data_6GDZ # _entry.id 6GDZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.308 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6GDZ WWPDB D_1200009451 BMRB 34264 # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'exendin-4 based dual GLP-1/glucagon receptor agonist' _pdbx_database_related.db_id 34264 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6GDZ _pdbx_database_status.recvd_initial_deposition_date 2018-04-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Evers, A.' 1 ? 'Kurz, M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Med. Chem.' _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 1520-4804 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 61 _citation.language ? _citation.page_first 5580 _citation.page_last 5593 _citation.title 'Dual Glucagon-like Peptide 1 (GLP-1)/Glucagon Receptor Agonists Specifically Optimized for Multidose Formulations.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.8b00292 _citation.pdbx_database_id_PubMed 29879354 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Evers, A.' 1 ? primary 'Bossart, M.' 2 ? primary 'Pfeiffer-Marek, S.' 3 ? primary 'Elvert, R.' 4 ? primary 'Schreuder, H.' 5 ? primary 'Kurz, M.' 6 ? primary 'Stengelin, S.' 7 ? primary 'Lorenz, M.' 8 ? primary 'Herling, A.' 9 ? primary 'Konkar, A.' 10 ? primary 'Lukasczyk, U.' 11 ? primary 'Pfenninger, A.' 12 ? primary 'Lorenz, K.' 13 ? primary 'Haack, T.' 14 ? primary 'Kadereit, D.' 15 ? primary 'Wagner, M.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn Exendin-4 4142.586 1 ? ? ? ? 2 non-polymer syn '(2~{S})-2-[[(4~{S})-4-(hexadecanoylamino)-5-oxidanyl-5-oxidanylidene-pentanoyl]amino]pentanedioic acid' 514.652 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'H(AIB)QGTFTSDLSKQKDEQRAKLFIEWL(AIB)AGGPSSGAPPPS(NH2)' _entity_poly.pdbx_seq_one_letter_code_can HAQGTFTSDLSKQKDEQRAKLFIEWLAAGGPSSGAPPPSX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 AIB n 1 3 GLN n 1 4 GLY n 1 5 THR n 1 6 PHE n 1 7 THR n 1 8 SER n 1 9 ASP n 1 10 LEU n 1 11 SER n 1 12 LYS n 1 13 GLN n 1 14 LYS n 1 15 ASP n 1 16 GLU n 1 17 GLN n 1 18 ARG n 1 19 ALA n 1 20 LYS n 1 21 LEU n 1 22 PHE n 1 23 ILE n 1 24 GLU n 1 25 TRP n 1 26 LEU n 1 27 AIB n 1 28 ALA n 1 29 GLY n 1 30 GLY n 1 31 PRO n 1 32 SER n 1 33 SER n 1 34 GLY n 1 35 ALA n 1 36 PRO n 1 37 PRO n 1 38 PRO n 1 39 SER n 1 40 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 40 _pdbx_entity_src_syn.organism_scientific 'Heloderma suspectum' _pdbx_entity_src_syn.organism_common_name 'Gila monster' _pdbx_entity_src_syn.ncbi_taxonomy_id 8554 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EXE4_HELSU _struct_ref.pdbx_db_accession P26349 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS _struct_ref.pdbx_align_begin 48 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6GDZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 39 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P26349 _struct_ref_seq.db_align_beg 48 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 86 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 39 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6GDZ AIB A 2 ? UNP P26349 GLY 49 conflict 2 1 1 6GDZ GLN A 3 ? UNP P26349 GLU 50 conflict 3 2 1 6GDZ LYS A 14 ? UNP P26349 MET 61 conflict 14 3 1 6GDZ ASP A 15 ? UNP P26349 GLU 62 conflict 15 4 1 6GDZ GLN A 17 ? UNP P26349 GLU 64 conflict 17 5 1 6GDZ ARG A 18 ? UNP P26349 ALA 65 conflict 18 6 1 6GDZ ALA A 19 ? UNP P26349 VAL 66 conflict 19 7 1 6GDZ LYS A 20 ? UNP P26349 ARG 67 conflict 20 8 1 6GDZ AIB A 27 ? UNP P26349 LYS 74 conflict 27 9 1 6GDZ ALA A 28 ? UNP P26349 ASN 75 conflict 28 10 1 6GDZ NH2 A 40 ? UNP P26349 ? ? amidation 40 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight AIB 'L-peptide linking' n 'ALPHA-AMINOISOBUTYRIC ACID' ? 'C4 H9 N O2' 103.120 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 EVT non-polymer . '(2~{S})-2-[[(4~{S})-4-(hexadecanoylamino)-5-oxidanyl-5-oxidanylidene-pentanoyl]amino]pentanedioic acid' ? 'C26 H46 N2 O8' 514.652 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H COSY' 1 isotropic 2 1 1 '2D 1H-1H TOCSY' 1 isotropic 3 1 1 '2D 1H-1H NOESY' 1 isotropic 4 1 1 '2D 1H-13C HSQC' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '35mM sodium phosphate' _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 0.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err 0.01 _pdbx_nmr_exptl_sample_conditions.temperature_err 0.2 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '5 mg/mL Peptide 5, trifluoroethanol/water' _pdbx_nmr_sample_details.solvent_system trifluoroethanol/water _pdbx_nmr_sample_details.label 'Model 1' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 1 ? Bruker 700 'AVANCE I' 2 2 ? Bruker 500 'AVANCE II' # _pdbx_nmr_refine.entry_id 6GDZ _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 6GDZ _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6GDZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' TopSpin 3.2 'Bruker Biospin' 2 'structure calculation' SYBYL 2.1.1 Tripos 3 'chemical shift assignment' CARA 'Release 1.8.4.2' 'Keller and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6GDZ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6GDZ _struct.title 'exendin-4 based dual GLP-1/glucagon receptor agonist' _struct.pdbx_descriptor Exendin-4 _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6GDZ _struct_keywords.text HORMONE _struct_keywords.pdbx_keywords HORMONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 1 ? GLY A 29 ? HIS A 1 GLY A 29 1 ? 29 HELX_P HELX_P2 AA2 GLY A 30 ? GLY A 34 ? GLY A 30 GLY A 34 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A HIS 1 C ? ? ? 1_555 A AIB 2 N ? ? A HIS 1 A AIB 2 1_555 ? ? ? ? ? ? ? 1.353 ? covale2 covale both ? A AIB 2 C ? ? ? 1_555 A GLN 3 N ? ? A AIB 2 A GLN 3 1_555 ? ? ? ? ? ? ? 1.351 ? covale3 covale one ? A LYS 14 NZ ? ? ? 1_555 B EVT . C33 ? ? A LYS 14 A EVT 101 1_555 ? ? ? ? ? ? ? 1.354 ? covale4 covale both ? A LEU 26 C ? ? ? 1_555 A AIB 27 N ? ? A LEU 26 A AIB 27 1_555 ? ? ? ? ? ? ? 1.352 ? covale5 covale both ? A AIB 27 C ? ? ? 1_555 A ALA 28 N ? ? A AIB 27 A ALA 28 1_555 ? ? ? ? ? ? ? 1.352 ? covale6 covale both ? A SER 39 C ? ? ? 1_555 A NH2 40 N ? ? A SER 39 A NH2 40 1_555 ? ? ? ? ? ? ? 1.349 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EVT 101 ? 4 'binding site for residue EVT A 101' AC2 Software A NH2 40 ? 2 'binding site for Ligand NH2 A 40 bound to SER A 39' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 THR A 7 ? THR A 7 . ? 1_555 ? 2 AC1 4 LEU A 10 ? LEU A 10 . ? 1_555 ? 3 AC1 4 SER A 11 ? SER A 11 . ? 1_555 ? 4 AC1 4 LYS A 14 ? LYS A 14 . ? 1_555 ? 5 AC2 2 PRO A 38 ? PRO A 38 . ? 1_555 ? 6 AC2 2 SER A 39 ? SER A 39 . ? 1_555 ? # _atom_sites.entry_id 6GDZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 1 1 HIS HIS A . n A 1 2 AIB 2 2 2 AIB AIB A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 AIB 27 27 27 AIB ALA A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 NH2 40 40 39 NH2 SER A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id EVT _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 40 _pdbx_nonpoly_scheme.pdb_mon_id EVT _pdbx_nonpoly_scheme.auth_mon_id XXX _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 110 ? 1 MORE 0 ? 1 'SSA (A^2)' 3920 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-06-20 2 'Structure model' 1 1 2018-07-25 3 'Structure model' 1 2 2019-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.name' 6 3 'Structure model' '_pdbx_nmr_software.name' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'Peptide 5' _pdbx_nmr_exptl_sample.concentration 5 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mg/mL _pdbx_nmr_exptl_sample.isotopic_labeling none # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.22 107.30 -5.08 0.80 N 2 2 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 101.98 107.30 -5.32 0.80 N 3 6 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.48 107.30 -4.82 0.80 N 4 7 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.24 107.30 -5.06 0.80 N 5 9 CE2 A TRP 25 ? ? CD2 A TRP 25 ? ? CG A TRP 25 ? ? 102.22 107.30 -5.08 0.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 4 ASP A 15 ? ? -39.74 -37.37 2 10 PHE A 6 ? ? -68.57 -70.76 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 3 _pdbx_validate_planes.auth_comp_id PHE _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 22 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.092 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '(2~{S})-2-[[(4~{S})-4-(hexadecanoylamino)-5-oxidanyl-5-oxidanylidene-pentanoyl]amino]pentanedioic acid' _pdbx_entity_nonpoly.comp_id EVT # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #