data_6G8L # _entry.id 6G8L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6G8L pdb_00006g8l 10.2210/pdb6g8l/pdb WWPDB D_1200009580 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-04-17 2 'Structure model' 1 1 2019-12-04 3 'Structure model' 1 2 2019-12-18 4 'Structure model' 2 0 2023-11-15 5 'Structure model' 2 1 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' atom_site 6 4 'Structure model' atom_site_anisotrop 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' database_2 10 4 'Structure model' pdbx_struct_conn_angle 11 4 'Structure model' pdbx_validate_main_chain_plane 12 4 'Structure model' pdbx_validate_peptide_omega 13 4 'Structure model' pdbx_validate_rmsd_angle 14 4 'Structure model' pdbx_validate_torsion 15 4 'Structure model' struct_conn 16 4 'Structure model' struct_conn_type 17 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_citation_author.identifier_ORCID' 10 2 'Structure model' '_citation_author.name' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.page_last' 14 3 'Structure model' '_citation_author.identifier_ORCID' 15 4 'Structure model' '_atom_site.auth_atom_id' 16 4 'Structure model' '_atom_site.label_atom_id' 17 4 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 18 4 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' 19 4 'Structure model' '_database_2.pdbx_DOI' 20 4 'Structure model' '_database_2.pdbx_database_accession' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_alt_id' 24 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 25 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 29 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 30 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 31 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 32 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 33 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 34 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 35 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 36 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 37 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_alt_id' 38 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 39 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 40 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 41 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 42 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 43 4 'Structure model' '_pdbx_struct_conn_angle.value' 44 4 'Structure model' '_pdbx_validate_main_chain_plane.improper_torsion_angle' 45 4 'Structure model' '_pdbx_validate_peptide_omega.auth_comp_id_1' 46 4 'Structure model' '_pdbx_validate_peptide_omega.auth_comp_id_2' 47 4 'Structure model' '_pdbx_validate_peptide_omega.auth_seq_id_1' 48 4 'Structure model' '_pdbx_validate_peptide_omega.auth_seq_id_2' 49 4 'Structure model' '_pdbx_validate_peptide_omega.omega' 50 4 'Structure model' '_pdbx_validate_rmsd_angle.angle_deviation' 51 4 'Structure model' '_pdbx_validate_rmsd_angle.angle_standard_deviation' 52 4 'Structure model' '_pdbx_validate_rmsd_angle.angle_target_value' 53 4 'Structure model' '_pdbx_validate_rmsd_angle.angle_value' 54 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_atom_id_1' 55 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_atom_id_2' 56 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_atom_id_3' 57 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_comp_id_1' 58 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_comp_id_3' 59 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_seq_id_1' 60 4 'Structure model' '_pdbx_validate_rmsd_angle.auth_seq_id_3' 61 4 'Structure model' '_pdbx_validate_torsion.phi' 62 4 'Structure model' '_pdbx_validate_torsion.psi' 63 4 'Structure model' '_struct_conn.conn_type_id' 64 4 'Structure model' '_struct_conn.id' 65 4 'Structure model' '_struct_conn.pdbx_dist_value' 66 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 67 4 'Structure model' '_struct_conn.pdbx_ptnr1_label_alt_id' 68 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 69 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 70 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 71 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 72 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 73 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 74 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 75 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 76 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 77 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 78 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 79 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 80 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 81 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 82 4 'Structure model' '_struct_conn.ptnr2_symmetry' 83 4 'Structure model' '_struct_conn_type.id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6G8L _pdbx_database_status.recvd_initial_deposition_date 2018-04-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'similar structure in same study' 6g8i unspecified PDB 'similar structure in same study' 6g6x unspecified PDB 'similar structure in same study' 6g8j unspecified PDB 'similar structure in same study' 6g8k unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Andrei, S.A.' 1 0000-0003-2961-8018 'Thijssen, V.' 2 0000-0002-4390-1314 'Brunsveld, L.' 3 0000-0001-5675-511X 'Ottmann, C.' 4 0000-0001-7315-0315 'Milroy, L.G.' 5 0000-0003-4601-0936 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem.Commun.(Camb.)' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1364-548X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 55 _citation.language ? _citation.page_first 14809 _citation.page_last 14812 _citation.title 'A study on the effect of synthetic alpha-to-beta3-amino acid mutations on the binding of phosphopeptides to 14-3-3 proteins.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/c9cc07982c _citation.pdbx_database_id_PubMed 31763628 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Andrei, S.A.' 1 ? primary 'Thijssen, V.' 2 ? primary 'Brunsveld, L.' 3 ? primary 'Ottmann, C.' 4 ? primary 'Milroy, L.G.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '14-3-3 protein sigma' 26542.914 1 ? ? ? ? 2 polymer syn ACE-ARG-ALA-HIS-SEP-SER-PRO-ALA-SER-BLE-GLN 1175.190 1 ? ? ? 'BLE is a beta3-leucine unnatural amino acid' 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 5 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 6 water nat water 18.015 426 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Epithelial cell marker protein 1,Stratifin' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM DISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM DISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; A ? 2 'polypeptide(L)' no yes '(ACE)RAH(SEP)SPAS(B3L)Q' XRAHSSPASXQ P ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CHLORIDE ION' CL 4 'MAGNESIUM ION' MG 5 'SODIUM ION' NA 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 ARG n 1 9 ALA n 1 10 SER n 1 11 LEU n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 ALA n 1 16 LYS n 1 17 LEU n 1 18 ALA n 1 19 GLU n 1 20 GLN n 1 21 ALA n 1 22 GLU n 1 23 ARG n 1 24 TYR n 1 25 GLU n 1 26 ASP n 1 27 MET n 1 28 ALA n 1 29 ALA n 1 30 PHE n 1 31 MET n 1 32 LYS n 1 33 GLY n 1 34 ALA n 1 35 VAL n 1 36 GLU n 1 37 LYS n 1 38 GLY n 1 39 GLU n 1 40 GLU n 1 41 LEU n 1 42 SER n 1 43 CYS n 1 44 GLU n 1 45 GLU n 1 46 ARG n 1 47 ASN n 1 48 LEU n 1 49 LEU n 1 50 SER n 1 51 VAL n 1 52 ALA n 1 53 TYR n 1 54 LYS n 1 55 ASN n 1 56 VAL n 1 57 VAL n 1 58 GLY n 1 59 GLY n 1 60 GLN n 1 61 ARG n 1 62 ALA n 1 63 ALA n 1 64 TRP n 1 65 ARG n 1 66 VAL n 1 67 LEU n 1 68 SER n 1 69 SER n 1 70 ILE n 1 71 GLU n 1 72 GLN n 1 73 LYS n 1 74 SER n 1 75 ASN n 1 76 GLU n 1 77 GLU n 1 78 GLY n 1 79 SER n 1 80 GLU n 1 81 GLU n 1 82 LYS n 1 83 GLY n 1 84 PRO n 1 85 GLU n 1 86 VAL n 1 87 ARG n 1 88 GLU n 1 89 TYR n 1 90 ARG n 1 91 GLU n 1 92 LYS n 1 93 VAL n 1 94 GLU n 1 95 THR n 1 96 GLU n 1 97 LEU n 1 98 GLN n 1 99 GLY n 1 100 VAL n 1 101 CYS n 1 102 ASP n 1 103 THR n 1 104 VAL n 1 105 LEU n 1 106 GLY n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 SER n 1 111 HIS n 1 112 LEU n 1 113 ILE n 1 114 LYS n 1 115 GLU n 1 116 ALA n 1 117 GLY n 1 118 ASP n 1 119 ALA n 1 120 GLU n 1 121 SER n 1 122 ARG n 1 123 VAL n 1 124 PHE n 1 125 TYR n 1 126 LEU n 1 127 LYS n 1 128 MET n 1 129 LYS n 1 130 GLY n 1 131 ASP n 1 132 TYR n 1 133 TYR n 1 134 ARG n 1 135 TYR n 1 136 LEU n 1 137 ALA n 1 138 GLU n 1 139 VAL n 1 140 ALA n 1 141 THR n 1 142 GLY n 1 143 ASP n 1 144 ASP n 1 145 LYS n 1 146 LYS n 1 147 ARG n 1 148 ILE n 1 149 ILE n 1 150 ASP n 1 151 SER n 1 152 ALA n 1 153 ARG n 1 154 SER n 1 155 ALA n 1 156 TYR n 1 157 GLN n 1 158 GLU n 1 159 ALA n 1 160 MET n 1 161 ASP n 1 162 ILE n 1 163 SER n 1 164 LYS n 1 165 LYS n 1 166 GLU n 1 167 MET n 1 168 PRO n 1 169 PRO n 1 170 THR n 1 171 ASN n 1 172 PRO n 1 173 ILE n 1 174 ARG n 1 175 LEU n 1 176 GLY n 1 177 LEU n 1 178 ALA n 1 179 LEU n 1 180 ASN n 1 181 PHE n 1 182 SER n 1 183 VAL n 1 184 PHE n 1 185 HIS n 1 186 TYR n 1 187 GLU n 1 188 ILE n 1 189 ALA n 1 190 ASN n 1 191 SER n 1 192 PRO n 1 193 GLU n 1 194 GLU n 1 195 ALA n 1 196 ILE n 1 197 SER n 1 198 LEU n 1 199 ALA n 1 200 LYS n 1 201 THR n 1 202 THR n 1 203 PHE n 1 204 ASP n 1 205 GLU n 1 206 ALA n 1 207 MET n 1 208 ALA n 1 209 ASP n 1 210 LEU n 1 211 HIS n 1 212 THR n 1 213 LEU n 1 214 SER n 1 215 GLU n 1 216 ASP n 1 217 SER n 1 218 TYR n 1 219 LYS n 1 220 ASP n 1 221 SER n 1 222 THR n 1 223 LEU n 1 224 ILE n 1 225 MET n 1 226 GLN n 1 227 LEU n 1 228 LEU n 1 229 ARG n 1 230 ASP n 1 231 ASN n 1 232 LEU n 1 233 THR n 1 234 LEU n 1 235 TRP n 1 236 THR n 2 1 ACE n 2 2 ARG n 2 3 ALA n 2 4 HIS n 2 5 SEP n 2 6 SER n 2 7 PRO n 2 8 ALA n 2 9 SER n 2 10 B3L n 2 11 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 236 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SFN, HME1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 11 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 B3L 'L-peptide linking' . '(3S)-3-amino-5-methylhexanoic acid' '(S)-beta-3-homoleucine' 'C7 H15 N O2' 145.200 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 -4 GLY GLY A . n A 1 2 ALA 2 -3 -3 ALA ALA A . n A 1 3 MET 3 -2 -2 MET MET A . n A 1 4 GLY 4 -1 -1 GLY GLY A . n A 1 5 SER 5 0 0 SER SER A . n A 1 6 MET 6 1 1 MET MET A . n A 1 7 GLU 7 2 2 GLU GLU A . n A 1 8 ARG 8 3 3 ARG ARG A . n A 1 9 ALA 9 4 4 ALA ALA A . n A 1 10 SER 10 5 5 SER SER A . n A 1 11 LEU 11 6 6 LEU LEU A . n A 1 12 ILE 12 7 7 ILE ILE A . n A 1 13 GLN 13 8 8 GLN GLN A . n A 1 14 LYS 14 9 9 LYS LYS A . n A 1 15 ALA 15 10 10 ALA ALA A . n A 1 16 LYS 16 11 11 LYS LYS A . n A 1 17 LEU 17 12 12 LEU LEU A . n A 1 18 ALA 18 13 13 ALA ALA A . n A 1 19 GLU 19 14 14 GLU GLU A . n A 1 20 GLN 20 15 15 GLN GLN A . n A 1 21 ALA 21 16 16 ALA ALA A . n A 1 22 GLU 22 17 17 GLU GLU A . n A 1 23 ARG 23 18 18 ARG ARG A . n A 1 24 TYR 24 19 19 TYR TYR A . n A 1 25 GLU 25 20 20 GLU GLU A . n A 1 26 ASP 26 21 21 ASP ASP A . n A 1 27 MET 27 22 22 MET MET A . n A 1 28 ALA 28 23 23 ALA ALA A . n A 1 29 ALA 29 24 24 ALA ALA A . n A 1 30 PHE 30 25 25 PHE PHE A . n A 1 31 MET 31 26 26 MET MET A . n A 1 32 LYS 32 27 27 LYS LYS A . n A 1 33 GLY 33 28 28 GLY GLY A . n A 1 34 ALA 34 29 29 ALA ALA A . n A 1 35 VAL 35 30 30 VAL VAL A . n A 1 36 GLU 36 31 31 GLU GLU A . n A 1 37 LYS 37 32 32 LYS LYS A . n A 1 38 GLY 38 33 33 GLY GLY A . n A 1 39 GLU 39 34 34 GLU GLU A . n A 1 40 GLU 40 35 35 GLU GLU A . n A 1 41 LEU 41 36 36 LEU LEU A . n A 1 42 SER 42 37 37 SER SER A . n A 1 43 CYS 43 38 38 CYS CYS A . n A 1 44 GLU 44 39 39 GLU GLU A . n A 1 45 GLU 45 40 40 GLU GLU A . n A 1 46 ARG 46 41 41 ARG ARG A . n A 1 47 ASN 47 42 42 ASN ASN A . n A 1 48 LEU 48 43 43 LEU LEU A . n A 1 49 LEU 49 44 44 LEU LEU A . n A 1 50 SER 50 45 45 SER SER A . n A 1 51 VAL 51 46 46 VAL VAL A . n A 1 52 ALA 52 47 47 ALA ALA A . n A 1 53 TYR 53 48 48 TYR TYR A . n A 1 54 LYS 54 49 49 LYS LYS A . n A 1 55 ASN 55 50 50 ASN ASN A . n A 1 56 VAL 56 51 51 VAL VAL A . n A 1 57 VAL 57 52 52 VAL VAL A . n A 1 58 GLY 58 53 53 GLY GLY A . n A 1 59 GLY 59 54 54 GLY GLY A . n A 1 60 GLN 60 55 55 GLN GLN A . n A 1 61 ARG 61 56 56 ARG ARG A . n A 1 62 ALA 62 57 57 ALA ALA A . n A 1 63 ALA 63 58 58 ALA ALA A . n A 1 64 TRP 64 59 59 TRP TRP A . n A 1 65 ARG 65 60 60 ARG ARG A . n A 1 66 VAL 66 61 61 VAL VAL A . n A 1 67 LEU 67 62 62 LEU LEU A . n A 1 68 SER 68 63 63 SER SER A . n A 1 69 SER 69 64 64 SER SER A . n A 1 70 ILE 70 65 65 ILE ILE A . n A 1 71 GLU 71 66 66 GLU GLU A . n A 1 72 GLN 72 67 67 GLN GLN A . n A 1 73 LYS 73 68 68 LYS LYS A . n A 1 74 SER 74 69 69 SER SER A . n A 1 75 ASN 75 70 70 ASN ASN A . n A 1 76 GLU 76 71 71 GLU GLU A . n A 1 77 GLU 77 72 72 GLU GLU A . n A 1 78 GLY 78 73 73 GLY GLY A . n A 1 79 SER 79 74 74 SER SER A . n A 1 80 GLU 80 75 75 GLU GLU A . n A 1 81 GLU 81 76 76 GLU GLU A . n A 1 82 LYS 82 77 77 LYS LYS A . n A 1 83 GLY 83 78 78 GLY GLY A . n A 1 84 PRO 84 79 79 PRO PRO A . n A 1 85 GLU 85 80 80 GLU GLU A . n A 1 86 VAL 86 81 81 VAL VAL A . n A 1 87 ARG 87 82 82 ARG ARG A . n A 1 88 GLU 88 83 83 GLU GLU A . n A 1 89 TYR 89 84 84 TYR TYR A . n A 1 90 ARG 90 85 85 ARG ARG A . n A 1 91 GLU 91 86 86 GLU GLU A . n A 1 92 LYS 92 87 87 LYS LYS A . n A 1 93 VAL 93 88 88 VAL VAL A . n A 1 94 GLU 94 89 89 GLU GLU A . n A 1 95 THR 95 90 90 THR THR A . n A 1 96 GLU 96 91 91 GLU GLU A . n A 1 97 LEU 97 92 92 LEU LEU A . n A 1 98 GLN 98 93 93 GLN GLN A . n A 1 99 GLY 99 94 94 GLY GLY A . n A 1 100 VAL 100 95 95 VAL VAL A . n A 1 101 CYS 101 96 96 CYS CYS A . n A 1 102 ASP 102 97 97 ASP ASP A . n A 1 103 THR 103 98 98 THR THR A . n A 1 104 VAL 104 99 99 VAL VAL A . n A 1 105 LEU 105 100 100 LEU LEU A . n A 1 106 GLY 106 101 101 GLY GLY A . n A 1 107 LEU 107 102 102 LEU LEU A . n A 1 108 LEU 108 103 103 LEU LEU A . n A 1 109 ASP 109 104 104 ASP ASP A . n A 1 110 SER 110 105 105 SER SER A . n A 1 111 HIS 111 106 106 HIS HIS A . n A 1 112 LEU 112 107 107 LEU LEU A . n A 1 113 ILE 113 108 108 ILE ILE A . n A 1 114 LYS 114 109 109 LYS LYS A . n A 1 115 GLU 115 110 110 GLU GLU A . n A 1 116 ALA 116 111 111 ALA ALA A . n A 1 117 GLY 117 112 112 GLY GLY A . n A 1 118 ASP 118 113 113 ASP ASP A . n A 1 119 ALA 119 114 114 ALA ALA A . n A 1 120 GLU 120 115 115 GLU GLU A . n A 1 121 SER 121 116 116 SER SER A . n A 1 122 ARG 122 117 117 ARG ARG A . n A 1 123 VAL 123 118 118 VAL VAL A . n A 1 124 PHE 124 119 119 PHE PHE A . n A 1 125 TYR 125 120 120 TYR TYR A . n A 1 126 LEU 126 121 121 LEU LEU A . n A 1 127 LYS 127 122 122 LYS LYS A . n A 1 128 MET 128 123 123 MET MET A . n A 1 129 LYS 129 124 124 LYS LYS A . n A 1 130 GLY 130 125 125 GLY GLY A . n A 1 131 ASP 131 126 126 ASP ASP A . n A 1 132 TYR 132 127 127 TYR TYR A . n A 1 133 TYR 133 128 128 TYR TYR A . n A 1 134 ARG 134 129 129 ARG ARG A . n A 1 135 TYR 135 130 130 TYR TYR A . n A 1 136 LEU 136 131 131 LEU LEU A . n A 1 137 ALA 137 132 132 ALA ALA A . n A 1 138 GLU 138 133 133 GLU GLU A . n A 1 139 VAL 139 134 134 VAL VAL A . n A 1 140 ALA 140 135 135 ALA ALA A . n A 1 141 THR 141 136 136 THR THR A . n A 1 142 GLY 142 137 137 GLY GLY A . n A 1 143 ASP 143 138 138 ASP ASP A . n A 1 144 ASP 144 139 139 ASP ASP A . n A 1 145 LYS 145 140 140 LYS LYS A . n A 1 146 LYS 146 141 141 LYS LYS A . n A 1 147 ARG 147 142 142 ARG ARG A . n A 1 148 ILE 148 143 143 ILE ILE A . n A 1 149 ILE 149 144 144 ILE ILE A . n A 1 150 ASP 150 145 145 ASP ASP A . n A 1 151 SER 151 146 146 SER SER A . n A 1 152 ALA 152 147 147 ALA ALA A . n A 1 153 ARG 153 148 148 ARG ARG A . n A 1 154 SER 154 149 149 SER SER A . n A 1 155 ALA 155 150 150 ALA ALA A . n A 1 156 TYR 156 151 151 TYR TYR A . n A 1 157 GLN 157 152 152 GLN GLN A . n A 1 158 GLU 158 153 153 GLU GLU A . n A 1 159 ALA 159 154 154 ALA ALA A . n A 1 160 MET 160 155 155 MET MET A . n A 1 161 ASP 161 156 156 ASP ASP A . n A 1 162 ILE 162 157 157 ILE ILE A . n A 1 163 SER 163 158 158 SER SER A . n A 1 164 LYS 164 159 159 LYS LYS A . n A 1 165 LYS 165 160 160 LYS LYS A . n A 1 166 GLU 166 161 161 GLU GLU A . n A 1 167 MET 167 162 162 MET MET A . n A 1 168 PRO 168 163 163 PRO PRO A . n A 1 169 PRO 169 164 164 PRO PRO A . n A 1 170 THR 170 165 165 THR THR A . n A 1 171 ASN 171 166 166 ASN ASN A . n A 1 172 PRO 172 167 167 PRO PRO A . n A 1 173 ILE 173 168 168 ILE ILE A . n A 1 174 ARG 174 169 169 ARG ARG A . n A 1 175 LEU 175 170 170 LEU LEU A . n A 1 176 GLY 176 171 171 GLY GLY A . n A 1 177 LEU 177 172 172 LEU LEU A . n A 1 178 ALA 178 173 173 ALA ALA A . n A 1 179 LEU 179 174 174 LEU LEU A . n A 1 180 ASN 180 175 175 ASN ASN A . n A 1 181 PHE 181 176 176 PHE PHE A . n A 1 182 SER 182 177 177 SER SER A . n A 1 183 VAL 183 178 178 VAL VAL A . n A 1 184 PHE 184 179 179 PHE PHE A . n A 1 185 HIS 185 180 180 HIS HIS A . n A 1 186 TYR 186 181 181 TYR TYR A . n A 1 187 GLU 187 182 182 GLU GLU A . n A 1 188 ILE 188 183 183 ILE ILE A . n A 1 189 ALA 189 184 184 ALA ALA A . n A 1 190 ASN 190 185 185 ASN ASN A . n A 1 191 SER 191 186 186 SER SER A . n A 1 192 PRO 192 187 187 PRO PRO A . n A 1 193 GLU 193 188 188 GLU GLU A . n A 1 194 GLU 194 189 189 GLU GLU A . n A 1 195 ALA 195 190 190 ALA ALA A . n A 1 196 ILE 196 191 191 ILE ILE A . n A 1 197 SER 197 192 192 SER SER A . n A 1 198 LEU 198 193 193 LEU LEU A . n A 1 199 ALA 199 194 194 ALA ALA A . n A 1 200 LYS 200 195 195 LYS LYS A . n A 1 201 THR 201 196 196 THR THR A . n A 1 202 THR 202 197 197 THR THR A . n A 1 203 PHE 203 198 198 PHE PHE A . n A 1 204 ASP 204 199 199 ASP ASP A . n A 1 205 GLU 205 200 200 GLU GLU A . n A 1 206 ALA 206 201 201 ALA ALA A . n A 1 207 MET 207 202 202 MET MET A . n A 1 208 ALA 208 203 203 ALA ALA A . n A 1 209 ASP 209 204 204 ASP ASP A . n A 1 210 LEU 210 205 205 LEU LEU A . n A 1 211 HIS 211 206 206 HIS HIS A . n A 1 212 THR 212 207 207 THR THR A . n A 1 213 LEU 213 208 208 LEU LEU A . n A 1 214 SER 214 209 209 SER SER A . n A 1 215 GLU 215 210 210 GLU GLU A . n A 1 216 ASP 216 211 211 ASP ASP A . n A 1 217 SER 217 212 212 SER SER A . n A 1 218 TYR 218 213 213 TYR TYR A . n A 1 219 LYS 219 214 214 LYS LYS A . n A 1 220 ASP 220 215 215 ASP ASP A . n A 1 221 SER 221 216 216 SER SER A . n A 1 222 THR 222 217 217 THR THR A . n A 1 223 LEU 223 218 218 LEU LEU A . n A 1 224 ILE 224 219 219 ILE ILE A . n A 1 225 MET 225 220 220 MET MET A . n A 1 226 GLN 226 221 221 GLN GLN A . n A 1 227 LEU 227 222 222 LEU LEU A . n A 1 228 LEU 228 223 223 LEU LEU A . n A 1 229 ARG 229 224 224 ARG ARG A . n A 1 230 ASP 230 225 225 ASP ASP A . n A 1 231 ASN 231 226 226 ASN ASN A . n A 1 232 LEU 232 227 227 LEU LEU A . n A 1 233 THR 233 228 228 THR THR A . n A 1 234 LEU 234 229 229 LEU LEU A . n A 1 235 TRP 235 230 230 TRP TRP A . n A 1 236 THR 236 231 231 THR THR A . n B 2 1 ACE 1 123 ? ? ? P . n B 2 2 ARG 2 124 ? ? ? P . n B 2 3 ALA 3 125 125 ALA ALA P . n B 2 4 HIS 4 126 126 HIS HIS P . n B 2 5 SEP 5 127 127 SEP SEP P . n B 2 6 SER 6 128 128 SER SER P . n B 2 7 PRO 7 129 129 PRO PRO P . n B 2 8 ALA 8 130 130 ALA ALA P . n B 2 9 SER 9 131 131 SER SER P . n B 2 10 B3L 10 132 132 B3L BLE P . n B 2 11 GLN 11 133 133 GLN GLN P . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CL 1 301 1 CL CL A . D 4 MG 1 302 2 MG MG A . E 5 NA 1 303 3 NA NA A . F 6 HOH 1 401 160 HOH HOH A . F 6 HOH 2 402 349 HOH HOH A . F 6 HOH 3 403 123 HOH HOH A . F 6 HOH 4 404 389 HOH HOH A . F 6 HOH 5 405 307 HOH HOH A . F 6 HOH 6 406 231 HOH HOH A . F 6 HOH 7 407 369 HOH HOH A . F 6 HOH 8 408 188 HOH HOH A . F 6 HOH 9 409 240 HOH HOH A . F 6 HOH 10 410 364 HOH HOH A . F 6 HOH 11 411 213 HOH HOH A . F 6 HOH 12 412 346 HOH HOH A . F 6 HOH 13 413 344 HOH HOH A . F 6 HOH 14 414 220 HOH HOH A . F 6 HOH 15 415 3 HOH HOH A . F 6 HOH 16 416 421 HOH HOH A . F 6 HOH 17 417 135 HOH HOH A . F 6 HOH 18 418 79 HOH HOH A . F 6 HOH 19 419 341 HOH HOH A . F 6 HOH 20 420 333 HOH HOH A . F 6 HOH 21 421 398 HOH HOH A . F 6 HOH 22 422 191 HOH HOH A . F 6 HOH 23 423 411 HOH HOH A . F 6 HOH 24 424 282 HOH HOH A . F 6 HOH 25 425 360 HOH HOH A . F 6 HOH 26 426 156 HOH HOH A . F 6 HOH 27 427 67 HOH HOH A . F 6 HOH 28 428 40 HOH HOH A . F 6 HOH 29 429 300 HOH HOH A . F 6 HOH 30 430 279 HOH HOH A . F 6 HOH 31 431 370 HOH HOH A . F 6 HOH 32 432 81 HOH HOH A . F 6 HOH 33 433 122 HOH HOH A . F 6 HOH 34 434 207 HOH HOH A . F 6 HOH 35 435 361 HOH HOH A . F 6 HOH 36 436 381 HOH HOH A . F 6 HOH 37 437 321 HOH HOH A . F 6 HOH 38 438 18 HOH HOH A . F 6 HOH 39 439 168 HOH HOH A . F 6 HOH 40 440 251 HOH HOH A . F 6 HOH 41 441 278 HOH HOH A . F 6 HOH 42 442 234 HOH HOH A . F 6 HOH 43 443 151 HOH HOH A . F 6 HOH 44 444 262 HOH HOH A . F 6 HOH 45 445 36 HOH HOH A . F 6 HOH 46 446 233 HOH HOH A . F 6 HOH 47 447 172 HOH HOH A . F 6 HOH 48 448 216 HOH HOH A . F 6 HOH 49 449 107 HOH HOH A . F 6 HOH 50 450 214 HOH HOH A . F 6 HOH 51 451 17 HOH HOH A . F 6 HOH 52 452 125 HOH HOH A . F 6 HOH 53 453 120 HOH HOH A . F 6 HOH 54 454 10 HOH HOH A . F 6 HOH 55 455 304 HOH HOH A . F 6 HOH 56 456 400 HOH HOH A . F 6 HOH 57 457 73 HOH HOH A . F 6 HOH 58 458 285 HOH HOH A . F 6 HOH 59 459 105 HOH HOH A . F 6 HOH 60 460 347 HOH HOH A . F 6 HOH 61 461 158 HOH HOH A . F 6 HOH 62 462 4 HOH HOH A . F 6 HOH 63 463 255 HOH HOH A . F 6 HOH 64 464 126 HOH HOH A . F 6 HOH 65 465 200 HOH HOH A . F 6 HOH 66 466 38 HOH HOH A . F 6 HOH 67 467 178 HOH HOH A . F 6 HOH 68 468 23 HOH HOH A . F 6 HOH 69 469 397 HOH HOH A . F 6 HOH 70 470 153 HOH HOH A . F 6 HOH 71 471 113 HOH HOH A . F 6 HOH 72 472 5 HOH HOH A . F 6 HOH 73 473 92 HOH HOH A . F 6 HOH 74 474 319 HOH HOH A . F 6 HOH 75 475 34 HOH HOH A . F 6 HOH 76 476 26 HOH HOH A . F 6 HOH 77 477 95 HOH HOH A . F 6 HOH 78 478 187 HOH HOH A . F 6 HOH 79 479 372 HOH HOH A . F 6 HOH 80 480 150 HOH HOH A . F 6 HOH 81 481 197 HOH HOH A . F 6 HOH 82 482 209 HOH HOH A . F 6 HOH 83 483 110 HOH HOH A . F 6 HOH 84 484 166 HOH HOH A . F 6 HOH 85 485 173 HOH HOH A . F 6 HOH 86 486 226 HOH HOH A . F 6 HOH 87 487 117 HOH HOH A . F 6 HOH 88 488 24 HOH HOH A . F 6 HOH 89 489 250 HOH HOH A . F 6 HOH 90 490 202 HOH HOH A . F 6 HOH 91 491 83 HOH HOH A . F 6 HOH 92 492 419 HOH HOH A . F 6 HOH 93 493 109 HOH HOH A . F 6 HOH 94 494 6 HOH HOH A . F 6 HOH 95 495 140 HOH HOH A . F 6 HOH 96 496 1 HOH HOH A . F 6 HOH 97 497 45 HOH HOH A . F 6 HOH 98 498 63 HOH HOH A . F 6 HOH 99 499 146 HOH HOH A . F 6 HOH 100 500 89 HOH HOH A . F 6 HOH 101 501 91 HOH HOH A . F 6 HOH 102 502 267 HOH HOH A . F 6 HOH 103 503 131 HOH HOH A . F 6 HOH 104 504 159 HOH HOH A . F 6 HOH 105 505 376 HOH HOH A . F 6 HOH 106 506 32 HOH HOH A . F 6 HOH 107 507 311 HOH HOH A . F 6 HOH 108 508 186 HOH HOH A . F 6 HOH 109 509 66 HOH HOH A . F 6 HOH 110 510 42 HOH HOH A . F 6 HOH 111 511 14 HOH HOH A . F 6 HOH 112 512 124 HOH HOH A . F 6 HOH 113 513 16 HOH HOH A . F 6 HOH 114 514 142 HOH HOH A . F 6 HOH 115 515 185 HOH HOH A . F 6 HOH 116 516 157 HOH HOH A . F 6 HOH 117 517 55 HOH HOH A . F 6 HOH 118 518 12 HOH HOH A . F 6 HOH 119 519 84 HOH HOH A . F 6 HOH 120 520 96 HOH HOH A . F 6 HOH 121 521 313 HOH HOH A . F 6 HOH 122 522 104 HOH HOH A . F 6 HOH 123 523 111 HOH HOH A . F 6 HOH 124 524 208 HOH HOH A . F 6 HOH 125 525 56 HOH HOH A . F 6 HOH 126 526 162 HOH HOH A . F 6 HOH 127 527 174 HOH HOH A . F 6 HOH 128 528 50 HOH HOH A . F 6 HOH 129 529 365 HOH HOH A . F 6 HOH 130 530 11 HOH HOH A . F 6 HOH 131 531 229 HOH HOH A . F 6 HOH 132 532 68 HOH HOH A . F 6 HOH 133 533 64 HOH HOH A . F 6 HOH 134 534 29 HOH HOH A . F 6 HOH 135 535 88 HOH HOH A . F 6 HOH 136 536 106 HOH HOH A . F 6 HOH 137 537 164 HOH HOH A . F 6 HOH 138 538 43 HOH HOH A . F 6 HOH 139 539 62 HOH HOH A . F 6 HOH 140 540 230 HOH HOH A . F 6 HOH 141 541 35 HOH HOH A . F 6 HOH 142 542 127 HOH HOH A . F 6 HOH 143 543 74 HOH HOH A . F 6 HOH 144 544 76 HOH HOH A . F 6 HOH 145 545 86 HOH HOH A . F 6 HOH 146 546 82 HOH HOH A . F 6 HOH 147 547 97 HOH HOH A . F 6 HOH 148 548 90 HOH HOH A . F 6 HOH 149 549 78 HOH HOH A . F 6 HOH 150 550 273 HOH HOH A . F 6 HOH 151 551 57 HOH HOH A . F 6 HOH 152 552 13 HOH HOH A . F 6 HOH 153 553 47 HOH HOH A . F 6 HOH 154 554 39 HOH HOH A . F 6 HOH 155 555 108 HOH HOH A . F 6 HOH 156 556 192 HOH HOH A . F 6 HOH 157 557 52 HOH HOH A . F 6 HOH 158 558 286 HOH HOH A . F 6 HOH 159 559 21 HOH HOH A . F 6 HOH 160 560 59 HOH HOH A . F 6 HOH 161 561 75 HOH HOH A . F 6 HOH 162 562 98 HOH HOH A . F 6 HOH 163 563 41 HOH HOH A . F 6 HOH 164 564 31 HOH HOH A . F 6 HOH 165 565 145 HOH HOH A . F 6 HOH 166 566 275 HOH HOH A . F 6 HOH 167 567 182 HOH HOH A . F 6 HOH 168 568 261 HOH HOH A . F 6 HOH 169 569 49 HOH HOH A . F 6 HOH 170 570 167 HOH HOH A . F 6 HOH 171 571 239 HOH HOH A . F 6 HOH 172 572 30 HOH HOH A . F 6 HOH 173 573 58 HOH HOH A . F 6 HOH 174 574 180 HOH HOH A . F 6 HOH 175 575 362 HOH HOH A . F 6 HOH 176 576 15 HOH HOH A . F 6 HOH 177 577 25 HOH HOH A . F 6 HOH 178 578 413 HOH HOH A . F 6 HOH 179 579 19 HOH HOH A . F 6 HOH 180 580 44 HOH HOH A . F 6 HOH 181 581 298 HOH HOH A . F 6 HOH 182 582 316 HOH HOH A . F 6 HOH 183 583 198 HOH HOH A . F 6 HOH 184 584 217 HOH HOH A . F 6 HOH 185 585 80 HOH HOH A . F 6 HOH 186 586 407 HOH HOH A . F 6 HOH 187 587 20 HOH HOH A . F 6 HOH 188 588 323 HOH HOH A . F 6 HOH 189 589 183 HOH HOH A . F 6 HOH 190 590 33 HOH HOH A . F 6 HOH 191 591 379 HOH HOH A . F 6 HOH 192 592 7 HOH HOH A . F 6 HOH 193 593 354 HOH HOH A . F 6 HOH 194 594 87 HOH HOH A . F 6 HOH 195 595 101 HOH HOH A . F 6 HOH 196 596 65 HOH HOH A . F 6 HOH 197 597 254 HOH HOH A . F 6 HOH 198 598 141 HOH HOH A . F 6 HOH 199 599 352 HOH HOH A . F 6 HOH 200 600 22 HOH HOH A . F 6 HOH 201 601 312 HOH HOH A . F 6 HOH 202 602 27 HOH HOH A . F 6 HOH 203 603 138 HOH HOH A . F 6 HOH 204 604 99 HOH HOH A . F 6 HOH 205 605 305 HOH HOH A . F 6 HOH 206 606 184 HOH HOH A . F 6 HOH 207 607 310 HOH HOH A . F 6 HOH 208 608 53 HOH HOH A . F 6 HOH 209 609 137 HOH HOH A . F 6 HOH 210 610 170 HOH HOH A . F 6 HOH 211 611 128 HOH HOH A . F 6 HOH 212 612 46 HOH HOH A . F 6 HOH 213 613 290 HOH HOH A . F 6 HOH 214 614 219 HOH HOH A . F 6 HOH 215 615 165 HOH HOH A . F 6 HOH 216 616 203 HOH HOH A . F 6 HOH 217 617 271 HOH HOH A . F 6 HOH 218 618 315 HOH HOH A . F 6 HOH 219 619 335 HOH HOH A . F 6 HOH 220 620 295 HOH HOH A . F 6 HOH 221 621 152 HOH HOH A . F 6 HOH 222 622 309 HOH HOH A . F 6 HOH 223 623 93 HOH HOH A . F 6 HOH 224 624 420 HOH HOH A . F 6 HOH 225 625 9 HOH HOH A . F 6 HOH 226 626 260 HOH HOH A . F 6 HOH 227 627 281 HOH HOH A . F 6 HOH 228 628 28 HOH HOH A . F 6 HOH 229 629 211 HOH HOH A . F 6 HOH 230 630 371 HOH HOH A . F 6 HOH 231 631 256 HOH HOH A . F 6 HOH 232 632 246 HOH HOH A . F 6 HOH 233 633 306 HOH HOH A . F 6 HOH 234 634 236 HOH HOH A . F 6 HOH 235 635 115 HOH HOH A . F 6 HOH 236 636 264 HOH HOH A . F 6 HOH 237 637 116 HOH HOH A . F 6 HOH 238 638 403 HOH HOH A . F 6 HOH 239 639 175 HOH HOH A . F 6 HOH 240 640 357 HOH HOH A . F 6 HOH 241 641 384 HOH HOH A . F 6 HOH 242 642 205 HOH HOH A . F 6 HOH 243 643 238 HOH HOH A . F 6 HOH 244 644 375 HOH HOH A . F 6 HOH 245 645 163 HOH HOH A . F 6 HOH 246 646 100 HOH HOH A . F 6 HOH 247 647 241 HOH HOH A . F 6 HOH 248 648 8 HOH HOH A . F 6 HOH 249 649 331 HOH HOH A . F 6 HOH 250 650 199 HOH HOH A . F 6 HOH 251 651 388 HOH HOH A . F 6 HOH 252 652 339 HOH HOH A . F 6 HOH 253 653 395 HOH HOH A . F 6 HOH 254 654 277 HOH HOH A . F 6 HOH 255 655 103 HOH HOH A . F 6 HOH 256 656 418 HOH HOH A . F 6 HOH 257 657 287 HOH HOH A . F 6 HOH 258 658 367 HOH HOH A . F 6 HOH 259 659 161 HOH HOH A . F 6 HOH 260 660 179 HOH HOH A . F 6 HOH 261 661 378 HOH HOH A . F 6 HOH 262 662 143 HOH HOH A . F 6 HOH 263 663 325 HOH HOH A . F 6 HOH 264 664 218 HOH HOH A . F 6 HOH 265 665 374 HOH HOH A . F 6 HOH 266 666 263 HOH HOH A . F 6 HOH 267 667 272 HOH HOH A . F 6 HOH 268 668 326 HOH HOH A . F 6 HOH 269 669 85 HOH HOH A . F 6 HOH 270 670 130 HOH HOH A . F 6 HOH 271 671 171 HOH HOH A . F 6 HOH 272 672 343 HOH HOH A . F 6 HOH 273 673 269 HOH HOH A . F 6 HOH 274 674 353 HOH HOH A . F 6 HOH 275 675 237 HOH HOH A . F 6 HOH 276 676 268 HOH HOH A . F 6 HOH 277 677 274 HOH HOH A . F 6 HOH 278 678 301 HOH HOH A . F 6 HOH 279 679 417 HOH HOH A . F 6 HOH 280 680 302 HOH HOH A . F 6 HOH 281 681 291 HOH HOH A . F 6 HOH 282 682 225 HOH HOH A . F 6 HOH 283 683 242 HOH HOH A . F 6 HOH 284 684 383 HOH HOH A . F 6 HOH 285 685 265 HOH HOH A . F 6 HOH 286 686 48 HOH HOH A . F 6 HOH 287 687 334 HOH HOH A . F 6 HOH 288 688 387 HOH HOH A . F 6 HOH 289 689 318 HOH HOH A . F 6 HOH 290 690 121 HOH HOH A . F 6 HOH 291 691 244 HOH HOH A . F 6 HOH 292 692 355 HOH HOH A . F 6 HOH 293 693 317 HOH HOH A . F 6 HOH 294 694 380 HOH HOH A . F 6 HOH 295 695 194 HOH HOH A . F 6 HOH 296 696 252 HOH HOH A . F 6 HOH 297 697 119 HOH HOH A . F 6 HOH 298 698 258 HOH HOH A . F 6 HOH 299 699 330 HOH HOH A . F 6 HOH 300 700 296 HOH HOH A . F 6 HOH 301 701 382 HOH HOH A . F 6 HOH 302 702 204 HOH HOH A . F 6 HOH 303 703 154 HOH HOH A . F 6 HOH 304 704 356 HOH HOH A . F 6 HOH 305 705 401 HOH HOH A . F 6 HOH 306 706 408 HOH HOH A . F 6 HOH 307 707 348 HOH HOH A . F 6 HOH 308 708 320 HOH HOH A . F 6 HOH 309 709 193 HOH HOH A . F 6 HOH 310 710 147 HOH HOH A . F 6 HOH 311 711 327 HOH HOH A . F 6 HOH 312 712 373 HOH HOH A . F 6 HOH 313 713 139 HOH HOH A . F 6 HOH 314 714 134 HOH HOH A . F 6 HOH 315 715 412 HOH HOH A . F 6 HOH 316 716 424 HOH HOH A . F 6 HOH 317 717 409 HOH HOH A . F 6 HOH 318 718 129 HOH HOH A . F 6 HOH 319 719 297 HOH HOH A . F 6 HOH 320 720 328 HOH HOH A . F 6 HOH 321 721 253 HOH HOH A . F 6 HOH 322 722 359 HOH HOH A . F 6 HOH 323 723 169 HOH HOH A . F 6 HOH 324 724 70 HOH HOH A . F 6 HOH 325 725 340 HOH HOH A . F 6 HOH 326 726 259 HOH HOH A . F 6 HOH 327 727 402 HOH HOH A . F 6 HOH 328 728 176 HOH HOH A . F 6 HOH 329 729 345 HOH HOH A . F 6 HOH 330 730 37 HOH HOH A . F 6 HOH 331 731 414 HOH HOH A . F 6 HOH 332 732 245 HOH HOH A . F 6 HOH 333 733 190 HOH HOH A . F 6 HOH 334 734 410 HOH HOH A . F 6 HOH 335 735 201 HOH HOH A . F 6 HOH 336 736 284 HOH HOH A . F 6 HOH 337 737 224 HOH HOH A . F 6 HOH 338 738 280 HOH HOH A . F 6 HOH 339 739 393 HOH HOH A . F 6 HOH 340 740 270 HOH HOH A . F 6 HOH 341 741 428 HOH HOH A . F 6 HOH 342 742 405 HOH HOH A . F 6 HOH 343 743 144 HOH HOH A . F 6 HOH 344 744 118 HOH HOH A . F 6 HOH 345 745 377 HOH HOH A . F 6 HOH 346 746 427 HOH HOH A . F 6 HOH 347 747 422 HOH HOH A . F 6 HOH 348 748 294 HOH HOH A . F 6 HOH 349 749 221 HOH HOH A . F 6 HOH 350 750 155 HOH HOH A . F 6 HOH 351 751 342 HOH HOH A . F 6 HOH 352 752 363 HOH HOH A . F 6 HOH 353 753 72 HOH HOH A . F 6 HOH 354 754 358 HOH HOH A . F 6 HOH 355 755 276 HOH HOH A . F 6 HOH 356 756 149 HOH HOH A . F 6 HOH 357 757 232 HOH HOH A . F 6 HOH 358 758 228 HOH HOH A . F 6 HOH 359 759 222 HOH HOH A . F 6 HOH 360 760 337 HOH HOH A . F 6 HOH 361 761 336 HOH HOH A . F 6 HOH 362 762 404 HOH HOH A . F 6 HOH 363 763 406 HOH HOH A . F 6 HOH 364 764 69 HOH HOH A . F 6 HOH 365 765 114 HOH HOH A . F 6 HOH 366 766 102 HOH HOH A . F 6 HOH 367 767 54 HOH HOH A . F 6 HOH 368 768 133 HOH HOH A . F 6 HOH 369 769 235 HOH HOH A . F 6 HOH 370 770 283 HOH HOH A . F 6 HOH 371 771 177 HOH HOH A . F 6 HOH 372 772 212 HOH HOH A . F 6 HOH 373 773 368 HOH HOH A . F 6 HOH 374 774 350 HOH HOH A . F 6 HOH 375 775 299 HOH HOH A . F 6 HOH 376 776 227 HOH HOH A . F 6 HOH 377 777 206 HOH HOH A . F 6 HOH 378 778 94 HOH HOH A . F 6 HOH 379 779 288 HOH HOH A . F 6 HOH 380 780 308 HOH HOH A . F 6 HOH 381 781 266 HOH HOH A . F 6 HOH 382 782 394 HOH HOH A . F 6 HOH 383 783 391 HOH HOH A . F 6 HOH 384 784 181 HOH HOH A . F 6 HOH 385 785 257 HOH HOH A . F 6 HOH 386 786 338 HOH HOH A . F 6 HOH 387 787 71 HOH HOH A . F 6 HOH 388 788 425 HOH HOH A . F 6 HOH 389 789 189 HOH HOH A . F 6 HOH 390 790 415 HOH HOH A . F 6 HOH 391 791 223 HOH HOH A . F 6 HOH 392 792 60 HOH HOH A . F 6 HOH 393 793 423 HOH HOH A . F 6 HOH 394 794 351 HOH HOH A . F 6 HOH 395 795 324 HOH HOH A . F 6 HOH 396 796 195 HOH HOH A . F 6 HOH 397 797 248 HOH HOH A . F 6 HOH 398 798 329 HOH HOH A . F 6 HOH 399 799 292 HOH HOH A . G 6 HOH 1 201 322 HOH HOH P . G 6 HOH 2 202 148 HOH HOH P . G 6 HOH 3 203 196 HOH HOH P . G 6 HOH 4 204 61 HOH HOH P . G 6 HOH 5 205 215 HOH HOH P . G 6 HOH 6 206 392 HOH HOH P . G 6 HOH 7 207 136 HOH HOH P . G 6 HOH 8 208 2 HOH HOH P . G 6 HOH 9 209 210 HOH HOH P . G 6 HOH 10 210 243 HOH HOH P . G 6 HOH 11 211 247 HOH HOH P . G 6 HOH 12 212 386 HOH HOH P . G 6 HOH 13 213 132 HOH HOH P . G 6 HOH 14 214 314 HOH HOH P . G 6 HOH 15 215 77 HOH HOH P . G 6 HOH 16 216 112 HOH HOH P . G 6 HOH 17 217 51 HOH HOH P . G 6 HOH 18 218 416 HOH HOH P . G 6 HOH 19 219 396 HOH HOH P . G 6 HOH 20 220 399 HOH HOH P . G 6 HOH 21 221 289 HOH HOH P . G 6 HOH 22 222 426 HOH HOH P . G 6 HOH 23 223 249 HOH HOH P . G 6 HOH 24 224 303 HOH HOH P . G 6 HOH 25 225 366 HOH HOH P . G 6 HOH 26 226 293 HOH HOH P . G 6 HOH 27 227 390 HOH HOH P . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk ? ? ? ? ? http://www.mrc-lmb.cam.ac.uk/harry/mosflm/ ? MOSFLM ? ? package . 1 ? 'data scaling' ? ? 'Phil Evans' ? 01/02/18 ? ? ? ? http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ? Aimless ? ? program 0.6.3 2 ? phasing ? ? 'Randy J. Read' cimr-phaser@lists.cam.ac.uk 'Sun Dec 24 01:00:17 2017 (svn 8297) (git 7323, 4bfedeba6... )' ? ? ? ? http://www-structmed.cimr.cam.ac.uk/phaser/ ? PHASER ? ? program 2.8.1 3 ? refinement ? ? 'Paul D. Adams' PDAdams@lbl.gov ? ? ? ? C++ http://www.phenix-online.org/ ? PHENIX ? ? package . 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Sep. 1, 2017' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.24 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6G8L _cell.details ? _cell.formula_units_Z ? _cell.length_a 82.258 _cell.length_a_esd ? _cell.length_b 111.969 _cell.length_b_esd ? _cell.length_c 62.650 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6G8L _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6G8L _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.60 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.76 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.095 M HEPES, pH 7.1, 29% PEG 400, 0.19 M CaCl2, 5% glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-04-08 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0332 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, DESY BEAMLINE P11' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0332 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline P11 _diffrn_source.pdbx_synchrotron_site 'PETRA III, DESY' # _reflns.B_iso_Wilson_estimate 9.600 _reflns.entry_id 6G8L _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.370 _reflns.d_resolution_low 66.290 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 60861 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.900 _reflns.pdbx_Rmerge_I_obs 0.133 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 1475 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.140 _reflns.pdbx_Rpim_I_all 0.043 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 602191 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.992 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.370 1.390 ? ? ? ? ? ? 2881 96.000 ? ? ? ? 0.640 ? ? ? ? ? ? ? ? 4.400 ? ? ? ? 0.723 0.327 ? 1 1 0.708 ? 7.500 66.290 ? ? ? ? ? ? 438 99.900 ? ? ? ? 0.118 ? ? ? ? ? ? ? ? 11.400 ? ? ? ? 0.124 0.036 ? 2 1 0.979 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 64.480 _refine.B_iso_mean 14.4806 _refine.B_iso_min 0.850 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6G8L _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.3700 _refine.ls_d_res_low 45.5330 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 60814 _refine.ls_number_reflns_R_free 1523 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6900 _refine.ls_percent_reflns_R_free 2.5000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1362 _refine.ls_R_factor_R_free 0.1572 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1357 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3mhr _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 14.1900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.3700 _refine_hist.d_res_low 45.5330 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 426 _refine_hist.number_atoms_total 2354 _refine_hist.pdbx_number_residues_total 245 _refine_hist.pdbx_B_iso_mean_ligand 17.86 _refine_hist.pdbx_B_iso_mean_solvent 27.59 _refine_hist.pdbx_number_atoms_protein 1925 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.3700 1.4142 5341 . 133 5208 97.0000 . . . 0.2416 0.0000 0.2071 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.4142 1.4648 5461 . 129 5332 100.0000 . . . 0.2127 0.0000 0.1553 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.4648 1.5234 5492 . 152 5340 100.0000 . . . 0.1587 0.0000 0.1253 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.5234 1.5928 5486 . 145 5341 100.0000 . . . 0.1528 0.0000 0.1165 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.5928 1.6767 5492 . 123 5369 100.0000 . . . 0.1391 0.0000 0.1157 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.6767 1.7818 5537 . 148 5389 100.0000 . . . 0.1520 0.0000 0.1252 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.7818 1.9194 5490 . 128 5362 100.0000 . . . 0.1544 0.0000 0.1286 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.9194 2.1125 5568 . 122 5446 100.0000 . . . 0.1531 0.0000 0.1267 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.1125 2.4182 5561 . 150 5411 100.0000 . . . 0.1529 0.0000 0.1203 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.4182 3.0466 5597 . 135 5462 100.0000 . . . 0.1555 0.0000 0.1353 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 3.0466 45.5583 5789 . 158 5631 100.0000 . . . 0.1495 0.0000 0.1509 . . . . . . 11 . . . # _struct.entry_id 6G8L _struct.title '14-3-3sigma in complex with a L132beta3L mutated YAP pS127 phosphopeptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6G8L _struct_keywords.text 'beta amino acid, hippo pathway, YAP/TAZ, ONCOPROTEIN' _struct_keywords.pdbx_keywords ONCOPROTEIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? G N N 6 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP 1433S_HUMAN P31947 ? 1 ;MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPE VREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKK EMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; 1 2 PDB 6G8L 6G8L ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6G8L A 6 ? 236 ? P31947 1 ? 231 ? 1 231 2 2 6G8L P 1 ? 11 ? 6G8L 123 ? 133 ? 123 133 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6G8L GLY A 1 ? UNP P31947 ? ? 'expression tag' -4 1 1 6G8L ALA A 2 ? UNP P31947 ? ? 'expression tag' -3 2 1 6G8L MET A 3 ? UNP P31947 ? ? 'expression tag' -2 3 1 6G8L GLY A 4 ? UNP P31947 ? ? 'expression tag' -1 4 1 6G8L SER A 5 ? UNP P31947 ? ? 'expression tag' 0 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5860 ? 1 MORE -92 ? 1 'SSA (A^2)' 23250 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 7 ? ALA A 21 ? GLU A 2 ALA A 16 1 ? 15 HELX_P HELX_P2 AA2 ARG A 23 ? LYS A 37 ? ARG A 18 LYS A 32 1 ? 15 HELX_P HELX_P3 AA3 SER A 42 ? ASN A 75 ? SER A 37 ASN A 70 1 ? 34 HELX_P HELX_P4 AA4 PRO A 84 ? SER A 110 ? PRO A 79 SER A 105 1 ? 27 HELX_P HELX_P5 AA5 HIS A 111 ? ALA A 116 ? HIS A 106 ALA A 111 1 ? 6 HELX_P HELX_P6 AA6 ASP A 118 ? ALA A 140 ? ASP A 113 ALA A 135 1 ? 23 HELX_P HELX_P7 AA7 ASP A 144 ? MET A 167 ? ASP A 139 MET A 162 1 ? 24 HELX_P HELX_P8 AA8 ASN A 171 ? ILE A 188 ? ASN A 166 ILE A 183 1 ? 18 HELX_P HELX_P9 AA9 SER A 191 ? ALA A 208 ? SER A 186 ALA A 203 1 ? 18 HELX_P HELX_P10 AB1 ASP A 209 ? LEU A 213 ? ASP A 204 LEU A 208 5 ? 5 HELX_P HELX_P11 AB2 SER A 214 ? THR A 236 ? SER A 209 THR A 231 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B HIS 4 C A ? ? 1_555 B SEP 5 N ? ? P HIS 126 P SEP 127 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale2 covale both ? B HIS 4 C B ? ? 1_555 B SEP 5 N ? ? P HIS 126 P SEP 127 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale3 covale both ? B SEP 5 C ? ? ? 1_555 B SER 6 N ? ? P SEP 127 P SER 128 1_555 ? ? ? ? ? ? ? 1.318 ? ? covale4 covale both ? B SER 9 C ? ? ? 1_555 B B3L 10 N ? ? P SER 131 P B3L 132 1_555 ? ? ? ? ? ? ? 1.426 ? ? covale5 covale both ? B B3L 10 C ? ? ? 1_555 B GLN 11 N ? ? P B3L 132 P GLN 133 1_555 ? ? ? ? ? ? ? 1.323 ? ? metalc1 metalc ? ? A GLN 13 OE1 A ? ? 1_555 E NA . NA ? ? A GLN 8 A NA 303 4_555 ? ? ? ? ? ? ? 2.680 ? ? metalc2 metalc ? ? A GLN 13 OE1 B ? ? 1_555 E NA . NA ? ? A GLN 8 A NA 303 4_555 ? ? ? ? ? ? ? 2.418 ? ? metalc3 metalc ? ? A GLU 80 OE1 ? ? ? 1_555 D MG . MG ? ? A GLU 75 A MG 302 1_555 ? ? ? ? ? ? ? 2.377 ? ? metalc4 metalc ? ? A LYS 82 O ? ? ? 1_555 E NA . NA ? ? A LYS 77 A NA 303 1_555 ? ? ? ? ? ? ? 2.280 ? ? metalc5 metalc ? ? A GLU 85 OE1 ? ? ? 1_555 E NA . NA ? ? A GLU 80 A NA 303 1_555 ? ? ? ? ? ? ? 2.379 ? ? metalc6 metalc ? ? A GLU 85 OE2 ? ? ? 1_555 E NA . NA ? ? A GLU 80 A NA 303 1_555 ? ? ? ? ? ? ? 2.854 ? ? metalc7 metalc ? ? A GLU 166 O ? ? ? 1_555 D MG . MG ? ? A GLU 161 A MG 302 7_544 ? ? ? ? ? ? ? 2.281 ? ? metalc8 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 520 7_554 ? ? ? ? ? ? ? 2.486 ? ? metalc9 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 571 1_555 ? ? ? ? ? ? ? 2.413 ? ? metalc10 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 618 1_555 ? ? ? ? ? ? ? 2.278 ? ? metalc11 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 664 7_554 ? ? ? ? ? ? ? 2.573 ? ? metalc12 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 678 4_554 ? ? ? ? ? ? ? 2.277 ? ? metalc13 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 303 A HOH 402 4_555 ? ? ? ? ? ? ? 2.638 ? ? metalc14 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 303 A HOH 452 1_555 ? ? ? ? ? ? ? 2.904 ? ? metalc15 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 303 A HOH 654 1_555 ? ? ? ? ? ? ? 2.453 ? ? metalc16 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 303 A HOH 707 1_555 ? ? ? ? ? ? ? 2.667 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 A A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 OE1 B A GLN 13 ? A GLN 8 ? 1_555 19.9 ? 2 OE1 A A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? A LYS 82 ? A LYS 77 ? 1_555 30.2 ? 3 OE1 B A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? A LYS 82 ? A LYS 77 ? 1_555 45.0 ? 4 OE1 A A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 32.3 ? 5 OE1 B A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 46.7 ? 6 O ? A LYS 82 ? A LYS 77 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 2.2 ? 7 OE1 A A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 OE2 ? A GLU 85 ? A GLU 80 ? 1_555 34.6 ? 8 OE1 B A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 OE2 ? A GLU 85 ? A GLU 80 ? 1_555 49.2 ? 9 O ? A LYS 82 ? A LYS 77 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 OE2 ? A GLU 85 ? A GLU 80 ? 1_555 4.4 ? 10 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 OE2 ? A GLU 85 ? A GLU 80 ? 1_555 2.5 ? 11 OE1 A A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 402 ? 4_555 33.8 ? 12 OE1 B A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 402 ? 4_555 49.6 ? 13 O ? A LYS 82 ? A LYS 77 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 402 ? 4_555 5.2 ? 14 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 402 ? 4_555 4.7 ? 15 OE2 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 402 ? 4_555 3.6 ? 16 OE1 A A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 452 ? 1_555 34.9 ? 17 OE1 B A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 452 ? 1_555 49.2 ? 18 O ? A LYS 82 ? A LYS 77 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 452 ? 1_555 4.7 ? 19 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 452 ? 1_555 2.6 ? 20 OE2 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 452 ? 1_555 0.7 ? 21 O ? F HOH . ? A HOH 402 ? 4_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 452 ? 1_555 4.3 ? 22 OE1 A A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 654 ? 1_555 32.5 ? 23 OE1 B A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 654 ? 1_555 47.6 ? 24 O ? A LYS 82 ? A LYS 77 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 654 ? 1_555 2.6 ? 25 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 654 ? 1_555 1.9 ? 26 OE2 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 654 ? 1_555 2.2 ? 27 O ? F HOH . ? A HOH 402 ? 4_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 654 ? 1_555 2.9 ? 28 O ? F HOH . ? A HOH 452 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 654 ? 1_555 2.8 ? 29 OE1 A A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 707 ? 1_555 34.6 ? 30 OE1 B A GLN 13 ? A GLN 8 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 707 ? 1_555 50.2 ? 31 O ? A LYS 82 ? A LYS 77 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 707 ? 1_555 5.4 ? 32 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 707 ? 1_555 4.5 ? 33 OE2 ? A GLU 85 ? A GLU 80 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 707 ? 1_555 2.9 ? 34 O ? F HOH . ? A HOH 402 ? 4_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 707 ? 1_555 1.0 ? 35 O ? F HOH . ? A HOH 452 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 707 ? 1_555 3.5 ? 36 O ? F HOH . ? A HOH 654 ? 1_555 NA ? E NA . ? A NA 303 ? 4_555 O ? F HOH . ? A HOH 707 ? 1_555 2.8 ? 37 OE1 ? A GLU 80 ? A GLU 75 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? A GLU 166 ? A GLU 161 ? 1_555 68.6 ? 38 OE1 ? A GLU 80 ? A GLU 75 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 520 ? 7_554 96.3 ? 39 O ? A GLU 166 ? A GLU 161 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 520 ? 7_554 160.1 ? 40 OE1 ? A GLU 80 ? A GLU 75 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 571 ? 1_555 94.1 ? 41 O ? A GLU 166 ? A GLU 161 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 571 ? 1_555 27.5 ? 42 O ? F HOH . ? A HOH 520 ? 7_554 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 571 ? 1_555 153.9 ? 43 OE1 ? A GLU 80 ? A GLU 75 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 618 ? 1_555 77.8 ? 44 O ? A GLU 166 ? A GLU 161 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 618 ? 1_555 46.5 ? 45 O ? F HOH . ? A HOH 520 ? 7_554 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 618 ? 1_555 145.7 ? 46 O ? F HOH . ? A HOH 571 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 618 ? 1_555 60.1 ? 47 OE1 ? A GLU 80 ? A GLU 75 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 664 ? 7_554 156.1 ? 48 O ? A GLU 166 ? A GLU 161 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 664 ? 7_554 107.6 ? 49 O ? F HOH . ? A HOH 520 ? 7_554 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 664 ? 7_554 80.6 ? 50 O ? F HOH . ? A HOH 571 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 664 ? 7_554 80.2 ? 51 O ? F HOH . ? A HOH 618 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 664 ? 7_554 117.6 ? 52 OE1 ? A GLU 80 ? A GLU 75 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 678 ? 4_554 128.5 ? 53 O ? A GLU 166 ? A GLU 161 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 678 ? 4_554 117.4 ? 54 O ? F HOH . ? A HOH 520 ? 7_554 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 678 ? 4_554 82.0 ? 55 O ? F HOH . ? A HOH 571 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 678 ? 4_554 109.6 ? 56 O ? F HOH . ? A HOH 618 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 678 ? 4_554 76.1 ? 57 O ? F HOH . ? A HOH 664 ? 7_554 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 678 ? 4_554 74.8 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 110 A . ? SER 105 A HIS 111 A ? HIS 106 A 1 8.78 2 SER 110 A . ? SER 105 A HIS 111 A ? HIS 106 A 1 3.24 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 301 ? 2 'binding site for residue CL A 301' AC2 Software A MG 302 ? 7 'binding site for residue MG A 302' AC3 Software A NA 303 ? 7 'binding site for residue NA A 303' AC4 Software P B3L 132 ? 11 'binding site for Ligand residues B3L P 132 through GLN P 133 bound to SER P 131' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 LYS A 14 ? LYS A 9 . ? 4_555 ? 2 AC1 2 HOH F . ? HOH A 744 . ? 1_555 ? 3 AC2 7 GLU A 80 ? GLU A 75 . ? 1_555 ? 4 AC2 7 GLU A 166 ? GLU A 161 . ? 7_554 ? 5 AC2 7 HOH F . ? HOH A 520 . ? 7_554 ? 6 AC2 7 HOH F . ? HOH A 571 . ? 1_555 ? 7 AC2 7 HOH F . ? HOH A 618 . ? 1_555 ? 8 AC2 7 HOH F . ? HOH A 664 . ? 7_554 ? 9 AC2 7 HOH F . ? HOH A 678 . ? 4_554 ? 10 AC3 7 GLN A 13 ? GLN A 8 . ? 4_555 ? 11 AC3 7 LYS A 82 ? LYS A 77 . ? 1_555 ? 12 AC3 7 GLU A 85 ? GLU A 80 . ? 1_555 ? 13 AC3 7 HOH F . ? HOH A 402 . ? 4_555 ? 14 AC3 7 HOH F . ? HOH A 452 . ? 1_555 ? 15 AC3 7 HOH F . ? HOH A 654 . ? 1_555 ? 16 AC3 7 HOH F . ? HOH A 707 . ? 1_555 ? 17 AC4 11 ASN A 47 ? ASN A 42 . ? 1_555 ? 18 AC4 11 GLU A 120 ? GLU A 115 . ? 1_555 ? 19 AC4 11 ASN A 171 ? ASN A 166 . ? 1_555 ? 20 AC4 11 PRO A 172 ? PRO A 167 . ? 1_555 ? 21 AC4 11 ILE A 224 ? ILE A 219 . ? 1_555 ? 22 AC4 11 SER B 6 ? SER P 128 . ? 1_555 ? 23 AC4 11 ALA B 8 ? ALA P 130 . ? 1_555 ? 24 AC4 11 SER B 9 ? SER P 131 . ? 1_555 ? 25 AC4 11 HOH G . ? HOH P 201 . ? 1_555 ? 26 AC4 11 HOH G . ? HOH P 202 . ? 1_555 ? 27 AC4 11 HOH G . ? HOH P 205 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 405 ? ? O A HOH 633 ? ? 1.89 2 1 O A HOH 663 ? ? O A HOH 711 ? ? 1.93 3 1 O A HOH 593 ? ? O A HOH 715 ? ? 1.94 4 1 O A HOH 782 ? ? O A HOH 784 ? ? 1.94 5 1 O A HOH 502 ? ? O A HOH 753 ? ? 2.00 6 1 O A HOH 413 ? ? O A HOH 672 ? ? 2.00 7 1 O A HOH 607 ? ? O A HOH 622 ? ? 2.02 8 1 O A HOH 756 ? ? O A HOH 782 ? ? 2.04 9 1 O A HOH 731 ? ? O A HOH 773 ? ? 2.05 10 1 O A HOH 601 ? ? O A HOH 739 ? ? 2.06 11 1 O A HOH 650 ? ? O A HOH 659 ? ? 2.07 12 1 OG A SER 105 ? B O A HOH 401 ? ? 2.08 13 1 OE1 A GLN 8 ? B O A HOH 402 ? ? 2.09 14 1 O A HOH 414 ? ? O A HOH 653 ? ? 2.11 15 1 NH2 A ARG 142 ? A O A HOH 403 ? ? 2.11 16 1 O A HOH 415 ? ? O A HOH 456 ? ? 2.11 17 1 O A HOH 741 ? ? O A HOH 747 ? ? 2.11 18 1 OE1 A GLU 110 ? B O A HOH 404 ? ? 2.13 19 1 O A HOH 415 ? ? O A HOH 484 ? ? 2.14 20 1 O A HOH 642 ? ? O A HOH 703 ? ? 2.16 21 1 O A HOH 434 ? ? O A HOH 512 ? ? 2.17 22 1 O A ALA -3 ? ? O A HOH 405 ? ? 2.17 23 1 O A HOH 603 ? ? O A HOH 615 ? ? 2.18 24 1 O P HOH 206 ? ? O P HOH 211 ? ? 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 402 ? ? 1_555 O A HOH 707 ? ? 4_555 1.91 2 1 O A HOH 479 ? ? 1_555 O A HOH 619 ? ? 6_544 2.03 3 1 O A HOH 711 ? ? 1_555 O A HOH 762 ? ? 3_655 2.07 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 P _pdbx_validate_rmsd_angle.auth_comp_id_1 B3L _pdbx_validate_rmsd_angle.auth_seq_id_1 132 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 C _pdbx_validate_rmsd_angle.auth_asym_id_2 P _pdbx_validate_rmsd_angle.auth_comp_id_2 B3L _pdbx_validate_rmsd_angle.auth_seq_id_2 132 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 N _pdbx_validate_rmsd_angle.auth_asym_id_3 P _pdbx_validate_rmsd_angle.auth_comp_id_3 GLN _pdbx_validate_rmsd_angle.auth_seq_id_3 133 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 135.33 _pdbx_validate_rmsd_angle.angle_target_value 117.20 _pdbx_validate_rmsd_angle.angle_deviation 18.13 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.20 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 18 ? ? -105.86 73.97 2 1 HIS A 106 ? ? -145.87 37.81 3 1 HIS A 106 ? ? -142.95 37.81 4 1 THR A 136 ? ? -140.20 -11.08 5 1 B3L P 132 ? ? -113.56 -89.81 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 B3L _pdbx_validate_peptide_omega.auth_asym_id_1 P _pdbx_validate_peptide_omega.auth_seq_id_1 132 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLN _pdbx_validate_peptide_omega.auth_asym_id_2 P _pdbx_validate_peptide_omega.auth_seq_id_2 133 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -127.88 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id B3L _pdbx_validate_main_chain_plane.auth_asym_id P _pdbx_validate_main_chain_plane.auth_seq_id 132 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle 32.23 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 419 ? F HOH . 2 1 A HOH 425 ? F HOH . # _pdbx_phasing_MR.entry_id 6G8L _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 5.300 _pdbx_phasing_MR.d_res_low_rotation 45.530 _pdbx_phasing_MR.d_res_high_translation 5.300 _pdbx_phasing_MR.d_res_low_translation 45.530 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 798 ? 6.35 . 2 1 O ? A HOH 799 ? 6.44 . 3 1 O ? P HOH 227 ? 9.37 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 P ACE 123 ? B ACE 1 2 1 Y 1 P ARG 124 ? B ARG 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 B3L O O N N 81 B3L C C N N 82 B3L CB C N N 83 B3L CA C N S 84 B3L N N N N 85 B3L CG C N N 86 B3L CD C N N 87 B3L CE2 C N N 88 B3L CE1 C N N 89 B3L HB1 H N N 90 B3L HB2 H N N 91 B3L HA H N N 92 B3L H H N N 93 B3L HG H N N 94 B3L HGA H N N 95 B3L HD H N N 96 B3L H3E2 H N N 97 B3L H2E2 H N N 98 B3L H1E2 H N N 99 B3L H3E1 H N N 100 B3L H2E1 H N N 101 B3L H1E1 H N N 102 B3L OXT O N N 103 B3L H2 H N N 104 B3L HXT H N N 105 CL CL CL N N 106 CYS N N N N 107 CYS CA C N R 108 CYS C C N N 109 CYS O O N N 110 CYS CB C N N 111 CYS SG S N N 112 CYS OXT O N N 113 CYS H H N N 114 CYS H2 H N N 115 CYS HA H N N 116 CYS HB2 H N N 117 CYS HB3 H N N 118 CYS HG H N N 119 CYS HXT H N N 120 GLN N N N N 121 GLN CA C N S 122 GLN C C N N 123 GLN O O N N 124 GLN CB C N N 125 GLN CG C N N 126 GLN CD C N N 127 GLN OE1 O N N 128 GLN NE2 N N N 129 GLN OXT O N N 130 GLN H H N N 131 GLN H2 H N N 132 GLN HA H N N 133 GLN HB2 H N N 134 GLN HB3 H N N 135 GLN HG2 H N N 136 GLN HG3 H N N 137 GLN HE21 H N N 138 GLN HE22 H N N 139 GLN HXT H N N 140 GLU N N N N 141 GLU CA C N S 142 GLU C C N N 143 GLU O O N N 144 GLU CB C N N 145 GLU CG C N N 146 GLU CD C N N 147 GLU OE1 O N N 148 GLU OE2 O N N 149 GLU OXT O N N 150 GLU H H N N 151 GLU H2 H N N 152 GLU HA H N N 153 GLU HB2 H N N 154 GLU HB3 H N N 155 GLU HG2 H N N 156 GLU HG3 H N N 157 GLU HE2 H N N 158 GLU HXT H N N 159 GLY N N N N 160 GLY CA C N N 161 GLY C C N N 162 GLY O O N N 163 GLY OXT O N N 164 GLY H H N N 165 GLY H2 H N N 166 GLY HA2 H N N 167 GLY HA3 H N N 168 GLY HXT H N N 169 HIS N N N N 170 HIS CA C N S 171 HIS C C N N 172 HIS O O N N 173 HIS CB C N N 174 HIS CG C Y N 175 HIS ND1 N Y N 176 HIS CD2 C Y N 177 HIS CE1 C Y N 178 HIS NE2 N Y N 179 HIS OXT O N N 180 HIS H H N N 181 HIS H2 H N N 182 HIS HA H N N 183 HIS HB2 H N N 184 HIS HB3 H N N 185 HIS HD1 H N N 186 HIS HD2 H N N 187 HIS HE1 H N N 188 HIS HE2 H N N 189 HIS HXT H N N 190 HOH O O N N 191 HOH H1 H N N 192 HOH H2 H N N 193 ILE N N N N 194 ILE CA C N S 195 ILE C C N N 196 ILE O O N N 197 ILE CB C N S 198 ILE CG1 C N N 199 ILE CG2 C N N 200 ILE CD1 C N N 201 ILE OXT O N N 202 ILE H H N N 203 ILE H2 H N N 204 ILE HA H N N 205 ILE HB H N N 206 ILE HG12 H N N 207 ILE HG13 H N N 208 ILE HG21 H N N 209 ILE HG22 H N N 210 ILE HG23 H N N 211 ILE HD11 H N N 212 ILE HD12 H N N 213 ILE HD13 H N N 214 ILE HXT H N N 215 LEU N N N N 216 LEU CA C N S 217 LEU C C N N 218 LEU O O N N 219 LEU CB C N N 220 LEU CG C N N 221 LEU CD1 C N N 222 LEU CD2 C N N 223 LEU OXT O N N 224 LEU H H N N 225 LEU H2 H N N 226 LEU HA H N N 227 LEU HB2 H N N 228 LEU HB3 H N N 229 LEU HG H N N 230 LEU HD11 H N N 231 LEU HD12 H N N 232 LEU HD13 H N N 233 LEU HD21 H N N 234 LEU HD22 H N N 235 LEU HD23 H N N 236 LEU HXT H N N 237 LYS N N N N 238 LYS CA C N S 239 LYS C C N N 240 LYS O O N N 241 LYS CB C N N 242 LYS CG C N N 243 LYS CD C N N 244 LYS CE C N N 245 LYS NZ N N N 246 LYS OXT O N N 247 LYS H H N N 248 LYS H2 H N N 249 LYS HA H N N 250 LYS HB2 H N N 251 LYS HB3 H N N 252 LYS HG2 H N N 253 LYS HG3 H N N 254 LYS HD2 H N N 255 LYS HD3 H N N 256 LYS HE2 H N N 257 LYS HE3 H N N 258 LYS HZ1 H N N 259 LYS HZ2 H N N 260 LYS HZ3 H N N 261 LYS HXT H N N 262 MET N N N N 263 MET CA C N S 264 MET C C N N 265 MET O O N N 266 MET CB C N N 267 MET CG C N N 268 MET SD S N N 269 MET CE C N N 270 MET OXT O N N 271 MET H H N N 272 MET H2 H N N 273 MET HA H N N 274 MET HB2 H N N 275 MET HB3 H N N 276 MET HG2 H N N 277 MET HG3 H N N 278 MET HE1 H N N 279 MET HE2 H N N 280 MET HE3 H N N 281 MET HXT H N N 282 MG MG MG N N 283 NA NA NA N N 284 PHE N N N N 285 PHE CA C N S 286 PHE C C N N 287 PHE O O N N 288 PHE CB C N N 289 PHE CG C Y N 290 PHE CD1 C Y N 291 PHE CD2 C Y N 292 PHE CE1 C Y N 293 PHE CE2 C Y N 294 PHE CZ C Y N 295 PHE OXT O N N 296 PHE H H N N 297 PHE H2 H N N 298 PHE HA H N N 299 PHE HB2 H N N 300 PHE HB3 H N N 301 PHE HD1 H N N 302 PHE HD2 H N N 303 PHE HE1 H N N 304 PHE HE2 H N N 305 PHE HZ H N N 306 PHE HXT H N N 307 PRO N N N N 308 PRO CA C N S 309 PRO C C N N 310 PRO O O N N 311 PRO CB C N N 312 PRO CG C N N 313 PRO CD C N N 314 PRO OXT O N N 315 PRO H H N N 316 PRO HA H N N 317 PRO HB2 H N N 318 PRO HB3 H N N 319 PRO HG2 H N N 320 PRO HG3 H N N 321 PRO HD2 H N N 322 PRO HD3 H N N 323 PRO HXT H N N 324 SEP N N N N 325 SEP CA C N S 326 SEP CB C N N 327 SEP OG O N N 328 SEP C C N N 329 SEP O O N N 330 SEP OXT O N N 331 SEP P P N N 332 SEP O1P O N N 333 SEP O2P O N N 334 SEP O3P O N N 335 SEP H H N N 336 SEP H2 H N N 337 SEP HA H N N 338 SEP HB2 H N N 339 SEP HB3 H N N 340 SEP HXT H N N 341 SEP HOP2 H N N 342 SEP HOP3 H N N 343 SER N N N N 344 SER CA C N S 345 SER C C N N 346 SER O O N N 347 SER CB C N N 348 SER OG O N N 349 SER OXT O N N 350 SER H H N N 351 SER H2 H N N 352 SER HA H N N 353 SER HB2 H N N 354 SER HB3 H N N 355 SER HG H N N 356 SER HXT H N N 357 THR N N N N 358 THR CA C N S 359 THR C C N N 360 THR O O N N 361 THR CB C N R 362 THR OG1 O N N 363 THR CG2 C N N 364 THR OXT O N N 365 THR H H N N 366 THR H2 H N N 367 THR HA H N N 368 THR HB H N N 369 THR HG1 H N N 370 THR HG21 H N N 371 THR HG22 H N N 372 THR HG23 H N N 373 THR HXT H N N 374 TRP N N N N 375 TRP CA C N S 376 TRP C C N N 377 TRP O O N N 378 TRP CB C N N 379 TRP CG C Y N 380 TRP CD1 C Y N 381 TRP CD2 C Y N 382 TRP NE1 N Y N 383 TRP CE2 C Y N 384 TRP CE3 C Y N 385 TRP CZ2 C Y N 386 TRP CZ3 C Y N 387 TRP CH2 C Y N 388 TRP OXT O N N 389 TRP H H N N 390 TRP H2 H N N 391 TRP HA H N N 392 TRP HB2 H N N 393 TRP HB3 H N N 394 TRP HD1 H N N 395 TRP HE1 H N N 396 TRP HE3 H N N 397 TRP HZ2 H N N 398 TRP HZ3 H N N 399 TRP HH2 H N N 400 TRP HXT H N N 401 TYR N N N N 402 TYR CA C N S 403 TYR C C N N 404 TYR O O N N 405 TYR CB C N N 406 TYR CG C Y N 407 TYR CD1 C Y N 408 TYR CD2 C Y N 409 TYR CE1 C Y N 410 TYR CE2 C Y N 411 TYR CZ C Y N 412 TYR OH O N N 413 TYR OXT O N N 414 TYR H H N N 415 TYR H2 H N N 416 TYR HA H N N 417 TYR HB2 H N N 418 TYR HB3 H N N 419 TYR HD1 H N N 420 TYR HD2 H N N 421 TYR HE1 H N N 422 TYR HE2 H N N 423 TYR HH H N N 424 TYR HXT H N N 425 VAL N N N N 426 VAL CA C N S 427 VAL C C N N 428 VAL O O N N 429 VAL CB C N N 430 VAL CG1 C N N 431 VAL CG2 C N N 432 VAL OXT O N N 433 VAL H H N N 434 VAL H2 H N N 435 VAL HA H N N 436 VAL HB H N N 437 VAL HG11 H N N 438 VAL HG12 H N N 439 VAL HG13 H N N 440 VAL HG21 H N N 441 VAL HG22 H N N 442 VAL HG23 H N N 443 VAL HXT H N N 444 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 B3L C O doub N N 76 B3L C OXT sing N N 77 B3L CB C sing N N 78 B3L CA CB sing N N 79 B3L CA HA sing N N 80 B3L N CA sing N N 81 B3L N H2 sing N N 82 B3L CG CA sing N N 83 B3L CG HG sing N N 84 B3L CD CG sing N N 85 B3L CD CE1 sing N N 86 B3L CE2 CD sing N N 87 B3L CE2 H1E2 sing N N 88 B3L CE1 H1E1 sing N N 89 B3L CE1 H3E1 sing N N 90 B3L HB1 CB sing N N 91 B3L HB2 CB sing N N 92 B3L H N sing N N 93 B3L HGA CG sing N N 94 B3L HD CD sing N N 95 B3L H3E2 CE2 sing N N 96 B3L H2E2 CE2 sing N N 97 B3L H2E1 CE1 sing N N 98 B3L OXT HXT sing N N 99 CYS N CA sing N N 100 CYS N H sing N N 101 CYS N H2 sing N N 102 CYS CA C sing N N 103 CYS CA CB sing N N 104 CYS CA HA sing N N 105 CYS C O doub N N 106 CYS C OXT sing N N 107 CYS CB SG sing N N 108 CYS CB HB2 sing N N 109 CYS CB HB3 sing N N 110 CYS SG HG sing N N 111 CYS OXT HXT sing N N 112 GLN N CA sing N N 113 GLN N H sing N N 114 GLN N H2 sing N N 115 GLN CA C sing N N 116 GLN CA CB sing N N 117 GLN CA HA sing N N 118 GLN C O doub N N 119 GLN C OXT sing N N 120 GLN CB CG sing N N 121 GLN CB HB2 sing N N 122 GLN CB HB3 sing N N 123 GLN CG CD sing N N 124 GLN CG HG2 sing N N 125 GLN CG HG3 sing N N 126 GLN CD OE1 doub N N 127 GLN CD NE2 sing N N 128 GLN NE2 HE21 sing N N 129 GLN NE2 HE22 sing N N 130 GLN OXT HXT sing N N 131 GLU N CA sing N N 132 GLU N H sing N N 133 GLU N H2 sing N N 134 GLU CA C sing N N 135 GLU CA CB sing N N 136 GLU CA HA sing N N 137 GLU C O doub N N 138 GLU C OXT sing N N 139 GLU CB CG sing N N 140 GLU CB HB2 sing N N 141 GLU CB HB3 sing N N 142 GLU CG CD sing N N 143 GLU CG HG2 sing N N 144 GLU CG HG3 sing N N 145 GLU CD OE1 doub N N 146 GLU CD OE2 sing N N 147 GLU OE2 HE2 sing N N 148 GLU OXT HXT sing N N 149 GLY N CA sing N N 150 GLY N H sing N N 151 GLY N H2 sing N N 152 GLY CA C sing N N 153 GLY CA HA2 sing N N 154 GLY CA HA3 sing N N 155 GLY C O doub N N 156 GLY C OXT sing N N 157 GLY OXT HXT sing N N 158 HIS N CA sing N N 159 HIS N H sing N N 160 HIS N H2 sing N N 161 HIS CA C sing N N 162 HIS CA CB sing N N 163 HIS CA HA sing N N 164 HIS C O doub N N 165 HIS C OXT sing N N 166 HIS CB CG sing N N 167 HIS CB HB2 sing N N 168 HIS CB HB3 sing N N 169 HIS CG ND1 sing Y N 170 HIS CG CD2 doub Y N 171 HIS ND1 CE1 doub Y N 172 HIS ND1 HD1 sing N N 173 HIS CD2 NE2 sing Y N 174 HIS CD2 HD2 sing N N 175 HIS CE1 NE2 sing Y N 176 HIS CE1 HE1 sing N N 177 HIS NE2 HE2 sing N N 178 HIS OXT HXT sing N N 179 HOH O H1 sing N N 180 HOH O H2 sing N N 181 ILE N CA sing N N 182 ILE N H sing N N 183 ILE N H2 sing N N 184 ILE CA C sing N N 185 ILE CA CB sing N N 186 ILE CA HA sing N N 187 ILE C O doub N N 188 ILE C OXT sing N N 189 ILE CB CG1 sing N N 190 ILE CB CG2 sing N N 191 ILE CB HB sing N N 192 ILE CG1 CD1 sing N N 193 ILE CG1 HG12 sing N N 194 ILE CG1 HG13 sing N N 195 ILE CG2 HG21 sing N N 196 ILE CG2 HG22 sing N N 197 ILE CG2 HG23 sing N N 198 ILE CD1 HD11 sing N N 199 ILE CD1 HD12 sing N N 200 ILE CD1 HD13 sing N N 201 ILE OXT HXT sing N N 202 LEU N CA sing N N 203 LEU N H sing N N 204 LEU N H2 sing N N 205 LEU CA C sing N N 206 LEU CA CB sing N N 207 LEU CA HA sing N N 208 LEU C O doub N N 209 LEU C OXT sing N N 210 LEU CB CG sing N N 211 LEU CB HB2 sing N N 212 LEU CB HB3 sing N N 213 LEU CG CD1 sing N N 214 LEU CG CD2 sing N N 215 LEU CG HG sing N N 216 LEU CD1 HD11 sing N N 217 LEU CD1 HD12 sing N N 218 LEU CD1 HD13 sing N N 219 LEU CD2 HD21 sing N N 220 LEU CD2 HD22 sing N N 221 LEU CD2 HD23 sing N N 222 LEU OXT HXT sing N N 223 LYS N CA sing N N 224 LYS N H sing N N 225 LYS N H2 sing N N 226 LYS CA C sing N N 227 LYS CA CB sing N N 228 LYS CA HA sing N N 229 LYS C O doub N N 230 LYS C OXT sing N N 231 LYS CB CG sing N N 232 LYS CB HB2 sing N N 233 LYS CB HB3 sing N N 234 LYS CG CD sing N N 235 LYS CG HG2 sing N N 236 LYS CG HG3 sing N N 237 LYS CD CE sing N N 238 LYS CD HD2 sing N N 239 LYS CD HD3 sing N N 240 LYS CE NZ sing N N 241 LYS CE HE2 sing N N 242 LYS CE HE3 sing N N 243 LYS NZ HZ1 sing N N 244 LYS NZ HZ2 sing N N 245 LYS NZ HZ3 sing N N 246 LYS OXT HXT sing N N 247 MET N CA sing N N 248 MET N H sing N N 249 MET N H2 sing N N 250 MET CA C sing N N 251 MET CA CB sing N N 252 MET CA HA sing N N 253 MET C O doub N N 254 MET C OXT sing N N 255 MET CB CG sing N N 256 MET CB HB2 sing N N 257 MET CB HB3 sing N N 258 MET CG SD sing N N 259 MET CG HG2 sing N N 260 MET CG HG3 sing N N 261 MET SD CE sing N N 262 MET CE HE1 sing N N 263 MET CE HE2 sing N N 264 MET CE HE3 sing N N 265 MET OXT HXT sing N N 266 PHE N CA sing N N 267 PHE N H sing N N 268 PHE N H2 sing N N 269 PHE CA C sing N N 270 PHE CA CB sing N N 271 PHE CA HA sing N N 272 PHE C O doub N N 273 PHE C OXT sing N N 274 PHE CB CG sing N N 275 PHE CB HB2 sing N N 276 PHE CB HB3 sing N N 277 PHE CG CD1 doub Y N 278 PHE CG CD2 sing Y N 279 PHE CD1 CE1 sing Y N 280 PHE CD1 HD1 sing N N 281 PHE CD2 CE2 doub Y N 282 PHE CD2 HD2 sing N N 283 PHE CE1 CZ doub Y N 284 PHE CE1 HE1 sing N N 285 PHE CE2 CZ sing Y N 286 PHE CE2 HE2 sing N N 287 PHE CZ HZ sing N N 288 PHE OXT HXT sing N N 289 PRO N CA sing N N 290 PRO N CD sing N N 291 PRO N H sing N N 292 PRO CA C sing N N 293 PRO CA CB sing N N 294 PRO CA HA sing N N 295 PRO C O doub N N 296 PRO C OXT sing N N 297 PRO CB CG sing N N 298 PRO CB HB2 sing N N 299 PRO CB HB3 sing N N 300 PRO CG CD sing N N 301 PRO CG HG2 sing N N 302 PRO CG HG3 sing N N 303 PRO CD HD2 sing N N 304 PRO CD HD3 sing N N 305 PRO OXT HXT sing N N 306 SEP N CA sing N N 307 SEP N H sing N N 308 SEP N H2 sing N N 309 SEP CA CB sing N N 310 SEP CA C sing N N 311 SEP CA HA sing N N 312 SEP CB OG sing N N 313 SEP CB HB2 sing N N 314 SEP CB HB3 sing N N 315 SEP OG P sing N N 316 SEP C O doub N N 317 SEP C OXT sing N N 318 SEP OXT HXT sing N N 319 SEP P O1P doub N N 320 SEP P O2P sing N N 321 SEP P O3P sing N N 322 SEP O2P HOP2 sing N N 323 SEP O3P HOP3 sing N N 324 SER N CA sing N N 325 SER N H sing N N 326 SER N H2 sing N N 327 SER CA C sing N N 328 SER CA CB sing N N 329 SER CA HA sing N N 330 SER C O doub N N 331 SER C OXT sing N N 332 SER CB OG sing N N 333 SER CB HB2 sing N N 334 SER CB HB3 sing N N 335 SER OG HG sing N N 336 SER OXT HXT sing N N 337 THR N CA sing N N 338 THR N H sing N N 339 THR N H2 sing N N 340 THR CA C sing N N 341 THR CA CB sing N N 342 THR CA HA sing N N 343 THR C O doub N N 344 THR C OXT sing N N 345 THR CB OG1 sing N N 346 THR CB CG2 sing N N 347 THR CB HB sing N N 348 THR OG1 HG1 sing N N 349 THR CG2 HG21 sing N N 350 THR CG2 HG22 sing N N 351 THR CG2 HG23 sing N N 352 THR OXT HXT sing N N 353 TRP N CA sing N N 354 TRP N H sing N N 355 TRP N H2 sing N N 356 TRP CA C sing N N 357 TRP CA CB sing N N 358 TRP CA HA sing N N 359 TRP C O doub N N 360 TRP C OXT sing N N 361 TRP CB CG sing N N 362 TRP CB HB2 sing N N 363 TRP CB HB3 sing N N 364 TRP CG CD1 doub Y N 365 TRP CG CD2 sing Y N 366 TRP CD1 NE1 sing Y N 367 TRP CD1 HD1 sing N N 368 TRP CD2 CE2 doub Y N 369 TRP CD2 CE3 sing Y N 370 TRP NE1 CE2 sing Y N 371 TRP NE1 HE1 sing N N 372 TRP CE2 CZ2 sing Y N 373 TRP CE3 CZ3 doub Y N 374 TRP CE3 HE3 sing N N 375 TRP CZ2 CH2 doub Y N 376 TRP CZ2 HZ2 sing N N 377 TRP CZ3 CH2 sing Y N 378 TRP CZ3 HZ3 sing N N 379 TRP CH2 HH2 sing N N 380 TRP OXT HXT sing N N 381 TYR N CA sing N N 382 TYR N H sing N N 383 TYR N H2 sing N N 384 TYR CA C sing N N 385 TYR CA CB sing N N 386 TYR CA HA sing N N 387 TYR C O doub N N 388 TYR C OXT sing N N 389 TYR CB CG sing N N 390 TYR CB HB2 sing N N 391 TYR CB HB3 sing N N 392 TYR CG CD1 doub Y N 393 TYR CG CD2 sing Y N 394 TYR CD1 CE1 sing Y N 395 TYR CD1 HD1 sing N N 396 TYR CD2 CE2 doub Y N 397 TYR CD2 HD2 sing N N 398 TYR CE1 CZ doub Y N 399 TYR CE1 HE1 sing N N 400 TYR CE2 CZ sing Y N 401 TYR CE2 HE2 sing N N 402 TYR CZ OH sing N N 403 TYR OH HH sing N N 404 TYR OXT HXT sing N N 405 VAL N CA sing N N 406 VAL N H sing N N 407 VAL N H2 sing N N 408 VAL CA C sing N N 409 VAL CA CB sing N N 410 VAL CA HA sing N N 411 VAL C O doub N N 412 VAL C OXT sing N N 413 VAL CB CG1 sing N N 414 VAL CB CG2 sing N N 415 VAL CB HB sing N N 416 VAL CG1 HG11 sing N N 417 VAL CG1 HG12 sing N N 418 VAL CG1 HG13 sing N N 419 VAL CG2 HG21 sing N N 420 VAL CG2 HG22 sing N N 421 VAL CG2 HG23 sing N N 422 VAL OXT HXT sing N N 423 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Netherlands Organisation for Scientific Research' Netherlands 'ECHO-STIP 717.014.001' 1 'Netherlands Organisation for Scientific Research' Netherlands 'Gravity program 024.001.035' 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id B3L _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id B3L _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3MHR _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6G8L _atom_sites.fract_transf_matrix[1][1] 0.012157 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008931 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015962 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL H MG N NA O P S # loop_ # loop_ #