data_6G81
# 
_entry.id   6G81 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.394 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6G81         pdb_00006g81 10.2210/pdb6g81/pdb 
WWPDB D_1200009528 ?            ?                   
BMRB  34257        ?            10.13018/BMR34257   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-10-10 
2 'Structure model' 1 1 2018-12-05 
3 'Structure model' 1 2 2019-05-08 
4 'Structure model' 1 3 2023-06-14 
5 'Structure model' 1 4 2024-06-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
3 3 'Structure model' 'Data collection'     
4 4 'Structure model' 'Data collection'     
5 4 'Structure model' 'Database references' 
6 4 'Structure model' Other                 
7 5 'Structure model' 'Data collection'     
8 5 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' citation              
2  2 'Structure model' citation_author       
3  2 'Structure model' pdbx_database_proc    
4  3 'Structure model' pdbx_nmr_software     
5  4 'Structure model' database_2            
6  4 'Structure model' pdbx_database_status  
7  4 'Structure model' pdbx_nmr_spectrometer 
8  5 'Structure model' chem_comp_atom        
9  5 'Structure model' chem_comp_bond        
10 5 'Structure model' database_2            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.journal_volume'                   
2  2 'Structure model' '_citation.page_first'                       
3  2 'Structure model' '_citation.page_last'                        
4  2 'Structure model' '_citation_author.identifier_ORCID'          
5  3 'Structure model' '_pdbx_nmr_software.name'                    
6  4 'Structure model' '_database_2.pdbx_DOI'                       
7  4 'Structure model' '_database_2.pdbx_database_accession'        
8  4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 
9  4 'Structure model' '_pdbx_nmr_spectrometer.model'               
10 5 'Structure model' '_database_2.pdbx_DOI'                       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        6G81 
_pdbx_database_status.recvd_initial_deposition_date   2018-04-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            REL 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'Solution structure of the Ni metallochaperone HypA from Helicobacter pylori' 
_pdbx_database_related.db_id          34257 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Spronk, C.A.E.M.' 1  ? 
'Zerko, S.'        2  ? 
'Gorka, M.'        3  ? 
'Kozminski, W.'    4  ? 
'Bardiaux, B.'     5  ? 
'Zambelli, B.'     6  ? 
'Musiani, F.'      7  ? 
'Piccioli, M.'     8  ? 
'Hu, H.'           9  ? 
'Maroney, M.'      10 ? 
'Ciurli, S.'       11 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   GW 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Biol. Inorg. Chem.' 
_citation.journal_id_ASTM           JJBCFA 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1432-1327 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            23 
_citation.language                  ? 
_citation.page_first                1309 
_citation.page_last                 1330 
_citation.title                     
;Structure and dynamics of Helicobacter pylori nickel-chaperone HypA: an integrated approach using NMR spectroscopy, functional assays and computational tools.
;
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1007/s00775-018-1616-y 
_citation.pdbx_database_id_PubMed   30264175 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Spronk, C.A.E.M.' 1  ? 
primary 'Zerko, S.'        2  ? 
primary 'Gorka, M.'        3  ? 
primary 'Kozminski, W.'    4  ? 
primary 'Bardiaux, B.'     5  ? 
primary 'Zambelli, B.'     6  ? 
primary 'Musiani, F.'      7  ? 
primary 'Piccioli, M.'     8  ? 
primary 'Basak, P.'        9  ? 
primary 'Blum, F.C.'       10 ? 
primary 'Johnson, R.C.'    11 ? 
primary 'Hu, H.'           12 ? 
primary 'Merrell, D.S.'    13 ? 
primary 'Maroney, M.'      14 ? 
primary 'Ciurli, S.'       15 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Hydrogenase maturation factor HypA' 13221.247 1 ? ? ? ? 
2 non-polymer syn 'ZINC ION'                           65.409    1 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHEYSVVSSLIALCEEHAKKNQAHKIERVVVGIGERSAMDKSLFVSAFETFREESLVCKDAILDIVDEKVELECKDCSHV
FKPNALDYGVCEKCHSKNVIITQGNEMRLLSLEMLAE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHEYSVVSSLIALCEEHAKKNQAHKIERVVVGIGERSAMDKSLFVSAFETFREESLVCKDAILDIVDEKVELECKDCSHV
FKPNALDYGVCEKCHSKNVIITQGNEMRLLSLEMLAE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   GLU n 
1 4   TYR n 
1 5   SER n 
1 6   VAL n 
1 7   VAL n 
1 8   SER n 
1 9   SER n 
1 10  LEU n 
1 11  ILE n 
1 12  ALA n 
1 13  LEU n 
1 14  CYS n 
1 15  GLU n 
1 16  GLU n 
1 17  HIS n 
1 18  ALA n 
1 19  LYS n 
1 20  LYS n 
1 21  ASN n 
1 22  GLN n 
1 23  ALA n 
1 24  HIS n 
1 25  LYS n 
1 26  ILE n 
1 27  GLU n 
1 28  ARG n 
1 29  VAL n 
1 30  VAL n 
1 31  VAL n 
1 32  GLY n 
1 33  ILE n 
1 34  GLY n 
1 35  GLU n 
1 36  ARG n 
1 37  SER n 
1 38  ALA n 
1 39  MET n 
1 40  ASP n 
1 41  LYS n 
1 42  SER n 
1 43  LEU n 
1 44  PHE n 
1 45  VAL n 
1 46  SER n 
1 47  ALA n 
1 48  PHE n 
1 49  GLU n 
1 50  THR n 
1 51  PHE n 
1 52  ARG n 
1 53  GLU n 
1 54  GLU n 
1 55  SER n 
1 56  LEU n 
1 57  VAL n 
1 58  CYS n 
1 59  LYS n 
1 60  ASP n 
1 61  ALA n 
1 62  ILE n 
1 63  LEU n 
1 64  ASP n 
1 65  ILE n 
1 66  VAL n 
1 67  ASP n 
1 68  GLU n 
1 69  LYS n 
1 70  VAL n 
1 71  GLU n 
1 72  LEU n 
1 73  GLU n 
1 74  CYS n 
1 75  LYS n 
1 76  ASP n 
1 77  CYS n 
1 78  SER n 
1 79  HIS n 
1 80  VAL n 
1 81  PHE n 
1 82  LYS n 
1 83  PRO n 
1 84  ASN n 
1 85  ALA n 
1 86  LEU n 
1 87  ASP n 
1 88  TYR n 
1 89  GLY n 
1 90  VAL n 
1 91  CYS n 
1 92  GLU n 
1 93  LYS n 
1 94  CYS n 
1 95  HIS n 
1 96  SER n 
1 97  LYS n 
1 98  ASN n 
1 99  VAL n 
1 100 ILE n 
1 101 ILE n 
1 102 THR n 
1 103 GLN n 
1 104 GLY n 
1 105 ASN n 
1 106 GLU n 
1 107 MET n 
1 108 ARG n 
1 109 LEU n 
1 110 LEU n 
1 111 SER n 
1 112 LEU n 
1 113 GLU n 
1 114 MET n 
1 115 LEU n 
1 116 ALA n 
1 117 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   117 
_entity_src_gen.gene_src_common_name               'Campylobacter pylori J99' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'hypA, jhp_0803' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'J99 / ATCC 700824' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Helicobacter pylori J99' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     85963 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   HIS 2   2   2   HIS HIS A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   TYR 4   4   4   TYR TYR A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  CYS 14  14  14  CYS CYS A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  ASN 21  21  21  ASN ASN A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  HIS 24  24  24  HIS HIS A . n 
A 1 25  LYS 25  25  25  LYS LYS A . n 
A 1 26  ILE 26  26  26  ILE ILE A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  SER 37  37  37  SER SER A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  MET 39  39  39  MET MET A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  SER 42  42  42  SER SER A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  PHE 48  48  48  PHE PHE A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  PHE 51  51  51  PHE PHE A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  CYS 58  58  58  CYS CYS A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  GLU 68  68  68  GLU GLU A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  CYS 74  74  74  CYS CYS A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  CYS 77  77  77  CYS CYS A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  HIS 79  79  79  HIS HIS A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  PRO 83  83  83  PRO PRO A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  CYS 91  91  91  CYS CYS A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  HIS 95  95  95  HIS HIS A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 GLN 103 103 103 GLN GLN A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 MET 107 107 107 MET MET A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 GLU 113 113 113 GLU GLU A . n 
A 1 114 MET 114 114 114 MET MET A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          ZN 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     201 
_pdbx_nonpoly_scheme.auth_seq_num    118 
_pdbx_nonpoly_scheme.pdb_mon_id      ZN 
_pdbx_nonpoly_scheme.auth_mon_id     ZN 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6G81 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6G81 
_struct.title                        'Solution structure of the Ni metallochaperone HypA from Helicobacter pylori' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6G81 
_struct_keywords.text            'metallochaperone metal-binding Nickel hydrogenase, METAL BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HYPA_HELPJ 
_struct_ref.pdbx_db_accession          P0A0U5 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MHEYSVVSSLIALCEEHAKKNQAHKIERVVVGIGERSAMDKSLFVSAFETFREESLVCKDAILDIVDEKVELECKDCSHV
FKPNALDYGVCEKCHSKNVIITQGNEMRLLSLEMLAE
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6G81 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 117 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P0A0U5 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  117 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       117 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0    ? 
1 MORE         0    ? 
1 'SSA (A^2)'  7280 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 HIS A 2  ? ASN A 21 ? HIS A 2  ASN A 21 1 ? 20 
HELX_P HELX_P2 AA2 ASP A 40 ? GLU A 53 ? ASP A 40 GLU A 53 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 74 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 74 A ZN 201 1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc2 metalc ? ? A CYS 77 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 77 A ZN 201 1_555 ? ? ? ? ? ? ? 2.350 ? ? 
metalc3 metalc ? ? A CYS 91 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 91 A ZN 201 1_555 ? ? ? ? ? ? ? 2.340 ? ? 
metalc4 metalc ? ? A CYS 94 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 94 A ZN 201 1_555 ? ? ? ? ? ? ? 2.365 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? A CYS 74 ? A CYS 74 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 77 ? A CYS 77 ? 1_555 109.3 ? 
2 SG ? A CYS 74 ? A CYS 74 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 91 ? A CYS 91 ? 1_555 110.3 ? 
3 SG ? A CYS 77 ? A CYS 77 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 91 ? A CYS 91 ? 1_555 110.0 ? 
4 SG ? A CYS 74 ? A CYS 74 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 94 ? A CYS 94 ? 1_555 110.2 ? 
5 SG ? A CYS 77 ? A CYS 77 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 94 ? A CYS 94 ? 1_555 108.3 ? 
6 SG ? A CYS 91 ? A CYS 91 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 94 ? A CYS 94 ? 1_555 108.7 ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 62  ? GLU A 68  ? ILE A 62  GLU A 68  
AA1 2 ALA A 23  ? GLY A 34  ? ALA A 23  GLY A 34  
AA1 3 ARG A 108 ? ALA A 116 ? ARG A 108 ALA A 116 
AA2 1 GLU A 71  ? CYS A 74  ? GLU A 71  CYS A 74  
AA2 2 VAL A 99  ? GLN A 103 ? VAL A 99  GLN A 103 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ILE A 62 ? O ILE A 62 N VAL A 29  ? N VAL A 29  
AA1 2 3 N LYS A 25 ? N LYS A 25 O LEU A 115 ? O LEU A 115 
AA2 1 2 N GLU A 73 ? N GLU A 73 O ILE A 100 ? O ILE A 100 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    ZN 
_struct_site.pdbx_auth_seq_id     201 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'binding site for residue ZN A 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 74 ? CYS A 74 . ? 1_555 ? 
2 AC1 4 CYS A 77 ? CYS A 77 . ? 1_555 ? 
3 AC1 4 CYS A 91 ? CYS A 91 . ? 1_555 ? 
4 AC1 4 CYS A 94 ? CYS A 94 . ? 1_555 ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1  NE A ARG 36  ? ? CZ A ARG 36  ? ? NH2 A ARG 36  ? ? 123.68 120.30 3.38   0.50 N 
2  1  NE A ARG 52  ? ? CZ A ARG 52  ? ? NH2 A ARG 52  ? ? 117.05 120.30 -3.25  0.50 N 
3  1  N  A HIS 79  ? ? CA A HIS 79  ? ? C   A HIS 79  ? ? 129.21 111.00 18.21  2.70 N 
4  1  NE A ARG 108 ? ? CZ A ARG 108 ? ? NH2 A ARG 108 ? ? 123.31 120.30 3.01   0.50 N 
5  2  NE A ARG 52  ? ? CZ A ARG 52  ? ? NH1 A ARG 52  ? ? 123.32 120.30 3.02   0.50 N 
6  3  NE A ARG 36  ? ? CZ A ARG 36  ? ? NH2 A ARG 36  ? ? 123.34 120.30 3.04   0.50 N 
7  3  NE A ARG 52  ? ? CZ A ARG 52  ? ? NH2 A ARG 52  ? ? 117.18 120.30 -3.12  0.50 N 
8  4  N  A CYS 77  ? ? CA A CYS 77  ? ? C   A CYS 77  ? ? 93.62  111.00 -17.38 2.70 N 
9  6  NE A ARG 28  ? ? CZ A ARG 28  ? ? NH1 A ARG 28  ? ? 123.44 120.30 3.14   0.50 N 
10 6  NE A ARG 36  ? ? CZ A ARG 36  ? ? NH1 A ARG 36  ? ? 124.19 120.30 3.89   0.50 N 
11 7  NE A ARG 36  ? ? CZ A ARG 36  ? ? NH2 A ARG 36  ? ? 123.96 120.30 3.66   0.50 N 
12 8  NE A ARG 28  ? ? CZ A ARG 28  ? ? NH2 A ARG 28  ? ? 123.38 120.30 3.08   0.50 N 
13 8  N  A HIS 79  ? ? CA A HIS 79  ? ? C   A HIS 79  ? ? 129.82 111.00 18.82  2.70 N 
14 9  CA A ASP 76  ? ? C  A ASP 76  ? ? N   A CYS 77  ? ? 103.87 117.20 -13.33 2.20 Y 
15 9  N  A CYS 77  ? ? CA A CYS 77  ? ? C   A CYS 77  ? ? 94.64  111.00 -16.36 2.70 N 
16 9  N  A CYS 94  ? ? CA A CYS 94  ? ? C   A CYS 94  ? ? 94.60  111.00 -16.40 2.70 N 
17 10 NE A ARG 52  ? ? CZ A ARG 52  ? ? NH1 A ARG 52  ? ? 123.48 120.30 3.18   0.50 N 
18 11 NE A ARG 52  ? ? CZ A ARG 52  ? ? NH1 A ARG 52  ? ? 124.06 120.30 3.76   0.50 N 
19 11 CB A ASP 76  ? ? CG A ASP 76  ? ? OD2 A ASP 76  ? ? 123.79 118.30 5.49   0.90 N 
20 11 CA A ASP 76  ? ? C  A ASP 76  ? ? N   A CYS 77  ? ? 103.83 117.20 -13.37 2.20 Y 
21 11 N  A CYS 77  ? ? CA A CYS 77  ? ? C   A CYS 77  ? ? 91.95  111.00 -19.05 2.70 N 
22 11 NE A ARG 108 ? ? CZ A ARG 108 ? ? NH1 A ARG 108 ? ? 123.33 120.30 3.03   0.50 N 
23 12 NE A ARG 28  ? ? CZ A ARG 28  ? ? NH2 A ARG 28  ? ? 123.33 120.30 3.03   0.50 N 
24 12 NE A ARG 108 ? ? CZ A ARG 108 ? ? NH1 A ARG 108 ? ? 116.82 120.30 -3.48  0.50 N 
25 12 NE A ARG 108 ? ? CZ A ARG 108 ? ? NH2 A ARG 108 ? ? 124.79 120.30 4.49   0.50 N 
26 13 CB A ASP 76  ? ? CG A ASP 76  ? ? OD1 A ASP 76  ? ? 123.75 118.30 5.45   0.90 N 
27 14 NE A ARG 52  ? ? CZ A ARG 52  ? ? NH2 A ARG 52  ? ? 123.99 120.30 3.69   0.50 N 
28 14 NE A ARG 108 ? ? CZ A ARG 108 ? ? NH1 A ARG 108 ? ? 117.22 120.30 -3.08  0.50 N 
29 14 NE A ARG 108 ? ? CZ A ARG 108 ? ? NH2 A ARG 108 ? ? 123.45 120.30 3.15   0.50 N 
30 15 NE A ARG 108 ? ? CZ A ARG 108 ? ? NH2 A ARG 108 ? ? 123.64 120.30 3.34   0.50 N 
31 17 NE A ARG 52  ? ? CZ A ARG 52  ? ? NH2 A ARG 52  ? ? 116.99 120.30 -3.31  0.50 N 
32 17 N  A CYS 77  ? ? CA A CYS 77  ? ? C   A CYS 77  ? ? 94.52  111.00 -16.48 2.70 N 
33 18 NE A ARG 28  ? ? CZ A ARG 28  ? ? NH2 A ARG 28  ? ? 123.47 120.30 3.17   0.50 N 
34 18 N  A CYS 94  ? ? CA A CYS 94  ? ? C   A CYS 94  ? ? 94.38  111.00 -16.62 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  ASP A 76  ? ? -36.45  92.57   
2  1  HIS A 79  ? ? -141.20 12.05   
3  1  ASN A 98  ? ? 70.64   65.60   
4  2  ASP A 76  ? ? -44.73  94.99   
5  2  HIS A 79  ? ? -140.81 11.84   
6  2  ASP A 87  ? ? -78.12  40.20   
7  2  ASN A 98  ? ? 86.45   63.37   
8  2  GLU A 106 ? ? -145.94 -98.08  
9  3  ASP A 76  ? ? -41.69  95.07   
10 3  HIS A 79  ? ? -143.24 13.90   
11 3  ASP A 87  ? ? -79.54  39.82   
12 3  ASN A 98  ? ? 104.87  54.77   
13 3  GLU A 106 ? ? -144.48 -128.94 
14 4  ALA A 38  ? ? -83.33  35.16   
15 4  ASP A 76  ? ? -37.18  96.71   
16 4  HIS A 79  ? ? -141.37 11.88   
17 4  LEU A 86  ? ? -65.48  3.70    
18 4  ASN A 98  ? ? 76.76   59.34   
19 5  ALA A 38  ? ? -82.66  37.06   
20 5  ASP A 76  ? ? -41.64  94.85   
21 5  ASP A 87  ? ? -82.81  42.85   
22 5  ASN A 98  ? ? 90.76   59.03   
23 6  ASP A 76  ? ? -35.05  94.02   
24 6  CYS A 77  ? ? -161.29 78.04   
25 6  HIS A 79  ? ? -142.19 15.81   
26 6  ASP A 87  ? ? -81.97  40.63   
27 6  ASN A 98  ? ? 72.21   64.13   
28 7  ALA A 38  ? ? -81.18  30.17   
29 7  ASP A 76  ? ? -39.41  93.96   
30 7  CYS A 77  ? ? -156.59 76.88   
31 7  SER A 78  ? ? -59.09  105.60  
32 7  ASN A 98  ? ? 102.20  56.19   
33 7  GLU A 106 ? ? -137.50 -125.10 
34 8  ASP A 76  ? ? -37.54  92.57   
35 8  HIS A 79  ? ? -142.73 11.97   
36 8  LEU A 86  ? ? -64.14  2.00    
37 8  ASP A 87  ? ? -85.47  37.86   
38 8  ASN A 98  ? ? 93.85   57.39   
39 8  GLU A 106 ? ? -143.02 -115.91 
40 9  ALA A 38  ? ? -81.55  31.96   
41 9  ASP A 76  ? ? -36.44  91.83   
42 9  HIS A 79  ? ? -142.80 13.71   
43 9  LEU A 86  ? ? -69.62  7.31    
44 9  ASN A 98  ? ? 92.96   57.25   
45 10 ASP A 76  ? ? -40.09  93.40   
46 10 CYS A 77  ? ? -161.29 78.58   
47 10 ASP A 87  ? ? -78.89  22.06   
48 10 ASN A 98  ? ? 114.10  42.25   
49 11 ASP A 76  ? ? -38.62  98.26   
50 11 HIS A 79  ? ? -140.41 12.27   
51 11 LEU A 86  ? ? -69.17  9.21    
52 11 ASP A 87  ? ? -79.80  21.89   
53 11 ASN A 98  ? ? 92.20   57.78   
54 11 GLU A 106 ? ? -126.04 -120.55 
55 12 ASP A 76  ? ? -37.28  95.86   
56 12 CYS A 77  ? ? -162.03 98.40   
57 12 HIS A 79  ? ? -142.36 13.18   
58 12 ALA A 85  ? ? -145.28 -143.11 
59 12 ASN A 98  ? ? 71.43   65.39   
60 13 ASP A 76  ? ? -36.63  94.30   
61 13 HIS A 79  ? ? -142.07 12.59   
62 13 LEU A 86  ? ? -65.73  0.71    
63 13 ASN A 98  ? ? 103.83  54.26   
64 14 ASP A 76  ? ? -36.16  92.79   
65 14 CYS A 77  ? ? -155.71 80.38   
66 14 ASN A 98  ? ? 114.47  54.91   
67 15 ASP A 76  ? ? -42.46  96.70   
68 15 HIS A 79  ? ? -141.89 14.03   
69 15 ASP A 87  ? ? -79.42  21.06   
70 15 ASN A 98  ? ? 93.32   61.28   
71 15 GLU A 106 ? ? -144.04 -121.15 
72 16 ASP A 76  ? ? -41.19  94.63   
73 16 HIS A 79  ? ? -141.38 12.10   
74 16 ASN A 98  ? ? 78.69   60.33   
75 16 GLU A 106 ? ? -144.54 -106.54 
76 17 ASP A 76  ? ? -50.43  93.26   
77 17 CYS A 77  ? ? -150.77 51.16   
78 17 HIS A 79  ? ? -142.59 13.12   
79 17 LEU A 86  ? ? -69.80  4.53    
80 17 ASP A 87  ? ? -82.26  36.06   
81 17 ASN A 98  ? ? 76.31   81.47   
82 18 ASP A 76  ? ? -37.80  95.00   
83 18 HIS A 79  ? ? -142.45 15.40   
84 18 ASN A 84  ? ? -144.37 35.90   
85 18 LEU A 86  ? ? -69.57  2.76    
86 18 ASN A 98  ? ? 88.11   79.23   
87 19 ASP A 76  ? ? -40.46  98.94   
88 19 ASP A 87  ? ? -79.38  22.56   
89 19 ASN A 98  ? ? 68.10   81.76   
90 20 ASP A 76  ? ? -36.30  94.42   
91 20 HIS A 79  ? ? -142.42 12.54   
92 20 ASP A 87  ? ? -82.58  43.06   
93 20 ASN A 98  ? ? 100.82  56.70   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1  1  LYS A 75 ? ? ASP A 76 ? ? -149.51 
2  2  LYS A 75 ? ? ASP A 76 ? ? -148.43 
3  3  LYS A 75 ? ? ASP A 76 ? ? -148.39 
4  5  LYS A 75 ? ? ASP A 76 ? ? -148.20 
5  6  HIS A 79 ? ? VAL A 80 ? ? -149.68 
6  8  LYS A 75 ? ? ASP A 76 ? ? -148.00 
7  12 LYS A 75 ? ? ASP A 76 ? ? -145.66 
8  13 LYS A 75 ? ? ASP A 76 ? ? -147.13 
9  14 LYS A 75 ? ? ASP A 76 ? ? -149.75 
10 16 LYS A 75 ? ? ASP A 76 ? ? -149.25 
11 17 HIS A 79 ? ? VAL A 80 ? ? -148.52 
12 18 LYS A 75 ? ? ASP A 76 ? ? -145.26 
13 20 LYS A 75 ? ? ASP A 76 ? ? -149.86 
# 
_pdbx_nmr_ensemble.entry_id                                      6G81 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             6G81 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1 mM [U-13C; U-15N] HypA, 20 mM HEPES, 200 mM sodium chloride, 1 mM TCEP, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
_pdbx_nmr_sample_details.label            13C15N_sample 
_pdbx_nmr_sample_details.type             solution 
_pdbx_nmr_sample_details.details          ? 
# 
loop_
_pdbx_nmr_exptl_sample.solution_id 
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
1 HypA              1   ? mM '[U-13C; U-15N]'    
1 HEPES             20  ? mM 'natural abundance' 
1 'sodium chloride' 200 ? mM 'natural abundance' 
1 TCEP              1   ? mM 'natural abundance' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     7.2 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         0.2 
_pdbx_nmr_exptl_sample_conditions.details                
;Protein samples for NMR spectroscopy were constituted by ca. 1 mM [15N/13C]-labeled apo-HpHypA in 20 mM HEPES at pH 7.2 (or pH 6.3), 200 mM NaCl, 1 mM TCEP
;
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   'Not defined' 
_pdbx_nmr_exptl_sample_conditions.label                  condition_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1  1 1 '2D 1H-15N HSQC'                       1 isotropic 
2  1 1 '3D HNCO'                              1 isotropic 
6  1 1 '3D HN(CA)CO'                          1 isotropic 
3  1 1 '3D HNCACB'                            1 isotropic 
7  1 1 '3D CBCA(CO)NH'                        1 isotropic 
8  1 1 '3D HBHANH'                            1 isotropic 
4  1 1 '3D HBHA(CO)NH'                        1 isotropic 
5  1 1 '3D HCCH-TOCSY'                        1 isotropic 
9  1 1 '2D 1H-13C HSQC aromatic'              3 isotropic 
10 1 1 '2D (HB)CB(CGCD)HD'                    3 isotropic 
11 1 1 '2D (HB)CB(CGCDCE)HE'                  3 isotropic 
12 1 1 '3D HBCB(CGCD)HD'                      3 isotropic 
13 1 1 '3D HBCB(CGCDCE)HE'                    3 isotropic 
14 1 1 '3D 1H-13C NOESY aromatic'             4 isotropic 
15 1 1 '4D 13C(ali)-HMQC-NOESY-13C(aro)-HSQC' 3 isotropic 
16 1 1 '3D 1H-15N NOESY'                      3 isotropic 
17 1 1 '4D 13C(ali)-HMQC-NOESY-13C(ali)-HMQC' 3 isotropic 
18 1 1 '4D 13C-HMQC-NOESY-15N-HSQC'           3 isotropic 
# 
_pdbx_nmr_refine.entry_id           6G81 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   7 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 processing                  NMRPipe                             ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 
2 processing                  'Signal Separation Algorithm (SSA)' ? 'Stanek, Kosinski, Kozminski'                       
3 'chemical shift assignment' CARA                                ? 'Keller and Wuthrich'                               
4 'chemical shift assignment' Sparky                              ? Goddard                                             
5 'data analysis'             TALOS+                              ? 'Cornilescu, Delaglio and Bax'                      
6 'structure calculation'     YARIA                               ? 'Bardiaux, Krieger, Spronk'                         
8 'structure calculation'     ARIA                                ? 
;Linge, O'Donoghue and Nilges
;
7 refinement                  YASARA                              ? 'YASARA Biosciences'                                
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
GLN N    N  N N 88  
GLN CA   C  N S 89  
GLN C    C  N N 90  
GLN O    O  N N 91  
GLN CB   C  N N 92  
GLN CG   C  N N 93  
GLN CD   C  N N 94  
GLN OE1  O  N N 95  
GLN NE2  N  N N 96  
GLN OXT  O  N N 97  
GLN H    H  N N 98  
GLN H2   H  N N 99  
GLN HA   H  N N 100 
GLN HB2  H  N N 101 
GLN HB3  H  N N 102 
GLN HG2  H  N N 103 
GLN HG3  H  N N 104 
GLN HE21 H  N N 105 
GLN HE22 H  N N 106 
GLN HXT  H  N N 107 
GLU N    N  N N 108 
GLU CA   C  N S 109 
GLU C    C  N N 110 
GLU O    O  N N 111 
GLU CB   C  N N 112 
GLU CG   C  N N 113 
GLU CD   C  N N 114 
GLU OE1  O  N N 115 
GLU OE2  O  N N 116 
GLU OXT  O  N N 117 
GLU H    H  N N 118 
GLU H2   H  N N 119 
GLU HA   H  N N 120 
GLU HB2  H  N N 121 
GLU HB3  H  N N 122 
GLU HG2  H  N N 123 
GLU HG3  H  N N 124 
GLU HE2  H  N N 125 
GLU HXT  H  N N 126 
GLY N    N  N N 127 
GLY CA   C  N N 128 
GLY C    C  N N 129 
GLY O    O  N N 130 
GLY OXT  O  N N 131 
GLY H    H  N N 132 
GLY H2   H  N N 133 
GLY HA2  H  N N 134 
GLY HA3  H  N N 135 
GLY HXT  H  N N 136 
HIS N    N  N N 137 
HIS CA   C  N S 138 
HIS C    C  N N 139 
HIS O    O  N N 140 
HIS CB   C  N N 141 
HIS CG   C  Y N 142 
HIS ND1  N  Y N 143 
HIS CD2  C  Y N 144 
HIS CE1  C  Y N 145 
HIS NE2  N  Y N 146 
HIS OXT  O  N N 147 
HIS H    H  N N 148 
HIS H2   H  N N 149 
HIS HA   H  N N 150 
HIS HB2  H  N N 151 
HIS HB3  H  N N 152 
HIS HD1  H  N N 153 
HIS HD2  H  N N 154 
HIS HE1  H  N N 155 
HIS HE2  H  N N 156 
HIS HXT  H  N N 157 
ILE N    N  N N 158 
ILE CA   C  N S 159 
ILE C    C  N N 160 
ILE O    O  N N 161 
ILE CB   C  N S 162 
ILE CG1  C  N N 163 
ILE CG2  C  N N 164 
ILE CD1  C  N N 165 
ILE OXT  O  N N 166 
ILE H    H  N N 167 
ILE H2   H  N N 168 
ILE HA   H  N N 169 
ILE HB   H  N N 170 
ILE HG12 H  N N 171 
ILE HG13 H  N N 172 
ILE HG21 H  N N 173 
ILE HG22 H  N N 174 
ILE HG23 H  N N 175 
ILE HD11 H  N N 176 
ILE HD12 H  N N 177 
ILE HD13 H  N N 178 
ILE HXT  H  N N 179 
LEU N    N  N N 180 
LEU CA   C  N S 181 
LEU C    C  N N 182 
LEU O    O  N N 183 
LEU CB   C  N N 184 
LEU CG   C  N N 185 
LEU CD1  C  N N 186 
LEU CD2  C  N N 187 
LEU OXT  O  N N 188 
LEU H    H  N N 189 
LEU H2   H  N N 190 
LEU HA   H  N N 191 
LEU HB2  H  N N 192 
LEU HB3  H  N N 193 
LEU HG   H  N N 194 
LEU HD11 H  N N 195 
LEU HD12 H  N N 196 
LEU HD13 H  N N 197 
LEU HD21 H  N N 198 
LEU HD22 H  N N 199 
LEU HD23 H  N N 200 
LEU HXT  H  N N 201 
LYS N    N  N N 202 
LYS CA   C  N S 203 
LYS C    C  N N 204 
LYS O    O  N N 205 
LYS CB   C  N N 206 
LYS CG   C  N N 207 
LYS CD   C  N N 208 
LYS CE   C  N N 209 
LYS NZ   N  N N 210 
LYS OXT  O  N N 211 
LYS H    H  N N 212 
LYS H2   H  N N 213 
LYS HA   H  N N 214 
LYS HB2  H  N N 215 
LYS HB3  H  N N 216 
LYS HG2  H  N N 217 
LYS HG3  H  N N 218 
LYS HD2  H  N N 219 
LYS HD3  H  N N 220 
LYS HE2  H  N N 221 
LYS HE3  H  N N 222 
LYS HZ1  H  N N 223 
LYS HZ2  H  N N 224 
LYS HZ3  H  N N 225 
LYS HXT  H  N N 226 
MET N    N  N N 227 
MET CA   C  N S 228 
MET C    C  N N 229 
MET O    O  N N 230 
MET CB   C  N N 231 
MET CG   C  N N 232 
MET SD   S  N N 233 
MET CE   C  N N 234 
MET OXT  O  N N 235 
MET H    H  N N 236 
MET H2   H  N N 237 
MET HA   H  N N 238 
MET HB2  H  N N 239 
MET HB3  H  N N 240 
MET HG2  H  N N 241 
MET HG3  H  N N 242 
MET HE1  H  N N 243 
MET HE2  H  N N 244 
MET HE3  H  N N 245 
MET HXT  H  N N 246 
PHE N    N  N N 247 
PHE CA   C  N S 248 
PHE C    C  N N 249 
PHE O    O  N N 250 
PHE CB   C  N N 251 
PHE CG   C  Y N 252 
PHE CD1  C  Y N 253 
PHE CD2  C  Y N 254 
PHE CE1  C  Y N 255 
PHE CE2  C  Y N 256 
PHE CZ   C  Y N 257 
PHE OXT  O  N N 258 
PHE H    H  N N 259 
PHE H2   H  N N 260 
PHE HA   H  N N 261 
PHE HB2  H  N N 262 
PHE HB3  H  N N 263 
PHE HD1  H  N N 264 
PHE HD2  H  N N 265 
PHE HE1  H  N N 266 
PHE HE2  H  N N 267 
PHE HZ   H  N N 268 
PHE HXT  H  N N 269 
PRO N    N  N N 270 
PRO CA   C  N S 271 
PRO C    C  N N 272 
PRO O    O  N N 273 
PRO CB   C  N N 274 
PRO CG   C  N N 275 
PRO CD   C  N N 276 
PRO OXT  O  N N 277 
PRO H    H  N N 278 
PRO HA   H  N N 279 
PRO HB2  H  N N 280 
PRO HB3  H  N N 281 
PRO HG2  H  N N 282 
PRO HG3  H  N N 283 
PRO HD2  H  N N 284 
PRO HD3  H  N N 285 
PRO HXT  H  N N 286 
SER N    N  N N 287 
SER CA   C  N S 288 
SER C    C  N N 289 
SER O    O  N N 290 
SER CB   C  N N 291 
SER OG   O  N N 292 
SER OXT  O  N N 293 
SER H    H  N N 294 
SER H2   H  N N 295 
SER HA   H  N N 296 
SER HB2  H  N N 297 
SER HB3  H  N N 298 
SER HG   H  N N 299 
SER HXT  H  N N 300 
THR N    N  N N 301 
THR CA   C  N S 302 
THR C    C  N N 303 
THR O    O  N N 304 
THR CB   C  N R 305 
THR OG1  O  N N 306 
THR CG2  C  N N 307 
THR OXT  O  N N 308 
THR H    H  N N 309 
THR H2   H  N N 310 
THR HA   H  N N 311 
THR HB   H  N N 312 
THR HG1  H  N N 313 
THR HG21 H  N N 314 
THR HG22 H  N N 315 
THR HG23 H  N N 316 
THR HXT  H  N N 317 
TYR N    N  N N 318 
TYR CA   C  N S 319 
TYR C    C  N N 320 
TYR O    O  N N 321 
TYR CB   C  N N 322 
TYR CG   C  Y N 323 
TYR CD1  C  Y N 324 
TYR CD2  C  Y N 325 
TYR CE1  C  Y N 326 
TYR CE2  C  Y N 327 
TYR CZ   C  Y N 328 
TYR OH   O  N N 329 
TYR OXT  O  N N 330 
TYR H    H  N N 331 
TYR H2   H  N N 332 
TYR HA   H  N N 333 
TYR HB2  H  N N 334 
TYR HB3  H  N N 335 
TYR HD1  H  N N 336 
TYR HD2  H  N N 337 
TYR HE1  H  N N 338 
TYR HE2  H  N N 339 
TYR HH   H  N N 340 
TYR HXT  H  N N 341 
VAL N    N  N N 342 
VAL CA   C  N S 343 
VAL C    C  N N 344 
VAL O    O  N N 345 
VAL CB   C  N N 346 
VAL CG1  C  N N 347 
VAL CG2  C  N N 348 
VAL OXT  O  N N 349 
VAL H    H  N N 350 
VAL H2   H  N N 351 
VAL HA   H  N N 352 
VAL HB   H  N N 353 
VAL HG11 H  N N 354 
VAL HG12 H  N N 355 
VAL HG13 H  N N 356 
VAL HG21 H  N N 357 
VAL HG22 H  N N 358 
VAL HG23 H  N N 359 
VAL HXT  H  N N 360 
ZN  ZN   ZN N N 361 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
SER N   CA   sing N N 275 
SER N   H    sing N N 276 
SER N   H2   sing N N 277 
SER CA  C    sing N N 278 
SER CA  CB   sing N N 279 
SER CA  HA   sing N N 280 
SER C   O    doub N N 281 
SER C   OXT  sing N N 282 
SER CB  OG   sing N N 283 
SER CB  HB2  sing N N 284 
SER CB  HB3  sing N N 285 
SER OG  HG   sing N N 286 
SER OXT HXT  sing N N 287 
THR N   CA   sing N N 288 
THR N   H    sing N N 289 
THR N   H2   sing N N 290 
THR CA  C    sing N N 291 
THR CA  CB   sing N N 292 
THR CA  HA   sing N N 293 
THR C   O    doub N N 294 
THR C   OXT  sing N N 295 
THR CB  OG1  sing N N 296 
THR CB  CG2  sing N N 297 
THR CB  HB   sing N N 298 
THR OG1 HG1  sing N N 299 
THR CG2 HG21 sing N N 300 
THR CG2 HG22 sing N N 301 
THR CG2 HG23 sing N N 302 
THR OXT HXT  sing N N 303 
TYR N   CA   sing N N 304 
TYR N   H    sing N N 305 
TYR N   H2   sing N N 306 
TYR CA  C    sing N N 307 
TYR CA  CB   sing N N 308 
TYR CA  HA   sing N N 309 
TYR C   O    doub N N 310 
TYR C   OXT  sing N N 311 
TYR CB  CG   sing N N 312 
TYR CB  HB2  sing N N 313 
TYR CB  HB3  sing N N 314 
TYR CG  CD1  doub Y N 315 
TYR CG  CD2  sing Y N 316 
TYR CD1 CE1  sing Y N 317 
TYR CD1 HD1  sing N N 318 
TYR CD2 CE2  doub Y N 319 
TYR CD2 HD2  sing N N 320 
TYR CE1 CZ   doub Y N 321 
TYR CE1 HE1  sing N N 322 
TYR CE2 CZ   sing Y N 323 
TYR CE2 HE2  sing N N 324 
TYR CZ  OH   sing N N 325 
TYR OH  HH   sing N N 326 
TYR OXT HXT  sing N N 327 
VAL N   CA   sing N N 328 
VAL N   H    sing N N 329 
VAL N   H2   sing N N 330 
VAL CA  C    sing N N 331 
VAL CA  CB   sing N N 332 
VAL CA  HA   sing N N 333 
VAL C   O    doub N N 334 
VAL C   OXT  sing N N 335 
VAL CB  CG1  sing N N 336 
VAL CB  CG2  sing N N 337 
VAL CB  HB   sing N N 338 
VAL CG1 HG11 sing N N 339 
VAL CG1 HG12 sing N N 340 
VAL CG1 HG13 sing N N 341 
VAL CG2 HG21 sing N N 342 
VAL CG2 HG22 sing N N 343 
VAL CG2 HG23 sing N N 344 
VAL OXT HXT  sing N N 345 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 AVANCE ? Bruker  900 ? 
2 AVANCE ? Bruker  950 ? 
3 DDR2   ? Agilent 800 ? 
4 DDR2   ? Agilent 600 ? 
# 
_atom_sites.entry_id                    6G81 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_