN 29 27 27 GLN GLN A . n A 1 30 PHE 30 28 28 PHE PHE A . n A 1 31 ASP 31 29 29 ASP ASP A . n A 1 32 GLU 32 30 30 GLU GLU A . n A 1 33 VAL 33 31 31 VAL VAL A . n A 1 34 VAL 34 32 32 VAL VAL A . n A 1 35 VAL 35 33 33 VAL VAL A . n A 1 36 ALA 36 34 34 ALA ALA A . n A 1 37 ILE 37 35 35 ILE ILE A . n A 1 38 LEU 38 36 36 LEU LEU A . n A 1 39 VAL 39 37 ? ? ? A . n A 1 40 ASN 40 38 ? ? ? A . n A 1 41 PRO 41 39 ? ? ? A . n A 1 42 ALA 42 40 ? ? ? A . n A 1 43 LYS 43 41 ? ? ? A . n A 1 44 THR 44 42 ? ? ? A . n A 1 45 GLY 45 43 43 GLY GLY A . n A 1 46 MET 46 44 44 MET MET A . n A 1 47 PHE 47 45 45 PHE PHE A . n A 1 48 ASP 48 46 46 ASP ASP A . n A 1 49 LEU 49 47 47 LEU LEU A . n A 1 50 ASP 50 48 48 ASP ASP A . n A 1 51 GLU 51 49 49 GLU GLU A . n A 1 52 ARG 52 50 50 ARG ARG A . n A 1 53 ILE 53 51 51 ILE ILE A . n A 1 54 ALA 54 52 52 ALA ALA A . n A 1 55 MET 55 53 53 MET MET A . n A 1 56 VAL 56 54 54 VAL VAL A . n A 1 57 LYS 57 55 55 LYS LYS A . n A 1 58 GLU 58 56 56 GLU GLU A . n A 1 59 SER 59 57 57 SER SER A . n A 1 60 THR 60 58 58 THR THR A . n A 1 61 THR 61 59 59 THR THR A . n A 1 62 HIS 62 60 60 HIS HIS A . n A 1 63 LEU 63 61 61 LEU LEU A . n A 1 64 PRO 64 62 62 PRO PRO A . n A 1 65 ASN 65 63 63 ASN ASN A . n A 1 66 LEU 66 64 64 LEU LEU A . n A 1 67 ARG 67 65 65 ARG ARG A . n A 1 68 VAL 68 66 66 VAL VAL A . n A 1 69 GLN 69 67 67 GLN GLN A . n A 1 70 VAL 70 68 68 VAL VAL A . n A 1 71 GLY 71 69 69 GLY GLY A . n A 1 72 HIS 72 70 70 HIS HIS A . n A 1 73 GLY 73 71 71 GLY GLY A . n A 1 74 LEU 74 72 72 LEU LEU A . n A 1 75 VAL 75 73 73 VAL VAL A . n A 1 76 VAL 76 74 74 VAL VAL A . n A 1 77 ASP 77 75 75 ASP ASP A . n A 1 78 PHE 78 76 76 PHE PHE A . n A 1 79 VAL 79 77 77 VAL VAL A . n A 1 80 ARG 80 78 78 ARG ARG A . n A 1 81 SER 81 79 79 SER SER A . n A 1 82 CYS 82 80 80 CYS CYS A . n A 1 83 GLY 83 81 81 GLY GLY A . n A 1 84 MET 84 82 82 MET MET A . n A 1 85 THR 85 83 83 THR THR A . n A 1 86 ALA 86 84 84 ALA ALA A . n A 1 87 ILE 87 85 85 ILE ILE A . n A 1 88 VAL 88 86 86 VAL VAL A . n A 1 89 LYS 89 87 87 LYS LYS A . n A 1 90 GLY 90 88 88 GLY GLY A . n A 1 91 LEU 91 89 89 LEU LEU A . n A 1 92 ARG 92 90 90 ARG ARG A . n A 1 93 THR 93 91 91 THR THR A . n A 1 94 GLY 94 92 92 GLY GLY A . n A 1 95 THR 95 93 93 THR THR A . n A 1 96 ASP 96 94 94 ASP ASP A . n A 1 97 PHE 97 95 95 PHE PHE A . n A 1 98 GLU 98 96 96 GLU GLU A . n A 1 99 TYR 99 97 97 TYR TYR A . n A 1 100 GLU 100 98 98 GLU GLU A . n A 1 101 LEU 101 99 99 LEU LEU A . n A 1 102 GLN 102 100 100 GLN GLN A . n A 1 103 MET 103 101 101 MET MET A . n A 1 104 ALA 104 102 102 ALA ALA A . n A 1 105 GLN 105 103 103 GLN GLN A . n A 1 106 MET 106 104 104 MET MET A . n A 1 107 ASN 107 105 105 ASN ASN A . n A 1 108 LYS 108 106 106 LYS LYS A . n A 1 109 HIS 109 107 107 HIS HIS A . n A 1 110 ILE 110 108 108 ILE ILE A . n A 1 111 ALA 111 109 109 ALA ALA A . n A 1 112 GLY 112 110 110 GLY GLY A . n A 1 113 VAL 113 111 111 VAL VAL A . n A 1 114 ASP 114 112 112 ASP ASP A . n A 1 115 THR 115 113 113 THR THR A . n A 1 116 PHE 116 114 114 PHE PHE A . n A 1 117 PHE 117 115 115 PHE PHE A . n A 1 118 VAL 118 116 116 VAL VAL A . n A 1 119 ALA 119 117 117 ALA ALA A . n A 1 120 THR 120 118 118 THR THR A . n A 1 121 ALA 121 119 119 ALA ALA A . n A 1 122 PRO 122 120 120 PRO PRO A . n A 1 123 ARG 123 121 121 ARG ARG A . n A 1 124 TYR 124 122 122 