data_6G81 # _entry.id 6G81 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6G81 pdb_00006g81 10.2210/pdb6g81/pdb WWPDB D_1200009528 ? ? BMRB 34257 ? 10.13018/BMR34257 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-10-10 2 'Structure model' 1 1 2018-12-05 3 'Structure model' 1 2 2019-05-08 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_database_proc 4 3 'Structure model' pdbx_nmr_software 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status 7 4 'Structure model' pdbx_nmr_spectrometer 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_pdbx_nmr_software.name' 6 4 'Structure model' '_database_2.pdbx_DOI' 7 4 'Structure model' '_database_2.pdbx_database_accession' 8 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 9 4 'Structure model' '_pdbx_nmr_spectrometer.model' 10 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6G81 _pdbx_database_status.recvd_initial_deposition_date 2018-04-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of the Ni metallochaperone HypA from Helicobacter pylori' _pdbx_database_related.db_id 34257 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Spronk, C.A.E.M.' 1 ? 'Zerko, S.' 2 ? 'Gorka, M.' 3 ? 'Kozminski, W.' 4 ? 'Bardiaux, B.' 5 ? 'Zambelli, B.' 6 ? 'Musiani, F.' 7 ? 'Piccioli, M.' 8 ? 'Hu, H.' 9 ? 'Maroney, M.' 10 ? 'Ciurli, S.' 11 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GW _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Biol. Inorg. Chem.' _citation.journal_id_ASTM JJBCFA _citation.journal_id_CSD ? _citation.journal_id_ISSN 1432-1327 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 23 _citation.language ? _citation.page_first 1309 _citation.page_last 1330 _citation.title ;Structure and dynamics of Helicobacter pylori nickel-chaperone HypA: an integrated approach using NMR spectroscopy, functional assays and computational tools. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1007/s00775-018-1616-y _citation.pdbx_database_id_PubMed 30264175 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Spronk, C.A.E.M.' 1 ? primary 'Zerko, S.' 2 ? primary 'Gorka, M.' 3 ? primary 'Kozminski, W.' 4 ? primary 'Bardiaux, B.' 5 ? primary 'Zambelli, B.' 6 ? primary 'Musiani, F.' 7 ? primary 'Piccioli, M.' 8 ? primary 'Basak, P.' 9 ? primary 'Blum, F.C.' 10 ? primary 'Johnson, R.C.' 11 ? primary 'Hu, H.' 12 ? primary 'Merrell, D.S.' 13 ? primary 'Maroney, M.' 14 ? primary 'Ciurli, S.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hydrogenase maturation factor HypA' 13221.247 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHEYSVVSSLIALCEEHAKKNQAHKIERVVVGIGERSAMDKSLFVSAFETFREESLVCKDAILDIVDEKVELECKDCSHV FKPNALDYGVCEKCHSKNVIITQGNEMRLLSLEMLAE ; _entity_poly.pdbx_seq_one_letter_code_can ;MHEYSVVSSLIALCEEHAKKNQAHKIERVVVGIGERSAMDKSLFVSAFETFREESLVCKDAILDIVDEKVELECKDCSHV FKPNALDYGVCEKCHSKNVIITQGNEMRLLSLEMLAE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 GLU n 1 4 TYR n 1 5 SER n 1 6 VAL n 1 7 VAL n 1 8 SER n 1 9 SER n 1 10 LEU n 1 11 ILE n 1 12 ALA n 1 13 LEU n 1 14 CYS n 1 15 GLU n 1 16 GLU n 1 17 HIS n 1 18 ALA n 1 19 LYS n 1 20 LYS n 1 21 ASN n 1 22 GLN n 1 23 ALA n 1 24 HIS n 1 25 LYS n 1 26 ILE n 1 27 GLU n 1 28 ARG n 1 29 VAL n 1 30 VAL n 1 31 VAL n 1 32 GLY n 1 33 ILE n 1 34 GLY n 1 35 GLU n 1 36 ARG n 1 37 SER n 1 38 ALA n 1 39 MET n 1 40 ASP n 1 41 LYS n 1 42 SER n 1 43 LEU n 1 44 PHE n 1 45 VAL n 1 46 SER n 1 47 ALA n 1 48 PHE n 1 49 GLU n 1 50 THR n 1 51 PHE n 1 52 ARG n 1 53 GLU n 1 54 GLU n 1 55 SER n 1 56 LEU n 1 57 VAL n 1 58 CYS n 1 59 LYS n 1 60 ASP n 1 61 ALA n 1 62 ILE n 1 63 LEU n 1 64 ASP n 1 65 ILE n 1 66 VAL n 1 67 ASP n 1 68 GLU n 1 69 LYS n 1 70 VAL n 1 71 GLU n 1 72 LEU n 1 73 GLU n 1 74 CYS n 1 75 LYS n 1 76 ASP n 1 77 CYS n 1 78 SER n 1 79 HIS n 1 80 VAL n 1 81 PHE n 1 82 LYS n 1 83 PRO n 1 84 ASN n 1 85 ALA n 1 86 LEU n 1 87 ASP n 1 88 TYR n 1 89 GLY n 1 90 VAL n 1 91 CYS n 1 92 GLU n 1 93 LYS n 1 94 CYS n 1 95 HIS n 1 96 SER n 1 97 LYS n 1 98 ASN n 1 99 VAL n 1 100 ILE n 1 101 ILE n 1 102 THR n 1 103 GLN n 1 104 GLY n 1 105 ASN n 1 106 GLU n 1 107 MET n 1 108 ARG n 1 109 LEU n 1 110 LEU n 1 111 SER n 1 112 LEU n 1 113 GLU n 1 114 MET n 1 115 LEU n 1 116 ALA n 1 117 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 117 _entity_src_gen.gene_src_common_name 'Campylobacter pylori J99' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'hypA, jhp_0803' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'J99 / ATCC 700824' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Helicobacter pylori J99' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 85963 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 CYS 91 91 91 CYS CYS A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 CYS 94 94 94 CYS CYS A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 GLU 117 117 117 GLU GLU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 118 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6G81 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6G81 _struct.title 'Solution structure of the Ni metallochaperone HypA from Helicobacter pylori' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6G81 _struct_keywords.text 'metallochaperone metal-binding Nickel hydrogenase, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HYPA_HELPJ _struct_ref.pdbx_db_accession P0A0U5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MHEYSVVSSLIALCEEHAKKNQAHKIERVVVGIGERSAMDKSLFVSAFETFREESLVCKDAILDIVDEKVELECKDCSHV FKPNALDYGVCEKCHSKNVIITQGNEMRLLSLEMLAE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6G81 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 117 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A0U5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 117 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 117 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7280 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 2 ? ASN A 21 ? HIS A 2 ASN A 21 1 ? 20 HELX_P HELX_P2 AA2 ASP A 40 ? GLU A 53 ? ASP A 40 GLU A 53 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 74 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 74 A ZN 201 1_555 ? ? ? ? ? ? ? 2.337 ? ? metalc2 metalc ? ? A CYS 77 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 77 A ZN 201 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc3 metalc ? ? A CYS 91 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 91 A ZN 201 1_555 ? ? ? ? ? ? ? 2.340 ? ? metalc4 metalc ? ? A CYS 94 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 94 A ZN 201 1_555 ? ? ? ? ? ? ? 2.365 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 74 ? A CYS 74 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 77 ? A CYS 77 ? 1_555 109.3 ? 2 SG ? A CYS 74 ? A CYS 74 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 91 ? A CYS 91 ? 1_555 110.3 ? 3 SG ? A CYS 77 ? A CYS 77 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 91 ? A CYS 91 ? 1_555 110.0 ? 4 SG ? A CYS 74 ? A CYS 74 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 94 ? A CYS 94 ? 1_555 110.2 ? 5 SG ? A CYS 77 ? A CYS 77 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 94 ? A CYS 94 ? 1_555 108.3 ? 6 SG ? A CYS 91 ? A CYS 91 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 94 ? A CYS 94 ? 1_555 108.7 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 62 ? GLU A 68 ? ILE A 62 GLU A 68 AA1 2 ALA A 23 ? GLY A 34 ? ALA A 23 GLY A 34 AA1 3 ARG A 108 ? ALA A 116 ? ARG A 108 ALA A 116 AA2 1 GLU A 71 ? CYS A 74 ? GLU A 71 CYS A 74 AA2 2 VAL A 99 ? GLN A 103 ? VAL A 99 GLN A 103 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 62 ? O ILE A 62 N VAL A 29 ? N VAL A 29 AA1 2 3 N LYS A 25 ? N LYS A 25 O LEU A 115 ? O LEU A 115 AA2 1 2 N GLU A 73 ? N GLU A 73 O ILE A 100 ? O ILE A 100 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 74 ? CYS A 74 . ? 1_555 ? 2 AC1 4 CYS A 77 ? CYS A 77 . ? 1_555 ? 3 AC1 4 CYS A 91 ? CYS A 91 . ? 1_555 ? 4 AC1 4 CYS A 94 ? CYS A 94 . ? 1_555 ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH2 A ARG 36 ? ? 123.68 120.30 3.38 0.50 N 2 1 NE A ARG 52 ? ? CZ A ARG 52 ? ? NH2 A ARG 52 ? ? 117.05 120.30 -3.25 0.50 N 3 1 N A HIS 79 ? ? CA A HIS 79 ? ? C A HIS 79 ? ? 129.21 111.00 18.21 2.70 N 4 1 NE A ARG 108 ? ? CZ A ARG 108 ? ? NH2 A ARG 108 ? ? 123.31 120.30 3.01 0.50 N 5 2 NE A ARG 52 ? ? CZ A ARG 52 ? ? NH1 A ARG 52 ? ? 123.32 120.30 3.02 0.50 N 6 3 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH2 A ARG 36 ? ? 123.34 120.30 3.04 0.50 N 7 3 NE A ARG 52 ? ? CZ A ARG 52 ? ? NH2 A ARG 52 ? ? 117.18 120.30 -3.12 0.50 N 8 4 N A CYS 77 ? ? CA A CYS 77 ? ? C A CYS 77 ? ? 93.62 111.00 -17.38 2.70 N 9 6 NE A ARG 28 ? ? CZ A ARG 28 ? ? NH1 A ARG 28 ? ? 123.44 120.30 3.14 0.50 N 10 6 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 124.19 120.30 3.89 0.50 N 11 7 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH2 A ARG 36 ? ? 123.96 120.30 3.66 0.50 N 12 8 NE A ARG 28 ? ? CZ A ARG 28 ? ? NH2 A ARG 28 ? ? 123.38 120.30 3.08 0.50 N 13 8 N A HIS 79 ? ? CA A HIS 79 ? ? C A HIS 79 ? ? 129.82 111.00 18.82 2.70 N 14 9 CA A ASP 76 ? ? C A ASP 76 ? ? N A CYS 77 ? ? 103.87 117.20 -13.33 2.20 Y 15 9 N A CYS 77 ? ? CA A CYS 77 ? ? C A CYS 77 ? ? 94.64 111.00 -16.36 2.70 N 16 9 N A CYS 94 ? ? CA A CYS 94 ? ? C A CYS 94 ? ? 94.60 111.00 -16.40 2.70 N 17 10 NE A ARG 52 ? ? CZ A ARG 52 ? ? NH1 A ARG 52 ? ? 123.48 120.30 3.18 0.50 N 18 11 NE A ARG 52 ? ? CZ A ARG 52 ? ? NH1 A ARG 52 ? ? 124.06 120.30 3.76 0.50 N 19 11 CB A ASP 76 ? ? CG A ASP 76 ? ? OD2 A ASP 76 ? ? 123.79 118.30 5.49 0.90 N 20 11 CA A ASP 76 ? ? C A ASP 76 ? ? N A CYS 77 ? ? 103.83 117.20 -13.37 2.20 Y 21 11 N A CYS 77 ? ? CA A CYS 77 ? ? C A CYS 77 ? ? 91.95 111.00 -19.05 2.70 N 22 11 NE A ARG 108 ? ? CZ A ARG 108 ? ? NH1 A ARG 108 ? ? 123.33 120.30 3.03 0.50 N 23 12 NE A ARG 28 ? ? CZ A ARG 28 ? ? NH2 A ARG 28 ? ? 123.33 120.30 3.03 0.50 N 24 12 NE A ARG 108 ? ? CZ A ARG 108 ? ? NH1 A ARG 108 ? ? 116.82 120.30 -3.48 0.50 N 25 12 NE A ARG 108 ? ? CZ A ARG 108 ? ? NH2 A ARG 108 ? ? 124.79 120.30 4.49 0.50 N 26 13 CB A ASP 76 ? ? CG A ASP 76 ? ? OD1 A ASP 76 ? ? 123.75 118.30 5.45 0.90 N 27 14 NE A ARG 52 ? ? CZ A ARG 52 ? ? NH2 A ARG 52 ? ? 123.99 120.30 3.69 0.50 N 28 14 NE A ARG 108 ? ? CZ A ARG 108 ? ? NH1 A ARG 108 ? ? 117.22 120.30 -3.08 0.50 N 29 14 NE A ARG 108 ? ? CZ A ARG 108 ? ? NH2 A ARG 108 ? ? 123.45 120.30 3.15 0.50 N 30 15 NE A ARG 108 ? ? CZ A ARG 108 ? ? NH2 A ARG 108 ? ? 123.64 120.30 3.34 0.50 N 31 17 NE A ARG 52 ? ? CZ A ARG 52 ? ? NH2 A ARG 52 ? ? 116.99 120.30 -3.31 0.50 N 32 17 N A CYS 77 ? ? CA A CYS 77 ? ? C A CYS 77 ? ? 94.52 111.00 -16.48 2.70 N 33 18 NE A ARG 28 ? ? CZ A ARG 28 ? ? NH2 A ARG 28 ? ? 123.47 120.30 3.17 0.50 N 34 18 N A CYS 94 ? ? CA A CYS 94 ? ? C A CYS 94 ? ? 94.38 111.00 -16.62 2.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 76 ? ? -36.45 92.57 2 1 HIS A 79 ? ? -141.20 12.05 3 1 ASN A 98 ? ? 70.64 65.60 4 2 ASP A 76 ? ? -44.73 94.99 5 2 HIS A 79 ? ? -140.81 11.84 6 2 ASP A 87 ? ? -78.12 40.20 7 2 ASN A 98 ? ? 86.45 63.37 8 2 GLU A 106 ? ? -145.94 -98.08 9 3 ASP A 76 ? ? -41.69 95.07 10 3 HIS A 79 ? ? -143.24 13.90 11 3 ASP A 87 ? ? -79.54 39.82 12 3 ASN A 98 ? ? 104.87 54.77 13 3 GLU A 106 ? ? -144.48 -128.94 14 4 ALA A 38 ? ? -83.33 35.16 15 4 ASP A 76 ? ? -37.18 96.71 16 4 HIS A 79 ? ? -141.37 11.88 17 4 LEU A 86 ? ? -65.48 3.70 18 4 ASN A 98 ? ? 76.76 59.34 19 5 ALA A 38 ? ? -82.66 37.06 20 5 ASP A 76 ? ? -41.64 94.85 21 5 ASP A 87 ? ? -82.81 42.85 22 5 ASN A 98 ? ? 90.76 59.03 23 6 ASP A 76 ? ? -35.05 94.02 24 6 CYS A 77 ? ? -161.29 78.04 25 6 HIS A 79 ? ? -142.19 15.81 26 6 ASP A 87 ? ? -81.97 40.63 27 6 ASN A 98 ? ? 72.21 64.13 28 7 ALA A 38 ? ? -81.18 30.17 29 7 ASP A 76 ? ? -39.41 93.96 30 7 CYS A 77 ? ? -156.59 76.88 31 7 SER A 78 ? ? -59.09 105.60 32 7 ASN A 98 ? ? 102.20 56.19 33 7 GLU A 106 ? ? -137.50 -125.10 34 8 ASP A 76 ? ? -37.54 92.57 35 8 HIS A 79 ? ? -142.73 11.97 36 8 LEU A 86 ? ? -64.14 2.00 37 8 ASP A 87 ? ? -85.47 37.86 38 8 ASN A 98 ? ? 93.85 57.39 39 8 GLU A 106 ? ? -143.02 -115.91 40 9 ALA A 38 ? ? -81.55 31.96 41 9 ASP A 76 ? ? -36.44 91.83 42 9 HIS A 79 ? ? -142.80 13.71 43 9 LEU A 86 ? ? -69.62 7.31 44 9 ASN A 98 ? ? 92.96 57.25 45 10 ASP A 76 ? ? -40.09 93.40 46 10 CYS A 77 ? ? -161.29 78.58 47 10 ASP A 87 ? ? -78.89 22.06 48 10 ASN A 98 ? ? 114.10 42.25 49 11 ASP A 76 ? ? -38.62 98.26 50 11 HIS A 79 ? ? -140.41 12.27 51 11 LEU A 86 ? ? -69.17 9.21 52 11 ASP A 87 ? ? -79.80 21.89 53 11 ASN A 98 ? ? 92.20 57.78 54 11 GLU A 106 ? ? -126.04 -120.55 55 12 ASP A 76 ? ? -37.28 95.86 56 12 CYS A 77 ? ? -162.03 98.40 57 12 HIS A 79 ? ? -142.36 13.18 58 12 ALA A 85 ? ? -145.28 -143.11 59 12 ASN A 98 ? ? 71.43 65.39 60 13 ASP A 76 ? ? -36.63 94.30 61 13 HIS A 79 ? ? -142.07 12.59 62 13 LEU A 86 ? ? -65.73 0.71 63 13 ASN A 98 ? ? 103.83 54.26 64 14 ASP A 76 ? ? -36.16 92.79 65 14 CYS A 77 ? ? -155.71 80.38 66 14 ASN A 98 ? ? 114.47 54.91 67 15 ASP A 76 ? ? -42.46 96.70 68 15 HIS A 79 ? ? -141.89 14.03 69 15 ASP A 87 ? ? -79.42 21.06 70 15 ASN A 98 ? ? 93.32 61.28 71 15 GLU A 106 ? ? -144.04 -121.15 72 16 ASP A 76 ? ? -41.19 94.63 73 16 HIS A 79 ? ? -141.38 12.10 74 16 ASN A 98 ? ? 78.69 60.33 75 16 GLU A 106 ? ? -144.54 -106.54 76 17 ASP A 76 ? ? -50.43 93.26 77 17 CYS A 77 ? ? -150.77 51.16 78 17 HIS A 79 ? ? -142.59 13.12 79 17 LEU A 86 ? ? -69.80 4.53 80 17 ASP A 87 ? ? -82.26 36.06 81 17 ASN A 98 ? ? 76.31 81.47 82 18 ASP A 76 ? ? -37.80 95.00 83 18 HIS A 79 ? ? -142.45 15.40 84 18 ASN A 84 ? ? -144.37 35.90 85 18 LEU A 86 ? ? -69.57 2.76 86 18 ASN A 98 ? ? 88.11 79.23 87 19 ASP A 76 ? ? -40.46 98.94 88 19 ASP A 87 ? ? -79.38 22.56 89 19 ASN A 98 ? ? 68.10 81.76 90 20 ASP A 76 ? ? -36.30 94.42 91 20 HIS A 79 ? ? -142.42 12.54 92 20 ASP A 87 ? ? -82.58 43.06 93 20 ASN A 98 ? ? 100.82 56.70 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 LYS A 75 ? ? ASP A 76 ? ? -149.51 2 2 LYS A 75 ? ? ASP A 76 ? ? -148.43 3 3 LYS A 75 ? ? ASP A 76 ? ? -148.39 4 5 LYS A 75 ? ? ASP A 76 ? ? -148.20 5 6 HIS A 79 ? ? VAL A 80 ? ? -149.68 6 8 LYS A 75 ? ? ASP A 76 ? ? -148.00 7 12 LYS A 75 ? ? ASP A 76 ? ? -145.66 8 13 LYS A 75 ? ? ASP A 76 ? ? -147.13 9 14 LYS A 75 ? ? ASP A 76 ? ? -149.75 10 16 LYS A 75 ? ? ASP A 76 ? ? -149.25 11 17 HIS A 79 ? ? VAL A 80 ? ? -148.52 12 18 LYS A 75 ? ? ASP A 76 ? ? -145.26 13 20 LYS A 75 ? ? ASP A 76 ? ? -149.86 # _pdbx_nmr_ensemble.entry_id 6G81 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6G81 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM [U-13C; U-15N] HypA, 20 mM HEPES, 200 mM sodium chloride, 1 mM TCEP, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 13C15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 HypA 1 ? mM '[U-13C; U-15N]' 1 HEPES 20 ? mM 'natural abundance' 1 'sodium chloride' 200 ? mM 'natural abundance' 1 TCEP 1 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.details ;Protein samples for NMR spectroscopy were constituted by ca. 1 mM [15N/13C]-labeled apo-HpHypA in 20 mM HEPES at pH 7.2 (or pH 6.3), 200 mM NaCl, 1 mM TCEP ; _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCO' 1 isotropic 6 1 1 '3D HN(CA)CO' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 7 1 1 '3D CBCA(CO)NH' 1 isotropic 8 1 1 '3D HBHANH' 1 isotropic 4 1 1 '3D HBHA(CO)NH' 1 isotropic 5 1 1 '3D HCCH-TOCSY' 1 isotropic 9 1 1 '2D 1H-13C HSQC aromatic' 3 isotropic 10 1 1 '2D (HB)CB(CGCD)HD' 3 isotropic 11 1 1 '2D (HB)CB(CGCDCE)HE' 3 isotropic 12 1 1 '3D HBCB(CGCD)HD' 3 isotropic 13 1 1 '3D HBCB(CGCDCE)HE' 3 isotropic 14 1 1 '3D 1H-13C NOESY aromatic' 4 isotropic 15 1 1 '4D 13C(ali)-HMQC-NOESY-13C(aro)-HSQC' 3 isotropic 16 1 1 '3D 1H-15N NOESY' 3 isotropic 17 1 1 '4D 13C(ali)-HMQC-NOESY-13C(ali)-HMQC' 3 isotropic 18 1 1 '4D 13C-HMQC-NOESY-15N-HSQC' 3 isotropic # _pdbx_nmr_refine.entry_id 6G81 _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 7 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 processing 'Signal Separation Algorithm (SSA)' ? 'Stanek, Kosinski, Kozminski' 3 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 4 'chemical shift assignment' Sparky ? Goddard 5 'data analysis' TALOS+ ? 'Cornilescu, Delaglio and Bax' 6 'structure calculation' YARIA ? 'Bardiaux, Krieger, Spronk' 8 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 7 refinement YASARA ? 'YASARA Biosciences' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 ZN ZN ZN N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 900 ? 2 AVANCE ? Bruker 950 ? 3 DDR2 ? Agilent 800 ? 4 DDR2 ? Agilent 600 ? # _atom_sites.entry_id 6G81 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_