data_6G8O # _entry.id 6G8O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6G8O pdb_00006g8o 10.2210/pdb6g8o/pdb WWPDB D_1200009291 ? ? BMRB 27432 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 6fxf unspecified BMRB . 27432 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6G8O _pdbx_database_status.recvd_initial_deposition_date 2018-04-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kukuk, L.K.' 1 ? 'Dingley, A.J.' 2 ? 'Koenig, B.W.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 54 _citation.page_last 54 _citation.title 'Structure of the SLy1 SAM homodimer reveals a new interface for SAM domain self-association.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-018-37185-3 _citation.pdbx_database_id_PubMed 30631134 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kukuk, L.' 1 0000-0002-4929-4156 primary 'Dingley, A.J.' 2 0000-0002-6838-5803 primary 'Granzin, J.' 3 0000-0001-6604-950X primary 'Nagel-Steger, L.' 4 0000-0001-5232-2149 primary 'Thiagarajan-Rosenkranz, P.' 5 ? primary 'Ciupka, D.' 6 ? primary 'Hanel, K.' 7 0000-0001-8314-9668 primary 'Batra-Safferling, R.' 8 0000-0002-8597-4335 primary 'Pacheco, V.' 9 ? primary 'Stoldt, M.' 10 0000-0002-5060-4844 primary 'Pfeffer, K.' 11 0000-0002-5652-6330 primary 'Beer-Hammer, S.' 12 0000-0001-6049-0257 primary 'Willbold, D.' 13 0000-0002-0065-7366 primary 'Koenig, B.W.' 14 0000-0002-5300-6276 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6G8O _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6G8O _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SAM and SH3 domain-containing protein 3' _entity.formula_weight 7954.952 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation 'K1G, S68C' _entity.pdbx_fragment 'SAM domain, UNP residues 253-321' _entity.details 'The two chains A and B are cross-linked by an artificial intermonomer disulfide bond at position 68 (320)' # _entity_name_com.entity_id 1 _entity_name_com.name 'SH3 protein expressed in lymphocytes' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGCE _entity_poly.pdbx_seq_one_letter_code_can GPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGCE _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LYS n 1 4 THR n 1 5 LEU n 1 6 HIS n 1 7 GLU n 1 8 LEU n 1 9 LEU n 1 10 GLU n 1 11 ARG n 1 12 ILE n 1 13 GLY n 1 14 LEU n 1 15 GLU n 1 16 GLU n 1 17 HIS n 1 18 THR n 1 19 SER n 1 20 THR n 1 21 LEU n 1 22 LEU n 1 23 LEU n 1 24 ASN n 1 25 GLY n 1 26 TYR n 1 27 GLN n 1 28 THR n 1 29 LEU n 1 30 GLU n 1 31 ASP n 1 32 PHE n 1 33 LYS n 1 34 GLU n 1 35 LEU n 1 36 ARG n 1 37 GLU n 1 38 THR n 1 39 HIS n 1 40 LEU n 1 41 ASN n 1 42 GLU n 1 43 LEU n 1 44 ASN n 1 45 ILE n 1 46 MET n 1 47 ASP n 1 48 PRO n 1 49 GLN n 1 50 HIS n 1 51 ARG n 1 52 ALA n 1 53 LYS n 1 54 LEU n 1 55 LEU n 1 56 THR n 1 57 ALA n 1 58 ALA n 1 59 GLU n 1 60 LEU n 1 61 LEU n 1 62 LEU n 1 63 ASP n 1 64 TYR n 1 65 ASP n 1 66 THR n 1 67 GLY n 1 68 CYS n 1 69 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 69 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Sash3, Sly' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SASH3_MOUSE _struct_ref.pdbx_db_accession Q8K352 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSE _struct_ref.pdbx_align_begin 254 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6G8O A 2 ? 69 ? Q8K352 254 ? 321 ? 2 69 2 1 6G8O B 2 ? 69 ? Q8K352 254 ? 321 ? 2 69 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6G8O GLY A 1 ? UNP Q8K352 ? ? 'expression tag' 1 1 1 6G8O CYS A 68 ? UNP Q8K352 SER 320 'engineered mutation' 68 2 2 6G8O GLY B 1 ? UNP Q8K352 ? ? 'expression tag' 1 3 2 6G8O CYS B 68 ? UNP Q8K352 SER 320 'engineered mutation' 68 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 2 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 2 isotropic 3 1 1 '3D HNCO' 1 isotropic 4 1 1 '3D HNCA' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 7 1 1 '3D CBCA(CO)NH' 1 isotropic 6 1 1 '3D H(CCO)NH' 1 isotropic 9 1 1 '3D C(CO)NH' 1 isotropic 8 1 1 '3D HCCH-TOCSY' 2 isotropic 10 1 1 '3D 1H-15N NOESY' 2 isotropic 11 1 2 '3D 1H-15N NOESY' 2 isotropic 13 1 1 '3D 1H-13C NOESY aliphatic' 2 isotropic 12 1 1 '3D 1H-13C NOESY aromatic' 2 isotropic 14 1 2 '3D 1H-13C NOESY aliphatic' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.098 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label Standard_conditions _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;1.4 mM [U-99% 13C; U-99% 15N] SLy1 SAM domain, 50 mM potassium phosphate, 20 mM NaCl, 0.2 mM EDTA, 0.03 % sodium azide, 93% H2O/7% D2O ; '93% H2O/7% D2O' Sample_1 solution ? 2 ;0.8 mM [U-99% 13C; U-99% 15N] SLy1 SAM domain, 0.8 mM SLy1 SAM domain, 50 mM potassium phosphate, 20 mM sodium chloride, 0.2 mM EDTA, 0.03 % sodium azide, 93% H2O/7% D2O ; '93% H2O/7% D2O' Sample_2 solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 600 ? 2 AVANCE ? Bruker 700 ? # _pdbx_nmr_refine.entry_id 6G8O _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # _pdbx_nmr_ensemble.entry_id 6G8O _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6G8O _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 processing NMRDraw ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'chemical shift assignment' ARIA ? ;Linge, O'Donoghue and Nilges ; 5 'structure calculation' CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 6 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6G8O _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6G8O _struct.title 'Solution structure of the cross-linked SAM domain dimer of murine SLy1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6G8O _struct_keywords.text 'SLy1, SAM, adapter protein, scaffold protein, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 4 ? GLY A 13 ? THR A 4 GLY A 13 1 ? 10 HELX_P HELX_P2 AA2 LEU A 14 ? GLU A 16 ? LEU A 14 GLU A 16 5 ? 3 HELX_P HELX_P3 AA3 HIS A 17 ? ASN A 24 ? HIS A 17 ASN A 24 1 ? 8 HELX_P HELX_P4 AA4 THR A 28 ? LYS A 33 ? THR A 28 LYS A 33 1 ? 6 HELX_P HELX_P5 AA5 ARG A 36 ? ASN A 44 ? ARG A 36 ASN A 44 1 ? 9 HELX_P HELX_P6 AA6 ASP A 47 ? TYR A 64 ? ASP A 47 TYR A 64 1 ? 18 HELX_P HELX_P7 AA7 THR B 4 ? GLY B 13 ? THR B 4 GLY B 13 1 ? 10 HELX_P HELX_P8 AA8 LEU B 14 ? GLU B 16 ? LEU B 14 GLU B 16 5 ? 3 HELX_P HELX_P9 AA9 HIS B 17 ? ASN B 24 ? HIS B 17 ASN B 24 1 ? 8 HELX_P HELX_P10 AB1 THR B 28 ? LYS B 33 ? THR B 28 LYS B 33 1 ? 6 HELX_P HELX_P11 AB2 ARG B 36 ? ASN B 44 ? ARG B 36 ASN B 44 1 ? 9 HELX_P HELX_P12 AB3 ASP B 47 ? TYR B 64 ? ASP B 47 TYR B 64 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 68 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 68 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 68 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 68 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.032 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 6G8O _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 6G8O _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 GLU 69 69 69 GLU GLU A . n B 1 1 GLY 1 1 1 GLY GLY B . n B 1 2 PRO 2 2 2 PRO PRO B . n B 1 3 LYS 3 3 3 LYS LYS B . n B 1 4 THR 4 4 4 THR THR B . n B 1 5 LEU 5 5 5 LEU LEU B . n B 1 6 HIS 6 6 6 HIS HIS B . n B 1 7 GLU 7 7 7 GLU GLU B . n B 1 8 LEU 8 8 8 LEU LEU B . n B 1 9 LEU 9 9 9 LEU LEU B . n B 1 10 GLU 10 10 10 GLU GLU B . n B 1 11 ARG 11 11 11 ARG ARG B . n B 1 12 ILE 12 12 12 ILE ILE B . n B 1 13 GLY 13 13 13 GLY GLY B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 GLU 15 15 15 GLU GLU B . n B 1 16 GLU 16 16 16 GLU GLU B . n B 1 17 HIS 17 17 17 HIS HIS B . n B 1 18 THR 18 18 18 THR THR B . n B 1 19 SER 19 19 19 SER SER B . n B 1 20 THR 20 20 20 THR THR B . n B 1 21 LEU 21 21 21 LEU LEU B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 LEU 23 23 23 LEU LEU B . n B 1 24 ASN 24 24 24 ASN ASN B . n B 1 25 GLY 25 25 25 GLY GLY B . n B 1 26 TYR 26 26 26 TYR TYR B . n B 1 27 GLN 27 27 27 GLN GLN B . n B 1 28 THR 28 28 28 THR THR B . n B 1 29 LEU 29 29 29 LEU LEU B . n B 1 30 GLU 30 30 30 GLU GLU B . n B 1 31 ASP 31 31 31 ASP ASP B . n B 1 32 PHE 32 32 32 PHE PHE B . n B 1 33 LYS 33 33 33 LYS LYS B . n B 1 34 GLU 34 34 34 GLU GLU B . n B 1 35 LEU 35 35 35 LEU LEU B . n B 1 36 ARG 36 36 36 ARG ARG B . n B 1 37 GLU 37 37 37 GLU GLU B . n B 1 38 THR 38 38 38 THR THR B . n B 1 39 HIS 39 39 39 HIS HIS B . n B 1 40 LEU 40 40 40 LEU LEU B . n B 1 41 ASN 41 41 41 ASN ASN B . n B 1 42 GLU 42 42 42 GLU GLU B . n B 1 43 LEU 43 43 43 LEU LEU B . n B 1 44 ASN 44 44 44 ASN ASN B . n B 1 45 ILE 45 45 45 ILE ILE B . n B 1 46 MET 46 46 46 MET MET B . n B 1 47 ASP 47 47 47 ASP ASP B . n B 1 48 PRO 48 48 48 PRO PRO B . n B 1 49 GLN 49 49 49 GLN GLN B . n B 1 50 HIS 50 50 50 HIS HIS B . n B 1 51 ARG 51 51 51 ARG ARG B . n B 1 52 ALA 52 52 52 ALA ALA B . n B 1 53 LYS 53 53 53 LYS LYS B . n B 1 54 LEU 54 54 54 LEU LEU B . n B 1 55 LEU 55 55 55 LEU LEU B . n B 1 56 THR 56 56 56 THR THR B . n B 1 57 ALA 57 57 57 ALA ALA B . n B 1 58 ALA 58 58 58 ALA ALA B . n B 1 59 GLU 59 59 59 GLU GLU B . n B 1 60 LEU 60 60 60 LEU LEU B . n B 1 61 LEU 61 61 61 LEU LEU B . n B 1 62 LEU 62 62 62 LEU LEU B . n B 1 63 ASP 63 63 63 ASP ASP B . n B 1 64 TYR 64 64 64 TYR TYR B . n B 1 65 ASP 65 65 65 ASP ASP B . n B 1 66 THR 66 66 66 THR THR B . n B 1 67 GLY 67 67 67 GLY GLY B . n B 1 68 CYS 68 68 68 CYS CYS B . n B 1 69 GLU 69 69 69 GLU GLU B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2360 ? 1 MORE -13 ? 1 'SSA (A^2)' 6940 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-01-30 2 'Structure model' 1 1 2019-05-08 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_nmr_software 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_database_status 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_nmr_software.name' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_conn.pdbx_dist_value' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'SLy1 SAM domain' 1.4 ? mM '[U-99% 13C; U-99% 15N]' 1 'potassium phosphate' 50 ? mM 'natural abundance' 1 NaCl 20 ? mM 'natural abundance' 1 EDTA 0.2 ? mM 'natural abundance' 1 'sodium azide' 0.03 ? % 'natural abundance' 2 'SLy1 SAM domain' 0.8 ? mM '[U-99% 13C; U-99% 15N]' 2 'potassium phosphate' 50 ? mM 'natural abundance' 2 'sodium chloride' 20 ? mM 'natural abundance' 2 EDTA 0.2 ? mM 'natural abundance' 2 'sodium azide' 0.03 ? % 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 60 ? ? H A TYR 64 ? ? 1.57 2 1 O B LEU 60 ? ? H B TYR 64 ? ? 1.57 3 3 O A LEU 60 ? ? H A TYR 64 ? ? 1.55 4 3 O B LEU 60 ? ? H B TYR 64 ? ? 1.55 5 4 HH12 A ARG 36 ? ? OE2 A GLU 59 ? ? 1.60 6 5 HG1 A THR 28 ? ? OD1 A ASP 31 ? ? 1.60 7 6 HH12 A ARG 36 ? ? OE2 A GLU 59 ? ? 1.59 8 10 O A LEU 60 ? ? H A TYR 64 ? ? 1.57 9 10 O B LEU 60 ? ? H B TYR 64 ? ? 1.57 10 10 HZ1 B LYS 33 ? ? OD2 B ASP 65 ? ? 1.58 11 10 HZ1 A LYS 33 ? ? OD2 A ASP 65 ? ? 1.59 12 11 O B LEU 60 ? ? H B TYR 64 ? ? 1.57 13 11 O A LEU 60 ? ? H A TYR 64 ? ? 1.58 14 14 O A LEU 60 ? ? H A TYR 64 ? ? 1.58 15 14 O B LEU 60 ? ? H B TYR 64 ? ? 1.58 16 14 HG1 B THR 28 ? ? OD1 B ASP 31 ? ? 1.59 17 14 HG1 A THR 28 ? ? OD1 A ASP 31 ? ? 1.59 18 15 O B LEU 60 ? ? H B TYR 64 ? ? 1.56 19 15 O A LEU 60 ? ? H A TYR 64 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 47 ? ? -59.05 102.78 2 1 TYR A 64 ? ? -100.01 44.79 3 1 ASP A 65 ? ? -82.12 41.99 4 1 CYS A 68 ? ? 64.34 169.97 5 1 ASP B 47 ? ? -58.77 102.83 6 1 TYR B 64 ? ? -100.59 44.68 7 1 ASP B 65 ? ? -81.59 41.61 8 1 CYS B 68 ? ? 64.17 169.38 9 2 ASP A 47 ? ? -57.54 104.95 10 2 TYR A 64 ? ? -99.69 52.69 11 2 ASP A 65 ? ? -79.95 48.04 12 2 CYS A 68 ? ? 62.36 171.27 13 2 ASP B 47 ? ? -57.37 104.97 14 2 TYR B 64 ? ? -100.05 52.54 15 2 ASP B 65 ? ? -79.58 48.00 16 2 CYS B 68 ? ? 62.11 171.07 17 3 ASP A 47 ? ? -57.44 108.49 18 3 TYR A 64 ? ? -99.03 51.48 19 3 ASP A 65 ? ? -86.09 33.79 20 3 CYS A 68 ? ? 61.94 172.66 21 3 ASP B 47 ? ? -57.50 108.32 22 3 TYR B 64 ? ? -98.94 51.45 23 3 ASP B 65 ? ? -85.65 33.46 24 3 CYS B 68 ? ? 61.76 172.34 25 4 ASP A 47 ? ? -55.33 105.16 26 4 TYR A 64 ? ? -96.97 52.90 27 4 ASP A 65 ? ? -78.01 43.50 28 4 CYS A 68 ? ? 63.58 166.04 29 4 ASP B 47 ? ? -55.10 105.06 30 4 TYR B 64 ? ? -96.67 52.93 31 4 ASP B 65 ? ? -77.77 43.24 32 4 CYS B 68 ? ? 63.49 165.78 33 5 TYR A 64 ? ? -100.05 48.41 34 5 ASP A 65 ? ? -80.68 37.06 35 5 CYS A 68 ? ? 65.81 159.73 36 5 TYR B 64 ? ? -100.05 48.47 37 5 ASP B 65 ? ? -80.98 37.41 38 5 CYS B 68 ? ? 65.73 159.49 39 6 ASP A 47 ? ? -58.87 102.92 40 6 TYR A 64 ? ? -83.74 48.83 41 6 ASP A 65 ? ? -80.96 47.47 42 6 CYS A 68 ? ? 63.32 164.91 43 6 ASP B 47 ? ? -58.24 102.89 44 6 TYR B 64 ? ? -84.13 48.70 45 6 ASP B 65 ? ? -80.82 47.27 46 6 CYS B 68 ? ? 63.61 164.65 47 7 TYR A 64 ? ? -107.05 48.54 48 7 ASP A 65 ? ? -79.37 35.63 49 7 CYS A 68 ? ? 62.71 161.63 50 7 ASP B 47 ? ? -59.71 109.91 51 7 TYR B 64 ? ? -107.28 48.62 52 7 ASP B 65 ? ? -79.34 35.12 53 7 CYS B 68 ? ? 62.98 161.43 54 8 ILE A 45 ? ? -100.69 77.25 55 8 ASP A 65 ? ? -78.84 48.99 56 8 CYS A 68 ? ? 63.14 174.94 57 8 ILE B 45 ? ? -100.26 77.06 58 8 ASP B 65 ? ? -78.83 49.14 59 8 CYS B 68 ? ? 62.82 174.55 60 9 CYS A 68 ? ? 59.77 -171.52 61 9 CYS B 68 ? ? 59.40 -171.17 62 10 ASP A 47 ? ? -58.15 107.01 63 10 TYR A 64 ? ? -93.04 47.91 64 10 CYS A 68 ? ? 62.57 178.36 65 10 ASP B 47 ? ? -58.40 106.81 66 10 TYR B 64 ? ? -93.14 48.12 67 10 CYS B 68 ? ? 62.77 178.07 68 11 ASP A 47 ? ? -51.71 105.95 69 11 TYR A 64 ? ? -106.24 41.83 70 11 ASP A 65 ? ? -80.96 39.52 71 11 CYS A 68 ? ? 66.85 159.28 72 11 ASP B 47 ? ? -51.33 105.90 73 11 TYR B 64 ? ? -105.91 41.65 74 11 ASP B 65 ? ? -80.76 39.38 75 11 CYS B 68 ? ? 66.47 159.04 76 12 TYR A 64 ? ? -97.18 49.52 77 12 CYS A 68 ? ? 61.29 171.30 78 12 TYR B 64 ? ? -97.28 49.26 79 12 CYS B 68 ? ? 61.48 171.24 80 13 ASP A 47 ? ? -50.58 105.63 81 13 TYR A 64 ? ? -98.04 41.44 82 13 ASP A 65 ? ? -78.45 44.09 83 13 CYS A 68 ? ? 61.60 176.81 84 13 ASP B 47 ? ? -50.29 105.66 85 13 TYR B 64 ? ? -97.89 41.51 86 13 ASP B 65 ? ? -78.58 44.17 87 13 CYS B 68 ? ? 61.55 176.50 88 14 ASP A 65 ? ? -78.91 42.81 89 14 CYS A 68 ? ? 63.22 163.79 90 14 ASP B 65 ? ? -78.90 42.50 91 14 CYS B 68 ? ? 63.62 163.92 92 15 TYR A 64 ? ? -104.81 44.28 93 15 TYR B 64 ? ? -104.70 44.26 # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'equilibrium centrifugation' ? 2 1 'gel filtration' ? 3 1 'native gel electrophoresis' ? #