TYR TYR A . n A 1 125 SER 125 123 123 SER SER A . n A 1 126 PHE 126 124 124 PHE PHE A . n A 1 127 VAL 127 125 125 VAL VAL A . n A 1 128 SER 128 126 126 SER SER A . n A 1 129 SER 129 127 127 SER SER A . n A 1 130 SER 130 128 128 SER SER A . n A 1 131 LEU 131 129 129 LEU LEU A . n A 1 132 ALA 132 130 130 ALA ALA A . n A 1 133 LYS 133 131 131 LYS LYS A . n A 1 134 GLU 134 132 132 GLU GLU A . n A 1 135 VAL 135 133 133 VAL VAL A . n A 1 136 ALA 136 134 134 ALA ALA A . n A 1 137 MET 137 135 135 MET MET A . n A 1 138 LEU 138 136 136 LEU LEU A . n A 1 139 GLY 139 137 137 GLY GLY A . n A 1 140 GLY 140 138 138 GLY GLY A . n A 1 141 ASP 141 139 139 ASP ASP A . n A 1 142 VAL 142 140 140 VAL VAL A . n A 1 143 SER 143 141 141 SER SER A . n A 1 144 GLU 144 142 142 GLU GLU A . n A 1 145 LEU 145 143 143 LEU LEU A . n A 1 146 LEU 146 144 144 LEU LEU A . n A 1 147 PRO 147 145 145 PRO PRO A . n A 1 148 GLU 148 146 146 GLU GLU A . n A 1 149 PRO 149 147 147 PRO PRO A . n A 1 150 VAL 150 148 148 VAL VAL A . n A 1 151 ASN 151 149 149 ASN ASN A . n A 1 152 ARG 152 150 150 ARG ARG A . n A 1 153 ARG 153 151 151 ARG ARG A . n A 1 154 LEU 154 152 152 LEU LEU A . n A 1 155 ARG 155 153 153 ARG ARG A . n A 1 156 ASP 156 154 154 ASP ASP A . n A 1 157 ARG 157 155 155 ARG ARG A . n A 1 158 LEU 158 156 156 LEU LEU A . n A 1 159 ASN 159 157 157 ASN ASN A . n A 1 160 THR 160 158 ? ? ? A . n A 1 161 GLU 161 159 ? ? ? A . n A 1 162 ARG 162 160 ? ? ? A . n A 1 163 THR 163 161 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EQ5 1 201 1 EQ5 LIG A . C 3 DMS 1 202 1 DMS DMS A . D 4 HOH 1 301 24 HOH HOH A . D 4 HOH 2 302 21 HOH HOH A . D 4 HOH 3 303 22 HOH HOH A . D 4 HOH 4 304 16 HOH HOH A . D 4 HOH 5 305 13 HOH HOH A . D 4 HOH 6 306 2 HOH HOH A . D 4 HOH 7 307 4 HOH HOH A . D 4 HOH 8 308 10 HOH HOH A . D 4 HOH 9 309 29 HOH HOH A . D 4 HOH 10 310 9 HOH HOH A . D 4 HOH 11 311 39 HOH HOH A . D 4 HOH 12 312 17 HOH HOH A . D 4 HOH 13 313 11 HOH HOH A . D 4 HOH 14 314 30 HOH HOH A . D 4 HOH 15 315 26 HOH HOH A . D 4 HOH 16 316 7 HOH HOH A . D 4 HOH 17 317 6 HOH HOH A . D 4 HOH 18 318 1 HOH HOH A . D 4 HOH 19 319 23 HOH HOH A . D 4 HOH 20 320 12 HOH HOH A . D 4 HOH 21 321 18 HOH HOH A . D 4 HOH 22 322 27 HOH HOH A . D 4 HOH 23 323 31 HOH HOH A . D 4 HOH 24 324 32 HOH HOH A . D 4 HOH 25 325 14 HOH HOH A . D 4 HOH 26 326 36 HOH HOH A . D 4 HOH 27 327 20 HOH HOH A . D 4 HOH 28 328 3 HOH HOH A . D 4 HOH 29 329 37 HOH HOH A . D 4 HOH 30 330 15 HOH HOH A . D 4 HOH 31 331 35 HOH HOH A . D 4 HOH 32 332 28 HOH HOH A . D 4 HOH 33 333 33 HOH HOH A . D 4 HOH 34 334 19 HOH HOH A . D 4 HOH 35 335 5 HOH HOH A . D 4 HOH 36 336 34 HOH HOH A . D 4 HOH 37 337 8 HOH HOH A . D 4 HOH 38 338 25 HOH HOH A . D 4 HOH 39 339 38 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 15260 ? 1 MORE -80 ? 1 'SSA (A^2)' 34860 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_675 -y+1,x-y+2,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 169.6561086522 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_465 -x+y-1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -146.9265000000 -0.8660254038 -0.5000000000 0.0000000000 84.8280543261 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_465 y-1,x+1,-z -0.5000000000 0.8660254038 0.0000000000 -146.9265000000 0.8660254038 0.5000000000 0.0000000000 84.8280543261 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_675 x-y+1,-y+2,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 169.6561086522 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 -x,-x+y,-z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A DMS 202 ? C DMS . 