data_6G8J # _entry.id 6G8J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6G8J pdb_00006g8j 10.2210/pdb6g8j/pdb WWPDB D_1200009578 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-04-17 2 'Structure model' 1 1 2019-12-04 3 'Structure model' 1 2 2019-12-18 4 'Structure model' 2 0 2022-12-07 5 'Structure model' 3 0 2023-11-15 6 'Structure model' 3 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' Advisory 4 4 'Structure model' 'Atomic model' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Non-polymer description' 9 4 'Structure model' 'Polymer sequence' 10 4 'Structure model' 'Source and taxonomy' 11 4 'Structure model' 'Structure summary' 12 5 'Structure model' 'Atomic model' 13 5 'Structure model' 'Data collection' 14 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' atom_site 6 4 'Structure model' atom_site_anisotrop 7 4 'Structure model' chem_comp 8 4 'Structure model' database_2 9 4 'Structure model' entity 10 4 'Structure model' entity_poly 11 4 'Structure model' entity_poly_seq 12 4 'Structure model' entity_src_gen 13 4 'Structure model' pdbx_entity_nonpoly 14 4 'Structure model' pdbx_nonpoly_scheme 15 4 'Structure model' pdbx_poly_seq_scheme 16 4 'Structure model' pdbx_struct_assembly_gen 17 4 'Structure model' pdbx_struct_conn_angle 18 4 'Structure model' pdbx_struct_special_symmetry 19 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 20 4 'Structure model' pdbx_unobs_or_zero_occ_residues 21 4 'Structure model' pdbx_validate_peptide_omega 22 4 'Structure model' struct_asym 23 4 'Structure model' struct_conn 24 4 'Structure model' struct_conn_type 25 4 'Structure model' struct_site 26 4 'Structure model' struct_site_gen 27 5 'Structure model' atom_site 28 5 'Structure model' atom_site_anisotrop 29 5 'Structure model' chem_comp_atom 30 5 'Structure model' chem_comp_bond 31 5 'Structure model' pdbx_validate_peptide_omega 32 6 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_citation_author.identifier_ORCID' 10 2 'Structure model' '_citation_author.name' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.page_last' 14 3 'Structure model' '_citation_author.identifier_ORCID' 15 4 'Structure model' '_atom_site.B_iso_or_equiv' 16 4 'Structure model' '_atom_site.Cartn_x' 17 4 'Structure model' '_atom_site.Cartn_y' 18 4 'Structure model' '_atom_site.Cartn_z' 19 4 'Structure model' '_atom_site.auth_asym_id' 20 4 'Structure model' '_atom_site.auth_atom_id' 21 4 'Structure model' '_atom_site.auth_comp_id' 22 4 'Structure model' '_atom_site.auth_seq_id' 23 4 'Structure model' '_atom_site.label_asym_id' 24 4 'Structure model' '_atom_site.label_atom_id' 25 4 'Structure model' '_atom_site.label_comp_id' 26 4 'Structure model' '_atom_site.label_entity_id' 27 4 'Structure model' '_atom_site.label_seq_id' 28 4 'Structure model' '_atom_site.pdbx_formal_charge' 29 4 'Structure model' '_atom_site.type_symbol' 30 4 'Structure model' '_atom_site_anisotrop.U[1][1]' 31 4 'Structure model' '_atom_site_anisotrop.U[1][2]' 32 4 'Structure model' '_atom_site_anisotrop.U[1][3]' 33 4 'Structure model' '_atom_site_anisotrop.U[2][2]' 34 4 'Structure model' '_atom_site_anisotrop.U[2][3]' 35 4 'Structure model' '_atom_site_anisotrop.U[3][3]' 36 4 'Structure model' '_atom_site_anisotrop.pdbx_auth_asym_id' 37 4 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 38 4 'Structure model' '_atom_site_anisotrop.pdbx_auth_comp_id' 39 4 'Structure model' '_atom_site_anisotrop.pdbx_auth_seq_id' 40 4 'Structure model' '_atom_site_anisotrop.pdbx_label_asym_id' 41 4 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' 42 4 'Structure model' '_atom_site_anisotrop.pdbx_label_comp_id' 43 4 'Structure model' '_atom_site_anisotrop.pdbx_label_seq_id' 44 4 'Structure model' '_atom_site_anisotrop.type_symbol' 45 4 'Structure model' '_chem_comp.formula' 46 4 'Structure model' '_chem_comp.formula_weight' 47 4 'Structure model' '_chem_comp.id' 48 4 'Structure model' '_chem_comp.mon_nstd_flag' 49 4 'Structure model' '_chem_comp.name' 50 4 'Structure model' '_chem_comp.pdbx_synonyms' 51 4 'Structure model' '_chem_comp.type' 52 4 'Structure model' '_database_2.pdbx_DOI' 53 4 'Structure model' '_database_2.pdbx_database_accession' 54 4 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 55 4 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 56 4 'Structure model' '_entity_poly_seq.mon_id' 57 4 'Structure model' '_entity_src_gen.gene_src_common_name' 58 4 'Structure model' '_pdbx_poly_seq_scheme.auth_mon_id' 59 4 'Structure model' '_pdbx_poly_seq_scheme.auth_seq_num' 60 4 'Structure model' '_pdbx_poly_seq_scheme.mon_id' 61 4 'Structure model' '_pdbx_poly_seq_scheme.pdb_mon_id' 62 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 63 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 64 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 65 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 66 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 67 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 68 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 69 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 70 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 71 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 72 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 73 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 74 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 75 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 76 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 77 4 'Structure model' '_pdbx_struct_conn_angle.value' 78 4 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 79 4 'Structure model' '_struct_conn.conn_type_id' 80 4 'Structure model' '_struct_conn.id' 81 4 'Structure model' '_struct_conn.pdbx_dist_value' 82 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 83 4 'Structure model' '_struct_conn.pdbx_ptnr1_label_alt_id' 84 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 85 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 86 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 87 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 88 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 89 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 90 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 91 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 92 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 93 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 94 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 95 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 96 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 97 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 98 4 'Structure model' '_struct_conn.ptnr2_symmetry' 99 4 'Structure model' '_struct_conn_type.id' 100 4 'Structure model' '_struct_site.details' 101 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 102 4 'Structure model' '_struct_site_gen.label_asym_id' 103 5 'Structure model' '_atom_site.auth_atom_id' 104 5 'Structure model' '_atom_site.label_atom_id' 105 5 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 106 5 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6G8J _pdbx_database_status.recvd_initial_deposition_date 2018-04-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'Similar structure in same study' _pdbx_database_related.db_id 6g6x _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Andrei, S.A.' 1 0000-0003-2961-8018 'Thijssen, V.' 2 0000-0002-4390-1314 'Brunsveld, L.' 3 0000-0001-5675-511X 'Ottmann, C.' 4 0000-0001-7315-0315 'Milroy, L.G.' 5 0000-0003-4601-0936 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem.Commun.(Camb.)' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1364-548X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 55 _citation.language ? _citation.page_first 14809 _citation.page_last 14812 _citation.title 'A study on the effect of synthetic alpha-to-beta3-amino acid mutations on the binding of phosphopeptides to 14-3-3 proteins.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/c9cc07982c _citation.pdbx_database_id_PubMed 31763628 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Andrei, S.A.' 1 ? primary 'Thijssen, V.' 2 ? primary 'Brunsveld, L.' 3 ? primary 'Ottmann, C.' 4 ? primary 'Milroy, L.G.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '14-3-3 protein sigma' 26542.914 1 ? ? ? ? 2 polymer syn ACE-ARG-ALA-HIS-SEP-SER-PRO-BAL-SER-LEU-GLN 1175.190 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 5 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 6 water nat water 18.015 375 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Epithelial cell marker protein 1,Stratifin' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM DISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM DISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; A ? 2 'polypeptide(L)' no yes '(ACE)RAH(SEP)SP(B3A)SLQ' XRAHSSPASLQ P ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CHLORIDE ION' CL 4 'MAGNESIUM ION' MG 5 'SODIUM ION' NA 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 ARG n 1 9 ALA n 1 10 SER n 1 11 LEU n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 ALA n 1 16 LYS n 1 17 LEU n 1 18 ALA n 1 19 GLU n 1 20 GLN n 1 21 ALA n 1 22 GLU n 1 23 ARG n 1 24 TYR n 1 25 GLU n 1 26 ASP n 1 27 MET n 1 28 ALA n 1 29 ALA n 1 30 PHE n 1 31 MET n 1 32 LYS n 1 33 GLY n 1 34 ALA n 1 35 VAL n 1 36 GLU n 1 37 LYS n 1 38 GLY n 1 39 GLU n 1 40 GLU n 1 41 LEU n 1 42 SER n 1 43 CYS n 1 44 GLU n 1 45 GLU n 1 46 ARG n 1 47 ASN n 1 48 LEU n 1 49 LEU n 1 50 SER n 1 51 VAL n 1 52 ALA n 1 53 TYR n 1 54 LYS n 1 55 ASN n 1 56 VAL n 1 57 VAL n 1 58 GLY n 1 59 GLY n 1 60 GLN n 1 61 ARG n 1 62 ALA n 1 63 ALA n 1 64 TRP n 1 65 ARG n 1 66 VAL n 1 67 LEU n 1 68 SER n 1 69 SER n 1 70 ILE n 1 71 GLU n 1 72 GLN n 1 73 LYS n 1 74 SER n 1 75 ASN n 1 76 GLU n 1 77 GLU n 1 78 GLY n 1 79 SER n 1 80 GLU n 1 81 GLU n 1 82 LYS n 1 83 GLY n 1 84 PRO n 1 85 GLU n 1 86 VAL n 1 87 ARG n 1 88 GLU n 1 89 TYR n 1 90 ARG n 1 91 GLU n 1 92 LYS n 1 93 VAL n 1 94 GLU n 1 95 THR n 1 96 GLU n 1 97 LEU n 1 98 GLN n 1 99 GLY n 1 100 VAL n 1 101 CYS n 1 102 ASP n 1 103 THR n 1 104 VAL n 1 105 LEU n 1 106 GLY n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 SER n 1 111 HIS n 1 112 LEU n 1 113 ILE n 1 114 LYS n 1 115 GLU n 1 116 ALA n 1 117 GLY n 1 118 ASP n 1 119 ALA n 1 120 GLU n 1 121 SER n 1 122 ARG n 1 123 VAL n 1 124 PHE n 1 125 TYR n 1 126 LEU n 1 127 LYS n 1 128 MET n 1 129 LYS n 1 130 GLY n 1 131 ASP n 1 132 TYR n 1 133 TYR n 1 134 ARG n 1 135 TYR n 1 136 LEU n 1 137 ALA n 1 138 GLU n 1 139 VAL n 1 140 ALA n 1 141 THR n 1 142 GLY n 1 143 ASP n 1 144 ASP n 1 145 LYS n 1 146 LYS n 1 147 ARG n 1 148 ILE n 1 149 ILE n 1 150 ASP n 1 151 SER n 1 152 ALA n 1 153 ARG n 1 154 SER n 1 155 ALA n 1 156 TYR n 1 157 GLN n 1 158 GLU n 1 159 ALA n 1 160 MET n 1 161 ASP n 1 162 ILE n 1 163 SER n 1 164 LYS n 1 165 LYS n 1 166 GLU n 1 167 MET n 1 168 PRO n 1 169 PRO n 1 170 THR n 1 171 ASN n 1 172 PRO n 1 173 ILE n 1 174 ARG n 1 175 LEU n 1 176 GLY n 1 177 LEU n 1 178 ALA n 1 179 LEU n 1 180 ASN n 1 181 PHE n 1 182 SER n 1 183 VAL n 1 184 PHE n 1 185 HIS n 1 186 TYR n 1 187 GLU n 1 188 ILE n 1 189 ALA n 1 190 ASN n 1 191 SER n 1 192 PRO n 1 193 GLU n 1 194 GLU n 1 195 ALA n 1 196 ILE n 1 197 SER n 1 198 LEU n 1 199 ALA n 1 200 LYS n 1 201 THR n 1 202 THR n 1 203 PHE n 1 204 ASP n 1 205 GLU n 1 206 ALA n 1 207 MET n 1 208 ALA n 1 209 ASP n 1 210 LEU n 1 211 HIS n 1 212 THR n 1 213 LEU n 1 214 SER n 1 215 GLU n 1 216 ASP n 1 217 SER n 1 218 TYR n 1 219 LYS n 1 220 ASP n 1 221 SER n 1 222 THR n 1 223 LEU n 1 224 ILE n 1 225 MET n 1 226 GLN n 1 227 LEU n 1 228 LEU n 1 229 ARG n 1 230 ASP n 1 231 ASN n 1 232 LEU n 1 233 THR n 1 234 LEU n 1 235 TRP n 1 236 THR n 2 1 ACE n 2 2 ARG n 2 3 ALA n 2 4 HIS n 2 5 SEP n 2 6 SER n 2 7 PRO n 2 8 B3A n 2 9 SER n 2 10 LEU n 2 11 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 236 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SFN, HME1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 11 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 B3A 'L-peptide linking' n '(3S)-3-AMINOBUTANOIC ACID' ? 'C4 H9 N O2' 103.120 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 -4 GLY GLY A . n A 1 2 ALA 2 -3 -3 ALA ALA A . n A 1 3 MET 3 -2 -2 MET MET A . n A 1 4 GLY 4 -1 -1 GLY GLY A . n A 1 5 SER 5 0 0 SER SER A . n A 1 6 MET 6 1 1 MET MET A . n A 1 7 GLU 7 2 2 GLU GLU A . n A 1 8 ARG 8 3 3 ARG ARG A . n A 1 9 ALA 9 4 4 ALA ALA A . n A 1 10 SER 10 5 5 SER SER A . n A 1 11 LEU 11 6 6 LEU LEU A . n A 1 12 ILE 12 7 7 ILE ILE A . n A 1 13 GLN 13 8 8 GLN GLN A . n A 1 14 LYS 14 9 9 LYS LYS A . n A 1 15 ALA 15 10 10 ALA ALA A . n A 1 16 LYS 16 11 11 LYS LYS A . n A 1 17 LEU 17 12 12 LEU LEU A . n A 1 18 ALA 18 13 13 ALA ALA A . n A 1 19 GLU 19 14 14 GLU GLU A . n A 1 20 GLN 20 15 15 GLN GLN A . n A 1 21 ALA 21 16 16 ALA ALA A . n A 1 22 GLU 22 17 17 GLU GLU A . n A 1 23 ARG 23 18 18 ARG ARG A . n A 1 24 TYR 24 19 19 TYR TYR A . n A 1 25 GLU 25 20 20 GLU GLU A . n A 1 26 ASP 26 21 21 ASP ASP A . n A 1 27 MET 27 22 22 MET MET A . n A 1 28 ALA 28 23 23 ALA ALA A . n A 1 29 ALA 29 24 24 ALA ALA A . n A 1 30 PHE 30 25 25 PHE PHE A . n A 1 31 MET 31 26 26 MET MET A . n A 1 32 LYS 32 27 27 LYS LYS A . n A 1 33 GLY 33 28 28 GLY GLY A . n A 1 34 ALA 34 29 29 ALA ALA A . n A 1 35 VAL 35 30 30 VAL VAL A . n A 1 36 GLU 36 31 31 GLU GLU A . n A 1 37 LYS 37 32 32 LYS LYS A . n A 1 38 GLY 38 33 33 GLY GLY A . n A 1 39 GLU 39 34 34 GLU GLU A . n A 1 40 GLU 40 35 35 GLU GLU A . n A 1 41 LEU 41 36 36 LEU LEU A . n A 1 42 SER 42 37 37 SER SER A . n A 1 43 CYS 43 38 38 CYS CYS A . n A 1 44 GLU 44 39 39 GLU GLU A . n A 1 45 GLU 45 40 40 GLU GLU A . n A 1 46 ARG 46 41 41 ARG ARG A . n A 1 47 ASN 47 42 42 ASN ASN A . n A 1 48 LEU 48 43 43 LEU LEU A . n A 1 49 LEU 49 44 44 LEU LEU A . n A 1 50 SER 50 45 45 SER SER A . n A 1 51 VAL 51 46 46 VAL VAL A . n A 1 52 ALA 52 47 47 ALA ALA A . n A 1 53 TYR 53 48 48 TYR TYR A . n A 1 54 LYS 54 49 49 LYS LYS A . n A 1 55 ASN 55 50 50 ASN ASN A . n A 1 56 VAL 56 51 51 VAL VAL A . n A 1 57 VAL 57 52 52 VAL VAL A . n A 1 58 GLY 58 53 53 GLY GLY A . n A 1 59 GLY 59 54 54 GLY GLY A . n A 1 60 GLN 60 55 55 GLN GLN A . n A 1 61 ARG 61 56 56 ARG ARG A . n A 1 62 ALA 62 57 57 ALA ALA A . n A 1 63 ALA 63 58 58 ALA ALA A . n A 1 64 TRP 64 59 59 TRP TRP A . n A 1 65 ARG 65 60 60 ARG ARG A . n A 1 66 VAL 66 61 61 VAL VAL A . n A 1 67 LEU 67 62 62 LEU LEU A . n A 1 68 SER 68 63 63 SER SER A . n A 1 69 SER 69 64 64 SER SER A . n A 1 70 ILE 70 65 65 ILE ILE A . n A 1 71 GLU 71 66 66 GLU GLU A . n A 1 72 GLN 72 67 67 GLN GLN A . n A 1 73 LYS 73 68 68 LYS LYS A . n A 1 74 SER 74 69 69 SER SER A . n A 1 75 ASN 75 70 70 ASN ASN A . n A 1 76 GLU 76 71 71 GLU GLU A . n A 1 77 GLU 77 72 72 GLU GLU A . n A 1 78 GLY 78 73 73 GLY GLY A . n A 1 79 SER 79 74 74 SER SER A . n A 1 80 GLU 80 75 75 GLU GLU A . n A 1 81 GLU 81 76 76 GLU GLU A . n A 1 82 LYS 82 77 77 LYS LYS A . n A 1 83 GLY 83 78 78 GLY GLY A . n A 1 84 PRO 84 79 79 PRO PRO A . n A 1 85 GLU 85 80 80 GLU GLU A . n A 1 86 VAL 86 81 81 VAL VAL A . n A 1 87 ARG 87 82 82 ARG ARG A . n A 1 88 GLU 88 83 83 GLU GLU A . n A 1 89 TYR 89 84 84 TYR TYR A . n A 1 90 ARG 90 85 85 ARG ARG A . n A 1 91 GLU 91 86 86 GLU GLU A . n A 1 92 LYS 92 87 87 LYS LYS A . n A 1 93 VAL 93 88 88 VAL VAL A . n A 1 94 GLU 94 89 89 GLU GLU A . n A 1 95 THR 95 90 90 THR THR A . n A 1 96 GLU 96 91 91 GLU GLU A . n A 1 97 LEU 97 92 92 LEU LEU A . n A 1 98 GLN 98 93 93 GLN GLN A . n A 1 99 GLY 99 94 94 GLY GLY A . n A 1 100 VAL 100 95 95 VAL VAL A . n A 1 101 CYS 101 96 96 CYS CYS A . n A 1 102 ASP 102 97 97 ASP ASP A . n A 1 103 THR 103 98 98 THR THR A . n A 1 104 VAL 104 99 99 VAL VAL A . n A 1 105 LEU 105 100 100 LEU LEU A . n A 1 106 GLY 106 101 101 GLY GLY A . n A 1 107 LEU 107 102 102 LEU LEU A . n A 1 108 LEU 108 103 103 LEU LEU A . n A 1 109 ASP 109 104 104 ASP ASP A . n A 1 110 SER 110 105 105 SER SER A . n A 1 111 HIS 111 106 106 HIS HIS A . n A 1 112 LEU 112 107 107 LEU LEU A . n A 1 113 ILE 113 108 108 ILE ILE A . n A 1 114 LYS 114 109 109 LYS LYS A . n A 1 115 GLU 115 110 110 GLU GLU A . n A 1 116 ALA 116 111 111 ALA ALA A . n A 1 117 GLY 117 112 112 GLY GLY A . n A 1 118 ASP 118 113 113 ASP ASP A . n A 1 119 ALA 119 114 114 ALA ALA A . n A 1 120 GLU 120 115 115 GLU GLU A . n A 1 121 SER 121 116 116 SER SER A . n A 1 122 ARG 122 117 117 ARG ARG A . n A 1 123 VAL 123 118 118 VAL VAL A . n A 1 124 PHE 124 119 119 PHE PHE A . n A 1 125 TYR 125 120 120 TYR TYR A . n A 1 126 LEU 126 121 121 LEU LEU A . n A 1 127 LYS 127 122 122 LYS LYS A . n A 1 128 MET 128 123 123 MET MET A . n A 1 129 LYS 129 124 124 LYS LYS A . n A 1 130 GLY 130 125 125 GLY GLY A . n A 1 131 ASP 131 126 126 ASP ASP A . n A 1 132 TYR 132 127 127 TYR TYR A . n A 1 133 TYR 133 128 128 TYR TYR A . n A 1 134 ARG 134 129 129 ARG ARG A . n A 1 135 TYR 135 130 130 TYR TYR A . n A 1 136 LEU 136 131 131 LEU LEU A . n A 1 137 ALA 137 132 132 ALA ALA A . n A 1 138 GLU 138 133 133 GLU GLU A . n A 1 139 VAL 139 134 134 VAL VAL A . n A 1 140 ALA 140 135 135 ALA ALA A . n A 1 141 THR 141 136 136 THR THR A . n A 1 142 GLY 142 137 137 GLY GLY A . n A 1 143 ASP 143 138 138 ASP ASP A . n A 1 144 ASP 144 139 139 ASP ASP A . n A 1 145 LYS 145 140 140 LYS LYS A . n A 1 146 LYS 146 141 141 LYS LYS A . n A 1 147 ARG 147 142 142 ARG ARG A . n A 1 148 ILE 148 143 143 ILE ILE A . n A 1 149 ILE 149 144 144 ILE ILE A . n A 1 150 ASP 150 145 145 ASP ASP A . n A 1 151 SER 151 146 146 SER SER A . n A 1 152 ALA 152 147 147 ALA ALA A . n A 1 153 ARG 153 148 148 ARG ARG A . n A 1 154 SER 154 149 149 SER SER A . n A 1 155 ALA 155 150 150 ALA ALA A . n A 1 156 TYR 156 151 151 TYR TYR A . n A 1 157 GLN 157 152 152 GLN GLN A . n A 1 158 GLU 158 153 153 GLU GLU A . n A 1 159 ALA 159 154 154 ALA ALA A . n A 1 160 MET 160 155 155 MET MET A . n A 1 161 ASP 161 156 156 ASP ASP A . n A 1 162 ILE 162 157 157 ILE ILE A . n A 1 163 SER 163 158 158 SER SER A . n A 1 164 LYS 164 159 159 LYS LYS A . n A 1 165 LYS 165 160 160 LYS LYS A . n A 1 166 GLU 166 161 161 GLU GLU A . n A 1 167 MET 167 162 162 MET MET A . n A 1 168 PRO 168 163 163 PRO PRO A . n A 1 169 PRO 169 164 164 PRO PRO A . n A 1 170 THR 170 165 165 THR THR A . n A 1 171 ASN 171 166 166 ASN ASN A . n A 1 172 PRO 172 167 167 PRO PRO A . n A 1 173 ILE 173 168 168 ILE ILE A . n A 1 174 ARG 174 169 169 ARG ARG A . n A 1 175 LEU 175 170 170 LEU LEU A . n A 1 176 GLY 176 171 171 GLY GLY A . n A 1 177 LEU 177 172 172 LEU LEU A . n A 1 178 ALA 178 173 173 ALA ALA A . n A 1 179 LEU 179 174 174 LEU LEU A . n A 1 180 ASN 180 175 175 ASN ASN A . n A 1 181 PHE 181 176 176 PHE PHE A . n A 1 182 SER 182 177 177 SER SER A . n A 1 183 VAL 183 178 178 VAL VAL A . n A 1 184 PHE 184 179 179 PHE PHE A . n A 1 185 HIS 185 180 180 HIS HIS A . n A 1 186 TYR 186 181 181 TYR TYR A . n A 1 187 GLU 187 182 182 GLU GLU A . n A 1 188 ILE 188 183 183 ILE ILE A . n A 1 189 ALA 189 184 184 ALA ALA A . n A 1 190 ASN 190 185 185 ASN ASN A . n A 1 191 SER 191 186 186 SER SER A . n A 1 192 PRO 192 187 187 PRO PRO A . n A 1 193 GLU 193 188 188 GLU GLU A . n A 1 194 GLU 194 189 189 GLU GLU A . n A 1 195 ALA 195 190 190 ALA ALA A . n A 1 196 ILE 196 191 191 ILE ILE A . n A 1 197 SER 197 192 192 SER SER A . n A 1 198 LEU 198 193 193 LEU LEU A . n A 1 199 ALA 199 194 194 ALA ALA A . n A 1 200 LYS 200 195 195 LYS LYS A . n A 1 201 THR 201 196 196 THR THR A . n A 1 202 THR 202 197 197 THR THR A . n A 1 203 PHE 203 198 198 PHE PHE A . n A 1 204 ASP 204 199 199 ASP ASP A . n A 1 205 GLU 205 200 200 GLU GLU A . n A 1 206 ALA 206 201 201 ALA ALA A . n A 1 207 MET 207 202 202 MET MET A . n A 1 208 ALA 208 203 203 ALA ALA A . n A 1 209 ASP 209 204 204 ASP ASP A . n A 1 210 LEU 210 205 205 LEU LEU A . n A 1 211 HIS 211 206 206 HIS HIS A . n A 1 212 THR 212 207 207 THR THR A . n A 1 213 LEU 213 208 208 LEU LEU A . n A 1 214 SER 214 209 209 SER SER A . n A 1 215 GLU 215 210 210 GLU GLU A . n A 1 216 ASP 216 211 211 ASP ASP A . n A 1 217 SER 217 212 212 SER SER A . n A 1 218 TYR 218 213 213 TYR TYR A . n A 1 219 LYS 219 214 214 LYS LYS A . n A 1 220 ASP 220 215 215 ASP ASP A . n A 1 221 SER 221 216 216 SER SER A . n A 1 222 THR 222 217 217 THR THR A . n A 1 223 LEU 223 218 218 LEU LEU A . n A 1 224 ILE 224 219 219 ILE ILE A . n A 1 225 MET 225 220 220 MET MET A . n A 1 226 GLN 226 221 221 GLN GLN A . n A 1 227 LEU 227 222 222 LEU LEU A . n A 1 228 LEU 228 223 223 LEU LEU A . n A 1 229 ARG 229 224 224 ARG ARG A . n A 1 230 ASP 230 225 225 ASP ASP A . n A 1 231 ASN 231 226 226 ASN ASN A . n A 1 232 LEU 232 227 227 LEU LEU A . n A 1 233 THR 233 228 228 THR THR A . n A 1 234 LEU 234 229 229 LEU LEU A . n A 1 235 TRP 235 230 230 TRP TRP A . n A 1 236 THR 236 231 231 THR THR A . n B 2 1 ACE 1 123 ? ? ? P . n B 2 2 ARG 2 124 ? ? ? P . n B 2 3 ALA 3 125 125 ALA ALA P . n B 2 4 HIS 4 126 126 HIS HIS P . n B 2 5 SEP 5 127 127 SEP SEP P . n B 2 6 SER 6 128 128 SER SER P . n B 2 7 PRO 7 129 129 PRO PRO P . n B 2 8 B3A 8 130 130 B3A BAL P . n B 2 9 SER 9 131 ? ? ? P . n B 2 10 LEU 10 132 ? ? ? P . n B 2 11 GLN 11 133 ? ? ? P . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CL 1 301 1 CL CL A . D 4 MG 1 302 2 MG MG A . E 5 NA 1 303 3 NA NA A . F 6 HOH 1 401 272 HOH HOH A . F 6 HOH 2 402 269 HOH HOH A . F 6 HOH 3 403 329 HOH HOH A . F 6 HOH 4 404 341 HOH HOH A . F 6 HOH 5 405 132 HOH HOH A . F 6 HOH 6 406 51 HOH HOH A . F 6 HOH 7 407 267 HOH HOH A . F 6 HOH 8 408 312 HOH HOH A . F 6 HOH 9 409 164 HOH HOH A . F 6 HOH 10 410 165 HOH HOH A . F 6 HOH 11 411 82 HOH HOH A . F 6 HOH 12 412 351 HOH HOH A . F 6 HOH 13 413 136 HOH HOH A . F 6 HOH 14 414 261 HOH HOH A . F 6 HOH 15 415 278 HOH HOH A . F 6 HOH 16 416 14 HOH HOH A . F 6 HOH 17 417 349 HOH HOH A . F 6 HOH 18 418 332 HOH HOH A . F 6 HOH 19 419 322 HOH HOH A . F 6 HOH 20 420 57 HOH HOH A . F 6 HOH 21 421 254 HOH HOH A . F 6 HOH 22 422 144 HOH HOH A . F 6 HOH 23 423 151 HOH HOH A . F 6 HOH 24 424 330 HOH HOH A . F 6 HOH 25 425 277 HOH HOH A . F 6 HOH 26 426 210 HOH HOH A . F 6 HOH 27 427 175 HOH HOH A . F 6 HOH 28 428 222 HOH HOH A . F 6 HOH 29 429 196 HOH HOH A . F 6 HOH 30 430 45 HOH HOH A . F 6 HOH 31 431 157 HOH HOH A . F 6 HOH 32 432 381 HOH HOH A . F 6 HOH 33 433 168 HOH HOH A . F 6 HOH 34 434 326 HOH HOH A . F 6 HOH 35 435 124 HOH HOH A . F 6 HOH 36 436 13 HOH HOH A . F 6 HOH 37 437 218 HOH HOH A . F 6 HOH 38 438 115 HOH HOH A . F 6 HOH 39 439 36 HOH HOH A . F 6 HOH 40 440 84 HOH HOH A . F 6 HOH 41 441 282 HOH HOH A . F 6 HOH 42 442 323 HOH HOH A . F 6 HOH 43 443 64 HOH HOH A . F 6 HOH 44 444 325 HOH HOH A . F 6 HOH 45 445 171 HOH HOH A . F 6 HOH 46 446 123 HOH HOH A . F 6 HOH 47 447 289 HOH HOH A . F 6 HOH 48 448 108 HOH HOH A . F 6 HOH 49 449 328 HOH HOH A . F 6 HOH 50 450 6 HOH HOH A . F 6 HOH 51 451 55 HOH HOH A . F 6 HOH 52 452 9 HOH HOH A . F 6 HOH 53 453 5 HOH HOH A . F 6 HOH 54 454 189 HOH HOH A . F 6 HOH 55 455 86 HOH HOH A . F 6 HOH 56 456 60 HOH HOH A . F 6 HOH 57 457 195 HOH HOH A . F 6 HOH 58 458 237 HOH HOH A . F 6 HOH 59 459 96 HOH HOH A . F 6 HOH 60 460 371 HOH HOH A . F 6 HOH 61 461 360 HOH HOH A . F 6 HOH 62 462 186 HOH HOH A . F 6 HOH 63 463 206 HOH HOH A . F 6 HOH 64 464 46 HOH HOH A . F 6 HOH 65 465 105 HOH HOH A . F 6 HOH 66 466 149 HOH HOH A . F 6 HOH 67 467 69 HOH HOH A . F 6 HOH 68 468 63 HOH HOH A . F 6 HOH 69 469 54 HOH HOH A . F 6 HOH 70 470 224 HOH HOH A . F 6 HOH 71 471 120 HOH HOH A . F 6 HOH 72 472 78 HOH HOH A . F 6 HOH 73 473 2 HOH HOH A . F 6 HOH 74 474 85 HOH HOH A . F 6 HOH 75 475 147 HOH HOH A . F 6 HOH 76 476 91 HOH HOH A . F 6 HOH 77 477 128 HOH HOH A . F 6 HOH 78 478 150 HOH HOH A . F 6 HOH 79 479 173 HOH HOH A . F 6 HOH 80 480 113 HOH HOH A . F 6 HOH 81 481 1 HOH HOH A . F 6 HOH 82 482 4 HOH HOH A . F 6 HOH 83 483 67 HOH HOH A . F 6 HOH 84 484 31 HOH HOH A . F 6 HOH 85 485 99 HOH HOH A . F 6 HOH 86 486 112 HOH HOH A . F 6 HOH 87 487 71 HOH HOH A . F 6 HOH 88 488 50 HOH HOH A . F 6 HOH 89 489 98 HOH HOH A . F 6 HOH 90 490 39 HOH HOH A . F 6 HOH 91 491 297 HOH HOH A . F 6 HOH 92 492 114 HOH HOH A . F 6 HOH 93 493 227 HOH HOH A . F 6 HOH 94 494 41 HOH HOH A . F 6 HOH 95 495 207 HOH HOH A . F 6 HOH 96 496 76 HOH HOH A . F 6 HOH 97 497 103 HOH HOH A . F 6 HOH 98 498 226 HOH HOH A . F 6 HOH 99 499 81 HOH HOH A . F 6 HOH 100 500 160 HOH HOH A . F 6 HOH 101 501 337 HOH HOH A . F 6 HOH 102 502 129 HOH HOH A . F 6 HOH 103 503 61 HOH HOH A . F 6 HOH 104 504 59 HOH HOH A . F 6 HOH 105 505 181 HOH HOH A . F 6 HOH 106 506 213 HOH HOH A . F 6 HOH 107 507 133 HOH HOH A . F 6 HOH 108 508 258 HOH HOH A . F 6 HOH 109 509 11 HOH HOH A . F 6 HOH 110 510 79 HOH HOH A . F 6 HOH 111 511 8 HOH HOH A . F 6 HOH 112 512 33 HOH HOH A . F 6 HOH 113 513 73 HOH HOH A . F 6 HOH 114 514 179 HOH HOH A . F 6 HOH 115 515 66 HOH HOH A . F 6 HOH 116 516 44 HOH HOH A . F 6 HOH 117 517 102 HOH HOH A . F 6 HOH 118 518 3 HOH HOH A . F 6 HOH 119 519 19 HOH HOH A . F 6 HOH 120 520 21 HOH HOH A . F 6 HOH 121 521 216 HOH HOH A . F 6 HOH 122 522 127 HOH HOH A . F 6 HOH 123 523 16 HOH HOH A . F 6 HOH 124 524 208 HOH HOH A . F 6 HOH 125 525 247 HOH HOH A . F 6 HOH 126 526 47 HOH HOH A . F 6 HOH 127 527 342 HOH HOH A . F 6 HOH 128 528 26 HOH HOH A . F 6 HOH 129 529 92 HOH HOH A . F 6 HOH 130 530 243 HOH HOH A . F 6 HOH 131 531 38 HOH HOH A . F 6 HOH 132 532 34 HOH HOH A . F 6 HOH 133 533 305 HOH HOH A . F 6 HOH 134 534 225 HOH HOH A . F 6 HOH 135 535 89 HOH HOH A . F 6 HOH 136 536 65 HOH HOH A . F 6 HOH 137 537 20 HOH HOH A . F 6 HOH 138 538 245 HOH HOH A . F 6 HOH 139 539 188 HOH HOH A . F 6 HOH 140 540 201 HOH HOH A . F 6 HOH 141 541 198 HOH HOH A . F 6 HOH 142 542 292 HOH HOH A . F 6 HOH 143 543 167 HOH HOH A . F 6 HOH 144 544 184 HOH HOH A . F 6 HOH 145 545 32 HOH HOH A . F 6 HOH 146 546 257 HOH HOH A . F 6 HOH 147 547 23 HOH HOH A . F 6 HOH 148 548 265 HOH HOH A . F 6 HOH 149 549 77 HOH HOH A . F 6 HOH 150 550 219 HOH HOH A . F 6 HOH 151 551 166 HOH HOH A . F 6 HOH 152 552 49 HOH HOH A . F 6 HOH 153 553 106 HOH HOH A . F 6 HOH 154 554 366 HOH HOH A . F 6 HOH 155 555 75 HOH HOH A . F 6 HOH 156 556 209 HOH HOH A . F 6 HOH 157 557 24 HOH HOH A . F 6 HOH 158 558 48 HOH HOH A . F 6 HOH 159 559 88 HOH HOH A . F 6 HOH 160 560 153 HOH HOH A . F 6 HOH 161 561 109 HOH HOH A . F 6 HOH 162 562 313 HOH HOH A . F 6 HOH 163 563 25 HOH HOH A . F 6 HOH 164 564 27 HOH HOH A . F 6 HOH 165 565 214 HOH HOH A . F 6 HOH 166 566 10 HOH HOH A . F 6 HOH 167 567 387 HOH HOH A . F 6 HOH 168 568 386 HOH HOH A . F 6 HOH 169 569 17 HOH HOH A . F 6 HOH 170 570 139 HOH HOH A . F 6 HOH 171 571 74 HOH HOH A . F 6 HOH 172 572 260 HOH HOH A . F 6 HOH 173 573 143 HOH HOH A . F 6 HOH 174 574 259 HOH HOH A . F 6 HOH 175 575 161 HOH HOH A . F 6 HOH 176 576 37 HOH HOH A . F 6 HOH 177 577 107 HOH HOH A . F 6 HOH 178 578 80 HOH HOH A . F 6 HOH 179 579 35 HOH HOH A . F 6 HOH 180 580 97 HOH HOH A . F 6 HOH 181 581 22 HOH HOH A . F 6 HOH 182 582 140 HOH HOH A . F 6 HOH 183 583 174 HOH HOH A . F 6 HOH 184 584 249 HOH HOH A . F 6 HOH 185 585 18 HOH HOH A . F 6 HOH 186 586 233 HOH HOH A . F 6 HOH 187 587 40 HOH HOH A . F 6 HOH 188 588 281 HOH HOH A . F 6 HOH 189 589 72 HOH HOH A . F 6 HOH 190 590 390 HOH HOH A . F 6 HOH 191 591 176 HOH HOH A . F 6 HOH 192 592 154 HOH HOH A . F 6 HOH 193 593 318 HOH HOH A . F 6 HOH 194 594 142 HOH HOH A . F 6 HOH 195 595 190 HOH HOH A . F 6 HOH 196 596 204 HOH HOH A . F 6 HOH 197 597 28 HOH HOH A . F 6 HOH 198 598 228 HOH HOH A . F 6 HOH 199 599 43 HOH HOH A . F 6 HOH 200 600 104 HOH HOH A . F 6 HOH 201 601 279 HOH HOH A . F 6 HOH 202 602 263 HOH HOH A . F 6 HOH 203 603 137 HOH HOH A . F 6 HOH 204 604 42 HOH HOH A . F 6 HOH 205 605 148 HOH HOH A . F 6 HOH 206 606 30 HOH HOH A . F 6 HOH 207 607 194 HOH HOH A . F 6 HOH 208 608 338 HOH HOH A . F 6 HOH 209 609 397 HOH HOH A . F 6 HOH 210 610 53 HOH HOH A . F 6 HOH 211 611 378 HOH HOH A . F 6 HOH 212 612 138 HOH HOH A . F 6 HOH 213 613 262 HOH HOH A . F 6 HOH 214 614 385 HOH HOH A . F 6 HOH 215 615 335 HOH HOH A . F 6 HOH 216 616 162 HOH HOH A . F 6 HOH 217 617 314 HOH HOH A . F 6 HOH 218 618 95 HOH HOH A . F 6 HOH 219 619 200 HOH HOH A . F 6 HOH 220 620 205 HOH HOH A . F 6 HOH 221 621 185 HOH HOH A . F 6 HOH 222 622 274 HOH HOH A . F 6 HOH 223 623 178 HOH HOH A . F 6 HOH 224 624 203 HOH HOH A . F 6 HOH 225 625 145 HOH HOH A . F 6 HOH 226 626 7 HOH HOH A . F 6 HOH 227 627 339 HOH HOH A . F 6 HOH 228 628 334 HOH HOH A . F 6 HOH 229 629 276 HOH HOH A . F 6 HOH 230 630 286 HOH HOH A . F 6 HOH 231 631 230 HOH HOH A . F 6 HOH 232 632 362 HOH HOH A . F 6 HOH 233 633 251 HOH HOH A . F 6 HOH 234 634 280 HOH HOH A . F 6 HOH 235 635 306 HOH HOH A . F 6 HOH 236 636 155 HOH HOH A . F 6 HOH 237 637 344 HOH HOH A . F 6 HOH 238 638 197 HOH HOH A . F 6 HOH 239 639 182 HOH HOH A . F 6 HOH 240 640 367 HOH HOH A . F 6 HOH 241 641 121 HOH HOH A . F 6 HOH 242 642 146 HOH HOH A . F 6 HOH 243 643 116 HOH HOH A . F 6 HOH 244 644 101 HOH HOH A . F 6 HOH 245 645 169 HOH HOH A . F 6 HOH 246 646 345 HOH HOH A . F 6 HOH 247 647 193 HOH HOH A . F 6 HOH 248 648 309 HOH HOH A . F 6 HOH 249 649 308 HOH HOH A . F 6 HOH 250 650 295 HOH HOH A . F 6 HOH 251 651 250 HOH HOH A . F 6 HOH 252 652 234 HOH HOH A . F 6 HOH 253 653 244 HOH HOH A . F 6 HOH 254 654 327 HOH HOH A . F 6 HOH 255 655 220 HOH HOH A . F 6 HOH 256 656 336 HOH HOH A . F 6 HOH 257 657 239 HOH HOH A . F 6 HOH 258 658 316 HOH HOH A . F 6 HOH 259 659 125 HOH HOH A . F 6 HOH 260 660 270 HOH HOH A . F 6 HOH 261 661 315 HOH HOH A . F 6 HOH 262 662 100 HOH HOH A . F 6 HOH 263 663 294 HOH HOH A . F 6 HOH 264 664 229 HOH HOH A . F 6 HOH 265 665 271 HOH HOH A . F 6 HOH 266 666 264 HOH HOH A . F 6 HOH 267 667 285 HOH HOH A . F 6 HOH 268 668 284 HOH HOH A . F 6 HOH 269 669 52 HOH HOH A . F 6 HOH 270 670 372 HOH HOH A . F 6 HOH 271 671 288 HOH HOH A . F 6 HOH 272 672 388 HOH HOH A . F 6 HOH 273 673 180 HOH HOH A . F 6 HOH 274 674 172 HOH HOH A . F 6 HOH 275 675 343 HOH HOH A . F 6 HOH 276 676 211 HOH HOH A . F 6 HOH 277 677 301 HOH HOH A . F 6 HOH 278 678 256 HOH HOH A . F 6 HOH 279 679 383 HOH HOH A . F 6 HOH 280 680 396 HOH HOH A . F 6 HOH 281 681 376 HOH HOH A . F 6 HOH 282 682 255 HOH HOH A . F 6 HOH 283 683 130 HOH HOH A . F 6 HOH 284 684 331 HOH HOH A . F 6 HOH 285 685 283 HOH HOH A . F 6 HOH 286 686 192 HOH HOH A . F 6 HOH 287 687 217 HOH HOH A . F 6 HOH 288 688 126 HOH HOH A . F 6 HOH 289 689 275 HOH HOH A . F 6 HOH 290 690 310 HOH HOH A . F 6 HOH 291 691 110 HOH HOH A . F 6 HOH 292 692 170 HOH HOH A . F 6 HOH 293 693 392 HOH HOH A . F 6 HOH 294 694 212 HOH HOH A . F 6 HOH 295 695 156 HOH HOH A . F 6 HOH 296 696 134 HOH HOH A . F 6 HOH 297 697 163 HOH HOH A . F 6 HOH 298 698 187 HOH HOH A . F 6 HOH 299 699 15 HOH HOH A . F 6 HOH 300 700 391 HOH HOH A . F 6 HOH 301 701 370 HOH HOH A . F 6 HOH 302 702 242 HOH HOH A . F 6 HOH 303 703 118 HOH HOH A . F 6 HOH 304 704 215 HOH HOH A . F 6 HOH 305 705 273 HOH HOH A . F 6 HOH 306 706 382 HOH HOH A . F 6 HOH 307 707 235 HOH HOH A . F 6 HOH 308 708 70 HOH HOH A . F 6 HOH 309 709 122 HOH HOH A . F 6 HOH 310 710 117 HOH HOH A . F 6 HOH 311 711 90 HOH HOH A . F 6 HOH 312 712 240 HOH HOH A . F 6 HOH 313 713 317 HOH HOH A . F 6 HOH 314 714 93 HOH HOH A . F 6 HOH 315 715 364 HOH HOH A . F 6 HOH 316 716 389 HOH HOH A . F 6 HOH 317 717 236 HOH HOH A . F 6 HOH 318 718 252 HOH HOH A . F 6 HOH 319 719 202 HOH HOH A . F 6 HOH 320 720 352 HOH HOH A . F 6 HOH 321 721 379 HOH HOH A . F 6 HOH 322 722 68 HOH HOH A . F 6 HOH 323 723 356 HOH HOH A . F 6 HOH 324 724 395 HOH HOH A . F 6 HOH 325 725 87 HOH HOH A . F 6 HOH 326 726 231 HOH HOH A . F 6 HOH 327 727 246 HOH HOH A . F 6 HOH 328 728 131 HOH HOH A . F 6 HOH 329 729 298 HOH HOH A . F 6 HOH 330 730 223 HOH HOH A . F 6 HOH 331 731 268 HOH HOH A . F 6 HOH 332 732 359 HOH HOH A . F 6 HOH 333 733 62 HOH HOH A . F 6 HOH 334 734 291 HOH HOH A . F 6 HOH 335 735 348 HOH HOH A . F 6 HOH 336 736 350 HOH HOH A . F 6 HOH 337 737 119 HOH HOH A . F 6 HOH 338 738 394 HOH HOH A . F 6 HOH 339 739 375 HOH HOH A . F 6 HOH 340 740 287 HOH HOH A . F 6 HOH 341 741 29 HOH HOH A . F 6 HOH 342 742 377 HOH HOH A . F 6 HOH 343 743 111 HOH HOH A . F 6 HOH 344 744 141 HOH HOH A . F 6 HOH 345 745 83 HOH HOH A . F 6 HOH 346 746 355 HOH HOH A . F 6 HOH 347 747 302 HOH HOH A . F 6 HOH 348 748 58 HOH HOH A . F 6 HOH 349 749 363 HOH HOH A . F 6 HOH 350 750 358 HOH HOH A . F 6 HOH 351 751 238 HOH HOH A . F 6 HOH 352 752 191 HOH HOH A . F 6 HOH 353 753 56 HOH HOH A . F 6 HOH 354 754 241 HOH HOH A . F 6 HOH 355 755 290 HOH HOH A . F 6 HOH 356 756 158 HOH HOH A . F 6 HOH 357 757 374 HOH HOH A . F 6 HOH 358 758 369 HOH HOH A . F 6 HOH 359 759 307 HOH HOH A . G 6 HOH 1 301 199 HOH HOH P . G 6 HOH 2 302 384 HOH HOH P . G 6 HOH 3 303 324 HOH HOH P . G 6 HOH 4 304 361 HOH HOH P . G 6 HOH 5 305 177 HOH HOH P . G 6 HOH 6 306 304 HOH HOH P . G 6 HOH 7 307 232 HOH HOH P . G 6 HOH 8 308 135 HOH HOH P . G 6 HOH 9 309 12 HOH HOH P . G 6 HOH 10 310 152 HOH HOH P . G 6 HOH 11 311 333 HOH HOH P . G 6 HOH 12 312 293 HOH HOH P . G 6 HOH 13 313 357 HOH HOH P . G 6 HOH 14 314 347 HOH HOH P . G 6 HOH 15 315 368 HOH HOH P . G 6 HOH 16 316 248 HOH HOH P . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk ? ? ? ? ? http://www.mrc-lmb.cam.ac.uk/harry/mosflm/ ? MOSFLM ? ? package . 1 ? 'data scaling' ? ? 'Phil Evans' ? 15/01/18 ? ? ? ? http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ? Aimless ? ? program 0.6.2 2 ? phasing ? ? 'Randy J. Read' cimr-phaser@lists.cam.ac.uk 'Sun Dec 24 01:00:17 2017 (svn 8297) (git 7323, 4bfedeba6... )' ? ? ? ? http://www-structmed.cimr.cam.ac.uk/phaser/ ? PHASER ? ? program 2.8.1 3 ? refinement ? ? 'Paul D. Adams' PDAdams@lbl.gov ? ? ? ? C++ http://www.phenix-online.org/ ? PHENIX ? ? package . 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Sep. 1, 2017' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.24 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6G8J _cell.details ? _cell.formula_units_Z ? _cell.length_a 82.149 _cell.length_a_esd ? _cell.length_b 112.019 _cell.length_b_esd ? _cell.length_c 62.680 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6G8J _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6G8J _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.60 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.095 M HEPES, pH 7.1, 29% PEG 400, 0.19 M CaCl2, 5% glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-07-18 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0332 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, DESY BEAMLINE P11' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0332 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline P11 _diffrn_source.pdbx_synchrotron_site 'PETRA III, DESY' # _reflns.B_iso_Wilson_estimate 15.790 _reflns.entry_id 6G8J _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.470 _reflns.d_resolution_low 66.240 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 48301 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.300 _reflns.pdbx_Rmerge_I_obs 0.099 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 484 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.104 _reflns.pdbx_Rpim_I_all 0.029 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 594758 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.994 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.470 1.500 ? ? 25334 ? ? ? 2286 94.400 ? ? ? ? 0.966 ? ? ? ? ? ? ? ? 11.100 ? ? ? 2.400 1.013 0.298 ? 1 1 0.627 ? 8.050 66.240 ? ? 4284 ? ? ? 355 99.800 ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 12.100 ? ? ? 37.500 0.056 0.016 ? 2 1 0.972 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 104.400 _refine.B_iso_mean 23.0596 _refine.B_iso_min 5.750 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6G8J _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.4700 _refine.ls_d_res_low 56.0090 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 48296 _refine.ls_number_reflns_R_free 1214 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.5800 _refine.ls_percent_reflns_R_free 2.5100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1592 _refine.ls_R_factor_R_free 0.1726 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1589 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3mhr _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 17.3100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.4700 _refine_hist.d_res_low 56.0090 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 375 _refine_hist.number_atoms_total 2279 _refine_hist.pdbx_number_residues_total 241 _refine_hist.pdbx_B_iso_mean_ligand 37.04 _refine_hist.pdbx_B_iso_mean_solvent 36.23 _refine_hist.pdbx_number_atoms_protein 1895 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.4700 1.5289 5160 . 139 5021 95.0000 . . . 0.2709 0.0000 0.2354 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 1.5289 1.5985 5245 . 116 5129 97.0000 . . . 0.2158 0.0000 0.2012 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 1.5985 1.6827 5257 . 140 5117 97.0000 . . . 0.2090 0.0000 0.1801 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 1.6827 1.7882 5315 . 142 5173 97.0000 . . . 0.1988 0.0000 0.1703 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 1.7882 1.9263 5326 . 129 5197 98.0000 . . . 0.1828 0.0000 0.1624 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 1.9263 2.1201 5375 . 124 5251 98.0000 . . . 0.1590 0.0000 0.1528 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.1201 2.4269 5411 . 136 5275 98.0000 . . . 0.1561 0.0000 0.1379 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.4269 3.0576 5499 . 144 5355 99.0000 . . . 0.1652 0.0000 0.1505 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 3.0576 56.0502 5708 . 144 5564 100.0000 . . . 0.1622 0.0000 0.1562 . . . . . . 9 . . . # _struct.entry_id 6G8J _struct.title '14-3-3sigma in complex with a A130beta3A mutated YAP pS127 phosphopeptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6G8J _struct_keywords.text 'beta amino acid, hippo pathway, YAP/TAZ, ONCOPROTEIN' _struct_keywords.pdbx_keywords ONCOPROTEIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? G N N 6 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP 1433S_HUMAN P31947 ? 1 ;MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPE VREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKK EMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; 1 2 PDB 6G8J 6G8J ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6G8J A 6 ? 236 ? P31947 1 ? 231 ? 1 231 2 2 6G8J P 1 ? 11 ? 6G8J 123 ? 133 ? 123 133 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6G8J GLY A 1 ? UNP P31947 ? ? 'expression tag' -4 1 1 6G8J ALA A 2 ? UNP P31947 ? ? 'expression tag' -3 2 1 6G8J MET A 3 ? UNP P31947 ? ? 'expression tag' -2 3 1 6G8J GLY A 4 ? UNP P31947 ? ? 'expression tag' -1 4 1 6G8J SER A 5 ? UNP P31947 ? ? 'expression tag' 0 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4950 ? 1 MORE -79 ? 1 'SSA (A^2)' 23640 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 7 ? ALA A 21 ? GLU A 2 ALA A 16 1 ? 15 HELX_P HELX_P2 AA2 ARG A 23 ? GLU A 36 ? ARG A 18 GLU A 31 1 ? 14 HELX_P HELX_P3 AA3 SER A 42 ? ASN A 75 ? SER A 37 ASN A 70 1 ? 34 HELX_P HELX_P4 AA4 PRO A 84 ? SER A 110 ? PRO A 79 SER A 105 1 ? 27 HELX_P HELX_P5 AA5 ASP A 118 ? ALA A 140 ? ASP A 113 ALA A 135 1 ? 23 HELX_P HELX_P6 AA6 ASP A 144 ? MET A 167 ? ASP A 139 MET A 162 1 ? 24 HELX_P HELX_P7 AA7 ASN A 171 ? ILE A 188 ? ASN A 166 ILE A 183 1 ? 18 HELX_P HELX_P8 AA8 SER A 191 ? ALA A 208 ? SER A 186 ALA A 203 1 ? 18 HELX_P HELX_P9 AA9 ASP A 209 ? LEU A 213 ? ASP A 204 LEU A 208 5 ? 5 HELX_P HELX_P10 AB1 SER A 214 ? THR A 236 ? SER A 209 THR A 231 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B HIS 4 C A ? ? 1_555 B SEP 5 N ? ? P HIS 126 P SEP 127 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? B HIS 4 C B ? ? 1_555 B SEP 5 N ? ? P HIS 126 P SEP 127 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale3 covale both ? B SEP 5 C ? ? ? 1_555 B SER 6 N ? ? P SEP 127 P SER 128 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale4 covale both ? B PRO 7 C ? ? ? 1_555 B B3A 8 N ? ? P PRO 129 P B3A 130 1_555 ? ? ? ? ? ? ? 1.430 ? ? metalc1 metalc ? ? A GLN 13 OE1 A ? ? 1_555 E NA . NA ? ? A GLN 8 A NA 303 1_555 ? ? ? ? ? ? ? 2.731 ? ? metalc2 metalc ? ? A GLN 13 OE1 B ? ? 1_555 E NA . NA ? ? A GLN 8 A NA 303 1_555 ? ? ? ? ? ? ? 2.688 ? ? metalc3 metalc ? ? A GLU 80 OE2 ? ? ? 1_555 D MG . MG ? ? A GLU 75 A MG 302 1_555 ? ? ? ? ? ? ? 2.324 ? ? metalc4 metalc ? ? A LYS 82 O ? ? ? 1_555 E NA . NA ? ? A LYS 77 A NA 303 4_555 ? ? ? ? ? ? ? 2.318 ? ? metalc5 metalc ? ? A GLU 85 OE1 ? ? ? 1_555 E NA . NA ? ? A GLU 80 A NA 303 4_555 ? ? ? ? ? ? ? 2.422 ? ? metalc6 metalc ? ? A GLU 85 OE2 ? ? ? 1_555 E NA . NA ? ? A GLU 80 A NA 303 4_555 ? ? ? ? ? ? ? 2.840 ? ? metalc7 metalc ? ? A GLU 166 O ? ? ? 1_555 D MG . MG ? ? A GLU 161 A MG 302 7_544 ? ? ? ? ? ? ? 2.305 ? ? metalc8 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 479 7_554 ? ? ? ? ? ? ? 2.490 ? ? metalc9 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 493 1_555 ? ? ? ? ? ? ? 2.383 ? ? metalc10 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 619 7_554 ? ? ? ? ? ? ? 2.453 ? ? metalc11 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 675 4_554 ? ? ? ? ? ? ? 2.228 ? ? metalc12 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 303 A HOH 465 4_555 ? ? ? ? ? ? ? 2.855 ? ? metalc13 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 303 A HOH 622 4_555 ? ? ? ? ? ? ? 2.463 ? ? metalc14 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 303 A HOH 625 1_555 ? ? ? ? ? ? ? 2.600 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 A A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 OE1 B A GLN 13 ? A GLN 8 ? 1_555 20.2 ? 2 OE1 A A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? A LYS 82 ? A LYS 77 ? 1_555 31.9 ? 3 OE1 B A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? A LYS 82 ? A LYS 77 ? 1_555 28.7 ? 4 OE1 A A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 34.0 ? 5 OE1 B A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 29.9 ? 6 O ? A LYS 82 ? A LYS 77 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 2.1 ? 7 OE1 A A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 OE2 ? A GLU 85 ? A GLU 80 ? 1_555 36.3 ? 8 OE1 B A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 OE2 ? A GLU 85 ? A GLU 80 ? 1_555 32.4 ? 9 O ? A LYS 82 ? A LYS 77 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 OE2 ? A GLU 85 ? A GLU 80 ? 1_555 4.4 ? 10 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 OE2 ? A GLU 85 ? A GLU 80 ? 1_555 2.5 ? 11 OE1 A A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 465 ? 4_555 137.1 ? 12 OE1 B A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 465 ? 4_555 121.9 ? 13 O ? A LYS 82 ? A LYS 77 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 465 ? 4_555 106.0 ? 14 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 465 ? 4_555 103.9 ? 15 OE2 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 465 ? 4_555 101.8 ? 16 OE1 A A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 622 ? 4_555 151.4 ? 17 OE1 B A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 622 ? 4_555 154.2 ? 18 O ? A LYS 82 ? A LYS 77 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 622 ? 4_555 176.6 ? 19 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 622 ? 4_555 174.6 ? 20 OE2 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 622 ? 4_555 172.2 ? 21 O ? F HOH . ? A HOH 465 ? 4_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 622 ? 4_555 70.9 ? 22 OE1 A A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 625 ? 1_555 95.9 ? 23 OE1 B A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 625 ? 1_555 77.7 ? 24 O ? A LYS 82 ? A LYS 77 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 625 ? 1_555 94.8 ? 25 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 625 ? 1_555 94.1 ? 26 OE2 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 625 ? 1_555 94.9 ? 27 O ? F HOH . ? A HOH 465 ? 4_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 625 ? 1_555 74.5 ? 28 O ? F HOH . ? A HOH 622 ? 4_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 625 ? 1_555 85.7 ? 29 OE2 ? A GLU 80 ? A GLU 75 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? A GLU 166 ? A GLU 161 ? 1_555 77.3 ? 30 OE2 ? A GLU 80 ? A GLU 75 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 479 ? 7_554 91.3 ? 31 O ? A GLU 166 ? A GLU 161 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 479 ? 7_554 162.3 ? 32 OE2 ? A GLU 80 ? A GLU 75 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 493 ? 1_555 102.3 ? 33 O ? A GLU 166 ? A GLU 161 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 493 ? 1_555 26.9 ? 34 O ? F HOH . ? A HOH 479 ? 7_554 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 493 ? 1_555 152.8 ? 35 OE2 ? A GLU 80 ? A GLU 75 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 619 ? 7_554 155.5 ? 36 O ? A GLU 166 ? A GLU 161 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 619 ? 7_554 101.9 ? 37 O ? F HOH . ? A HOH 479 ? 7_554 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 619 ? 7_554 82.8 ? 38 O ? F HOH . ? A HOH 493 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 619 ? 7_554 75.0 ? 39 OE2 ? A GLU 80 ? A GLU 75 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 675 ? 4_554 124.3 ? 40 O ? A GLU 166 ? A GLU 161 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 675 ? 4_554 120.6 ? 41 O ? F HOH . ? A HOH 479 ? 7_554 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 675 ? 4_554 76.9 ? 42 O ? F HOH . ? A HOH 493 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 675 ? 4_554 112.6 ? 43 O ? F HOH . ? A HOH 619 ? 7_554 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 675 ? 4_554 77.6 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 110 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 105 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 HIS _struct_mon_prot_cis.pdbx_label_seq_id_2 111 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 HIS _struct_mon_prot_cis.pdbx_auth_seq_id_2 106 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.54 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 301 ? 3 'binding site for residue CL A 301' AC2 Software A MG 302 ? 6 'binding site for residue MG A 302' AC3 Software A NA 303 ? 6 'binding site for residue NA A 303' AC4 Software P B3A 130 ? 6 'binding site for residue B3A P 130' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 LYS A 14 ? LYS A 9 . ? 4_555 ? 2 AC1 3 HOH F . ? HOH A 655 . ? 1_555 ? 3 AC1 3 HOH F . ? HOH A 708 . ? 1_555 ? 4 AC2 6 GLU A 80 ? GLU A 75 . ? 1_555 ? 5 AC2 6 GLU A 166 ? GLU A 161 . ? 7_554 ? 6 AC2 6 HOH F . ? HOH A 479 . ? 7_554 ? 7 AC2 6 HOH F . ? HOH A 493 . ? 1_555 ? 8 AC2 6 HOH F . ? HOH A 619 . ? 7_554 ? 9 AC2 6 HOH F . ? HOH A 675 . ? 4_554 ? 10 AC3 6 GLN A 13 ? GLN A 8 . ? 1_555 ? 11 AC3 6 LYS A 82 ? LYS A 77 . ? 4_555 ? 12 AC3 6 GLU A 85 ? GLU A 80 . ? 4_555 ? 13 AC3 6 HOH F . ? HOH A 465 . ? 4_555 ? 14 AC3 6 HOH F . ? HOH A 622 . ? 4_555 ? 15 AC3 6 HOH F . ? HOH A 625 . ? 1_555 ? 16 AC4 6 ASN A 47 ? ASN A 42 . ? 1_555 ? 17 AC4 6 SER A 50 ? SER A 45 . ? 1_555 ? 18 AC4 6 VAL A 51 ? VAL A 46 . ? 1_555 ? 19 AC4 6 LYS A 54 ? LYS A 49 . ? 1_555 ? 20 AC4 6 PRO B 7 ? PRO P 129 . ? 1_555 ? 21 AC4 6 HOH G . ? HOH P 303 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG A SER 0 ? ? O A HOH 404 ? ? 1.59 2 1 O A HOH 404 ? ? O A HOH 601 ? ? 1.94 3 1 O A HOH 677 ? ? O A HOH 690 ? ? 1.96 4 1 O A HOH 747 ? ? O A HOH 749 ? ? 2.01 5 1 O A HOH 729 ? ? O A HOH 749 ? ? 2.02 6 1 O A HOH 582 ? ? O A HOH 643 ? ? 2.02 7 1 O A HOH 460 ? ? O A HOH 724 ? ? 2.03 8 1 OE2 A GLU 91 ? A O A HOH 401 ? ? 2.03 9 1 O A HOH 562 ? ? O A HOH 658 ? ? 2.03 10 1 O A HOH 527 ? ? O A HOH 734 ? ? 2.05 11 1 O A HOH 634 ? ? O A HOH 685 ? ? 2.05 12 1 O A HOH 408 ? ? O A HOH 661 ? ? 2.05 13 1 O A HOH 596 ? ? O A HOH 659 ? ? 2.05 14 1 O A HOH 614 ? ? O A HOH 746 ? ? 2.05 15 1 O A HOH 415 ? ? O A HOH 441 ? ? 2.05 16 1 O A HOH 533 ? ? O A HOH 649 ? ? 2.06 17 1 O A HOH 685 ? ? O A HOH 736 ? ? 2.08 18 1 O A HOH 675 ? ? O A HOH 700 ? ? 2.10 19 1 O A HOH 667 ? ? O P HOH 304 ? ? 2.11 20 1 O A HOH 630 ? ? O A HOH 654 ? ? 2.11 21 1 O A HOH 608 ? ? O A HOH 735 ? ? 2.11 22 1 OG A SER 69 ? B O A HOH 402 ? ? 2.16 23 1 O A HOH 546 ? ? O A HOH 633 ? ? 2.17 24 1 O A HOH 464 ? ? O A HOH 583 ? ? 2.17 25 1 O P HOH 303 ? ? O P HOH 314 ? ? 2.18 26 1 O A HOH 426 ? ? O A HOH 613 ? ? 2.18 27 1 O A HOH 420 ? ? O A HOH 588 ? ? 2.18 28 1 O A HOH 544 ? ? O A HOH 605 ? ? 2.19 29 1 O A GLY 137 ? ? O A HOH 403 ? ? 2.19 30 1 O A ALA -3 ? ? O A HOH 404 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 721 ? ? 1_555 O A HOH 742 ? ? 6_545 2.05 2 1 O A HOH 729 ? ? 1_555 O A HOH 756 ? ? 4_555 2.12 3 1 O A HOH 671 ? ? 1_555 O A HOH 734 ? ? 6_544 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 18 ? ? -105.27 76.38 2 1 HIS A 106 ? ? -145.78 38.93 3 1 THR A 136 ? ? -143.13 -10.55 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 417 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_phasing_MR.entry_id 6G8J _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 5.300 _pdbx_phasing_MR.d_res_low_rotation 56.010 _pdbx_phasing_MR.d_res_high_translation 5.300 _pdbx_phasing_MR.d_res_low_translation 56.010 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 759 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 5.97 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 P ACE 123 ? B ACE 1 2 1 Y 1 P ARG 124 ? B ARG 2 3 1 Y 1 P SER 131 ? B SER 9 4 1 Y 1 P LEU 132 ? B LEU 10 5 1 Y 1 P GLN 133 ? B GLN 11 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 B3A CG C N N 81 B3A CA C N S 82 B3A N N N N 83 B3A CB C N N 84 B3A C C N N 85 B3A O O N N 86 B3A OXT O N N 87 B3A HG1 H N N 88 B3A HG2 H N N 89 B3A HG3 H N N 90 B3A HA H N N 91 B3A H H N N 92 B3A H2 H N N 93 B3A HB1 H N N 94 B3A HB2 H N N 95 B3A HXT H N N 96 CL CL CL N N 97 CYS N N N N 98 CYS CA C N R 99 CYS C C N N 100 CYS O O N N 101 CYS CB C N N 102 CYS SG S N N 103 CYS OXT O N N 104 CYS H H N N 105 CYS H2 H N N 106 CYS HA H N N 107 CYS HB2 H N N 108 CYS HB3 H N N 109 CYS HG H N N 110 CYS HXT H N N 111 GLN N N N N 112 GLN CA C N S 113 GLN C C N N 114 GLN O O N N 115 GLN CB C N N 116 GLN CG C N N 117 GLN CD C N N 118 GLN OE1 O N N 119 GLN NE2 N N N 120 GLN OXT O N N 121 GLN H H N N 122 GLN H2 H N N 123 GLN HA H N N 124 GLN HB2 H N N 125 GLN HB3 H N N 126 GLN HG2 H N N 127 GLN HG3 H N N 128 GLN HE21 H N N 129 GLN HE22 H N N 130 GLN HXT H N N 131 GLU N N N N 132 GLU CA C N S 133 GLU C C N N 134 GLU O O N N 135 GLU CB C N N 136 GLU CG C N N 137 GLU CD C N N 138 GLU OE1 O N N 139 GLU OE2 O N N 140 GLU OXT O N N 141 GLU H H N N 142 GLU H2 H N N 143 GLU HA H N N 144 GLU HB2 H N N 145 GLU HB3 H N N 146 GLU HG2 H N N 147 GLU HG3 H N N 148 GLU HE2 H N N 149 GLU HXT H N N 150 GLY N N N N 151 GLY CA C N N 152 GLY C C N N 153 GLY O O N N 154 GLY OXT O N N 155 GLY H H N N 156 GLY H2 H N N 157 GLY HA2 H N N 158 GLY HA3 H N N 159 GLY HXT H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 HOH O O N N 182 HOH H1 H N N 183 HOH H2 H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MET N N N N 254 MET CA C N S 255 MET C C N N 256 MET O O N N 257 MET CB C N N 258 MET CG C N N 259 MET SD S N N 260 MET CE C N N 261 MET OXT O N N 262 MET H H N N 263 MET H2 H N N 264 MET HA H N N 265 MET HB2 H N N 266 MET HB3 H N N 267 MET HG2 H N N 268 MET HG3 H N N 269 MET HE1 H N N 270 MET HE2 H N N 271 MET HE3 H N N 272 MET HXT H N N 273 MG MG MG N N 274 NA NA NA N N 275 PHE N N N N 276 PHE CA C N S 277 PHE C C N N 278 PHE O O N N 279 PHE CB C N N 280 PHE CG C Y N 281 PHE CD1 C Y N 282 PHE CD2 C Y N 283 PHE CE1 C Y N 284 PHE CE2 C Y N 285 PHE CZ C Y N 286 PHE OXT O N N 287 PHE H H N N 288 PHE H2 H N N 289 PHE HA H N N 290 PHE HB2 H N N 291 PHE HB3 H N N 292 PHE HD1 H N N 293 PHE HD2 H N N 294 PHE HE1 H N N 295 PHE HE2 H N N 296 PHE HZ H N N 297 PHE HXT H N N 298 PRO N N N N 299 PRO CA C N S 300 PRO C C N N 301 PRO O O N N 302 PRO CB C N N 303 PRO CG C N N 304 PRO CD C N N 305 PRO OXT O N N 306 PRO H H N N 307 PRO HA H N N 308 PRO HB2 H N N 309 PRO HB3 H N N 310 PRO HG2 H N N 311 PRO HG3 H N N 312 PRO HD2 H N N 313 PRO HD3 H N N 314 PRO HXT H N N 315 SEP N N N N 316 SEP CA C N S 317 SEP CB C N N 318 SEP OG O N N 319 SEP C C N N 320 SEP O O N N 321 SEP OXT O N N 322 SEP P P N N 323 SEP O1P O N N 324 SEP O2P O N N 325 SEP O3P O N N 326 SEP H H N N 327 SEP H2 H N N 328 SEP HA H N N 329 SEP HB2 H N N 330 SEP HB3 H N N 331 SEP HXT H N N 332 SEP HOP2 H N N 333 SEP HOP3 H N N 334 SER N N N N 335 SER CA C N S 336 SER C C N N 337 SER O O N N 338 SER CB C N N 339 SER OG O N N 340 SER OXT O N N 341 SER H H N N 342 SER H2 H N N 343 SER HA H N N 344 SER HB2 H N N 345 SER HB3 H N N 346 SER HG H N N 347 SER HXT H N N 348 THR N N N N 349 THR CA C N S 350 THR C C N N 351 THR O O N N 352 THR CB C N R 353 THR OG1 O N N 354 THR CG2 C N N 355 THR OXT O N N 356 THR H H N N 357 THR H2 H N N 358 THR HA H N N 359 THR HB H N N 360 THR HG1 H N N 361 THR HG21 H N N 362 THR HG22 H N N 363 THR HG23 H N N 364 THR HXT H N N 365 TRP N N N N 366 TRP CA C N S 367 TRP C C N N 368 TRP O O N N 369 TRP CB C N N 370 TRP CG C Y N 371 TRP CD1 C Y N 372 TRP CD2 C Y N 373 TRP NE1 N Y N 374 TRP CE2 C Y N 375 TRP CE3 C Y N 376 TRP CZ2 C Y N 377 TRP CZ3 C Y N 378 TRP CH2 C Y N 379 TRP OXT O N N 380 TRP H H N N 381 TRP H2 H N N 382 TRP HA H N N 383 TRP HB2 H N N 384 TRP HB3 H N N 385 TRP HD1 H N N 386 TRP HE1 H N N 387 TRP HE3 H N N 388 TRP HZ2 H N N 389 TRP HZ3 H N N 390 TRP HH2 H N N 391 TRP HXT H N N 392 TYR N N N N 393 TYR CA C N S 394 TYR C C N N 395 TYR O O N N 396 TYR CB C N N 397 TYR CG C Y N 398 TYR CD1 C Y N 399 TYR CD2 C Y N 400 TYR CE1 C Y N 401 TYR CE2 C Y N 402 TYR CZ C Y N 403 TYR OH O N N 404 TYR OXT O N N 405 TYR H H N N 406 TYR H2 H N N 407 TYR HA H N N 408 TYR HB2 H N N 409 TYR HB3 H N N 410 TYR HD1 H N N 411 TYR HD2 H N N 412 TYR HE1 H N N 413 TYR HE2 H N N 414 TYR HH H N N 415 TYR HXT H N N 416 VAL N N N N 417 VAL CA C N S 418 VAL C C N N 419 VAL O O N N 420 VAL CB C N N 421 VAL CG1 C N N 422 VAL CG2 C N N 423 VAL OXT O N N 424 VAL H H N N 425 VAL H2 H N N 426 VAL HA H N N 427 VAL HB H N N 428 VAL HG11 H N N 429 VAL HG12 H N N 430 VAL HG13 H N N 431 VAL HG21 H N N 432 VAL HG22 H N N 433 VAL HG23 H N N 434 VAL HXT H N N 435 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 B3A CG CA sing N N 76 B3A CG HG1 sing N N 77 B3A CG HG2 sing N N 78 B3A CG HG3 sing N N 79 B3A CA N sing N N 80 B3A CA CB sing N N 81 B3A CA HA sing N N 82 B3A N H sing N N 83 B3A N H2 sing N N 84 B3A CB C sing N N 85 B3A CB HB1 sing N N 86 B3A CB HB2 sing N N 87 B3A C OXT sing N N 88 B3A C O doub N N 89 B3A OXT HXT sing N N 90 CYS N CA sing N N 91 CYS N H sing N N 92 CYS N H2 sing N N 93 CYS CA C sing N N 94 CYS CA CB sing N N 95 CYS CA HA sing N N 96 CYS C O doub N N 97 CYS C OXT sing N N 98 CYS CB SG sing N N 99 CYS CB HB2 sing N N 100 CYS CB HB3 sing N N 101 CYS SG HG sing N N 102 CYS OXT HXT sing N N 103 GLN N CA sing N N 104 GLN N H sing N N 105 GLN N H2 sing N N 106 GLN CA C sing N N 107 GLN CA CB sing N N 108 GLN CA HA sing N N 109 GLN C O doub N N 110 GLN C OXT sing N N 111 GLN CB CG sing N N 112 GLN CB HB2 sing N N 113 GLN CB HB3 sing N N 114 GLN CG CD sing N N 115 GLN CG HG2 sing N N 116 GLN CG HG3 sing N N 117 GLN CD OE1 doub N N 118 GLN CD NE2 sing N N 119 GLN NE2 HE21 sing N N 120 GLN NE2 HE22 sing N N 121 GLN OXT HXT sing N N 122 GLU N CA sing N N 123 GLU N H sing N N 124 GLU N H2 sing N N 125 GLU CA C sing N N 126 GLU CA CB sing N N 127 GLU CA HA sing N N 128 GLU C O doub N N 129 GLU C OXT sing N N 130 GLU CB CG sing N N 131 GLU CB HB2 sing N N 132 GLU CB HB3 sing N N 133 GLU CG CD sing N N 134 GLU CG HG2 sing N N 135 GLU CG HG3 sing N N 136 GLU CD OE1 doub N N 137 GLU CD OE2 sing N N 138 GLU OE2 HE2 sing N N 139 GLU OXT HXT sing N N 140 GLY N CA sing N N 141 GLY N H sing N N 142 GLY N H2 sing N N 143 GLY CA C sing N N 144 GLY CA HA2 sing N N 145 GLY CA HA3 sing N N 146 GLY C O doub N N 147 GLY C OXT sing N N 148 GLY OXT HXT sing N N 149 HIS N CA sing N N 150 HIS N H sing N N 151 HIS N H2 sing N N 152 HIS CA C sing N N 153 HIS CA CB sing N N 154 HIS CA HA sing N N 155 HIS C O doub N N 156 HIS C OXT sing N N 157 HIS CB CG sing N N 158 HIS CB HB2 sing N N 159 HIS CB HB3 sing N N 160 HIS CG ND1 sing Y N 161 HIS CG CD2 doub Y N 162 HIS ND1 CE1 doub Y N 163 HIS ND1 HD1 sing N N 164 HIS CD2 NE2 sing Y N 165 HIS CD2 HD2 sing N N 166 HIS CE1 NE2 sing Y N 167 HIS CE1 HE1 sing N N 168 HIS NE2 HE2 sing N N 169 HIS OXT HXT sing N N 170 HOH O H1 sing N N 171 HOH O H2 sing N N 172 ILE N CA sing N N 173 ILE N H sing N N 174 ILE N H2 sing N N 175 ILE CA C sing N N 176 ILE CA CB sing N N 177 ILE CA HA sing N N 178 ILE C O doub N N 179 ILE C OXT sing N N 180 ILE CB CG1 sing N N 181 ILE CB CG2 sing N N 182 ILE CB HB sing N N 183 ILE CG1 CD1 sing N N 184 ILE CG1 HG12 sing N N 185 ILE CG1 HG13 sing N N 186 ILE CG2 HG21 sing N N 187 ILE CG2 HG22 sing N N 188 ILE CG2 HG23 sing N N 189 ILE CD1 HD11 sing N N 190 ILE CD1 HD12 sing N N 191 ILE CD1 HD13 sing N N 192 ILE OXT HXT sing N N 193 LEU N CA sing N N 194 LEU N H sing N N 195 LEU N H2 sing N N 196 LEU CA C sing N N 197 LEU CA CB sing N N 198 LEU CA HA sing N N 199 LEU C O doub N N 200 LEU C OXT sing N N 201 LEU CB CG sing N N 202 LEU CB HB2 sing N N 203 LEU CB HB3 sing N N 204 LEU CG CD1 sing N N 205 LEU CG CD2 sing N N 206 LEU CG HG sing N N 207 LEU CD1 HD11 sing N N 208 LEU CD1 HD12 sing N N 209 LEU CD1 HD13 sing N N 210 LEU CD2 HD21 sing N N 211 LEU CD2 HD22 sing N N 212 LEU CD2 HD23 sing N N 213 LEU OXT HXT sing N N 214 LYS N CA sing N N 215 LYS N H sing N N 216 LYS N H2 sing N N 217 LYS CA C sing N N 218 LYS CA CB sing N N 219 LYS CA HA sing N N 220 LYS C O doub N N 221 LYS C OXT sing N N 222 LYS CB CG sing N N 223 LYS CB HB2 sing N N 224 LYS CB HB3 sing N N 225 LYS CG CD sing N N 226 LYS CG HG2 sing N N 227 LYS CG HG3 sing N N 228 LYS CD CE sing N N 229 LYS CD HD2 sing N N 230 LYS CD HD3 sing N N 231 LYS CE NZ sing N N 232 LYS CE HE2 sing N N 233 LYS CE HE3 sing N N 234 LYS NZ HZ1 sing N N 235 LYS NZ HZ2 sing N N 236 LYS NZ HZ3 sing N N 237 LYS OXT HXT sing N N 238 MET N CA sing N N 239 MET N H sing N N 240 MET N H2 sing N N 241 MET CA C sing N N 242 MET CA CB sing N N 243 MET CA HA sing N N 244 MET C O doub N N 245 MET C OXT sing N N 246 MET CB CG sing N N 247 MET CB HB2 sing N N 248 MET CB HB3 sing N N 249 MET CG SD sing N N 250 MET CG HG2 sing N N 251 MET CG HG3 sing N N 252 MET SD CE sing N N 253 MET CE HE1 sing N N 254 MET CE HE2 sing N N 255 MET CE HE3 sing N N 256 MET OXT HXT sing N N 257 PHE N CA sing N N 258 PHE N H sing N N 259 PHE N H2 sing N N 260 PHE CA C sing N N 261 PHE CA CB sing N N 262 PHE CA HA sing N N 263 PHE C O doub N N 264 PHE C OXT sing N N 265 PHE CB CG sing N N 266 PHE CB HB2 sing N N 267 PHE CB HB3 sing N N 268 PHE CG CD1 doub Y N 269 PHE CG CD2 sing Y N 270 PHE CD1 CE1 sing Y N 271 PHE CD1 HD1 sing N N 272 PHE CD2 CE2 doub Y N 273 PHE CD2 HD2 sing N N 274 PHE CE1 CZ doub Y N 275 PHE CE1 HE1 sing N N 276 PHE CE2 CZ sing Y N 277 PHE CE2 HE2 sing N N 278 PHE CZ HZ sing N N 279 PHE OXT HXT sing N N 280 PRO N CA sing N N 281 PRO N CD sing N N 282 PRO N H sing N N 283 PRO CA C sing N N 284 PRO CA CB sing N N 285 PRO CA HA sing N N 286 PRO C O doub N N 287 PRO C OXT sing N N 288 PRO CB CG sing N N 289 PRO CB HB2 sing N N 290 PRO CB HB3 sing N N 291 PRO CG CD sing N N 292 PRO CG HG2 sing N N 293 PRO CG HG3 sing N N 294 PRO CD HD2 sing N N 295 PRO CD HD3 sing N N 296 PRO OXT HXT sing N N 297 SEP N CA sing N N 298 SEP N H sing N N 299 SEP N H2 sing N N 300 SEP CA CB sing N N 301 SEP CA C sing N N 302 SEP CA HA sing N N 303 SEP CB OG sing N N 304 SEP CB HB2 sing N N 305 SEP CB HB3 sing N N 306 SEP OG P sing N N 307 SEP C O doub N N 308 SEP C OXT sing N N 309 SEP OXT HXT sing N N 310 SEP P O1P doub N N 311 SEP P O2P sing N N 312 SEP P O3P sing N N 313 SEP O2P HOP2 sing N N 314 SEP O3P HOP3 sing N N 315 SER N CA sing N N 316 SER N H sing N N 317 SER N H2 sing N N 318 SER CA C sing N N 319 SER CA CB sing N N 320 SER CA HA sing N N 321 SER C O doub N N 322 SER C OXT sing N N 323 SER CB OG sing N N 324 SER CB HB2 sing N N 325 SER CB HB3 sing N N 326 SER OG HG sing N N 327 SER OXT HXT sing N N 328 THR N CA sing N N 329 THR N H sing N N 330 THR N H2 sing N N 331 THR CA C sing N N 332 THR CA CB sing N N 333 THR CA HA sing N N 334 THR C O doub N N 335 THR C OXT sing N N 336 THR CB OG1 sing N N 337 THR CB CG2 sing N N 338 THR CB HB sing N N 339 THR OG1 HG1 sing N N 340 THR CG2 HG21 sing N N 341 THR CG2 HG22 sing N N 342 THR CG2 HG23 sing N N 343 THR OXT HXT sing N N 344 TRP N CA sing N N 345 TRP N H sing N N 346 TRP N H2 sing N N 347 TRP CA C sing N N 348 TRP CA CB sing N N 349 TRP CA HA sing N N 350 TRP C O doub N N 351 TRP C OXT sing N N 352 TRP CB CG sing N N 353 TRP CB HB2 sing N N 354 TRP CB HB3 sing N N 355 TRP CG CD1 doub Y N 356 TRP CG CD2 sing Y N 357 TRP CD1 NE1 sing Y N 358 TRP CD1 HD1 sing N N 359 TRP CD2 CE2 doub Y N 360 TRP CD2 CE3 sing Y N 361 TRP NE1 CE2 sing Y N 362 TRP NE1 HE1 sing N N 363 TRP CE2 CZ2 sing Y N 364 TRP CE3 CZ3 doub Y N 365 TRP CE3 HE3 sing N N 366 TRP CZ2 CH2 doub Y N 367 TRP CZ2 HZ2 sing N N 368 TRP CZ3 CH2 sing Y N 369 TRP CZ3 HZ3 sing N N 370 TRP CH2 HH2 sing N N 371 TRP OXT HXT sing N N 372 TYR N CA sing N N 373 TYR N H sing N N 374 TYR N H2 sing N N 375 TYR CA C sing N N 376 TYR CA CB sing N N 377 TYR CA HA sing N N 378 TYR C O doub N N 379 TYR C OXT sing N N 380 TYR CB CG sing N N 381 TYR CB HB2 sing N N 382 TYR CB HB3 sing N N 383 TYR CG CD1 doub Y N 384 TYR CG CD2 sing Y N 385 TYR CD1 CE1 sing Y N 386 TYR CD1 HD1 sing N N 387 TYR CD2 CE2 doub Y N 388 TYR CD2 HD2 sing N N 389 TYR CE1 CZ doub Y N 390 TYR CE1 HE1 sing N N 391 TYR CE2 CZ sing Y N 392 TYR CE2 HE2 sing N N 393 TYR CZ OH sing N N 394 TYR OH HH sing N N 395 TYR OXT HXT sing N N 396 VAL N CA sing N N 397 VAL N H sing N N 398 VAL N H2 sing N N 399 VAL CA C sing N N 400 VAL CA CB sing N N 401 VAL CA HA sing N N 402 VAL C O doub N N 403 VAL C OXT sing N N 404 VAL CB CG1 sing N N 405 VAL CB CG2 sing N N 406 VAL CB HB sing N N 407 VAL CG1 HG11 sing N N 408 VAL CG1 HG12 sing N N 409 VAL CG1 HG13 sing N N 410 VAL CG2 HG21 sing N N 411 VAL CG2 HG22 sing N N 412 VAL CG2 HG23 sing N N 413 VAL OXT HXT sing N N 414 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Netherlands Organisation for Scientific Research' Netherlands 'ECHO-STIP 717.014.001' 1 'Netherlands Organisation for Scientific Research' Netherlands 'Gravity program 024.001.035' 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id B3A _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id B3A _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3MHR _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6G8J _atom_sites.fract_transf_matrix[1][1] 0.012173 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008927 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015954 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL H MG N NA O P S # loop_