2 1 A DMS 202 ? C DMS . 3 1 A HOH 312 ? D HOH . 4 1 A HOH 331 ? D HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-04-24 2 'Structure model' 1 1 2023-02-15 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Obsolete ? ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_PDB_obs_spr 3 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code' 4 2 'Structure model' '_pdbx_database_status.status_code_sf' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -25.9457 76.8363 13.9705 0.3127 0.4202 0.4583 -0.0206 -0.2255 0.1178 0.1622 1.7142 0.7710 -0.3552 0.1058 0.4606 0.1730 -0.0715 0.4061 -0.3034 -0.2861 -0.9448 0.4199 0.1205 0.3183 'X-RAY DIFFRACTION' 2 ? refined -25.7259 84.2328 12.2453 0.2242 0.3753 0.4038 0.0389 -0.1695 -0.0039 0.0990 0.1868 0.4177 0.0073 -0.1319 0.1494 -0.2303 0.1403 -0.0705 -0.4299 0.0787 -0.3026 0.4184 0.1058 0.2045 'X-RAY DIFFRACTION' 3 ? refined -34.1666 91.7569 6.4935 0.2755 0.2977 0.2927 0.0201 -0.0706 -0.0516 0.0755 0.0451 0.0327 -0.0124 -0.0567 0.0207 -0.0691 0.0785 -0.0000 -0.1376 0.2066 -0.2070 0.4184 0.0626 0.0465 'X-RAY DIFFRACTION' 4 ? refined -36.6277 65.9080 16.4823 0.4270 0.3399 0.4525 0.0246 -0.1779 0.2285 0.6530 0.7480 0.2117 0.4789 0.3231 0.0694 0.1367 0.0667 0.2385 -0.1722 -0.8859 -0.6455 0.2527 0.2977 0.2351 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 1 A 58 ;chain 'A' and (resid 1 through 58 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 59 A 94 ;chain 'A' and (resid 59 through 94 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 95 A 117 ;chain 'A' and (resid 95 through 117 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 118 A 157 ;chain 'A' and (resid 118 through 157 ) ; ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.20 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLY _pdbx_validate_rmsd_angle.auth_seq_id_1 71 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 GLY _pdbx_validate_rmsd_angle.auth_seq_id_2 71 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 GLY _pdbx_validate_rmsd_angle.auth_seq_id_3 71 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 128.97 _pdbx_validate_rmsd_angle.angle_target_value 113.10 _pdbx_validate_rmsd_angle.angle_deviation 15.87 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 155 ? ? -77.39 43.71 2 1 LEU A 156 ? ? -143.59 -42.39 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 HIS A 70 ? ? GLY A 71 ? ? -131.71 2 1 GLY A 71 ? ? LEU A 72 ? ? 132.13 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A SER 0 ? A SER 2 3 1 Y 1 A VAL 37 ? A VAL 39 4 1 Y 1 A ASN 38 ? A ASN 40 5 1 Y 1 A PRO 39 ? A PRO 41 6 1 Y 1 A ALA 40 ? A ALA 42 7 1 Y 1 A LYS 41 ? A LYS 43 8 1 Y 1 A THR 42 ? A THR 44 9 1 Y 1 A THR 158 ? A THR 160 10 1 Y 1 A GLU 159 ? A GLU 161 11 1 Y 1 A ARG 160 ? A ARG 162 12 1 Y 1 A THR 161 ? A THR 163 # _pdbx_audit_support.funding_organization 'Bill & Melinda Gates Foundation' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-indol-1-ylpropanoic acid' EQ5 3 'DIMETHYL SULFOXIDE' DMS 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #