data_6GJN # _entry.id 6GJN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.302 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6GJN WWPDB D_1200009959 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6GJN _pdbx_database_status.recvd_initial_deposition_date 2018-05-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Georgiou, C.' 1 ? 'De Simone, A.' 2 ? 'Walkinshaw, M.D.' 3 ? 'Michel, J.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-6520 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 542 _citation.page_last 547 _citation.title 'A computationally designed binding mode flip leads to a novel class of potent tri-vector cyclophilin inhibitors.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/c8sc03831g _citation.pdbx_database_id_PubMed 30746096 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'De Simone, A.' 1 ? primary 'Georgiou, C.' 2 ? primary 'Ioannidis, H.' 3 0000-0003-3470-6055 primary 'Gupta, A.A.' 4 ? primary 'Juarez-Jimenez, J.' 5 0000-0003-1464-1397 primary 'Doughty-Shenton, D.' 6 ? primary 'Blackburn, E.A.' 7 ? primary 'Wear, M.A.' 8 ? primary 'Richards, J.P.' 9 ? primary 'Barlow, P.N.' 10 ? primary 'Carragher, N.' 11 ? primary 'Walkinshaw, M.D.' 12 ? primary 'Hulme, A.N.' 13 0000-0002-4619-1506 primary 'Michel, J.' 14 0000-0003-0360-1760 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6GJN _cell.details ? _cell.formula_units_Z ? _cell.length_a 41.952 _cell.length_a_esd ? _cell.length_b 53.348 _cell.length_b_esd ? _cell.length_c 88.898 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6GJN _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidyl-prolyl cis-trans isomerase A' 18036.504 1 5.2.1.8 ? ? ? 2 non-polymer syn ;1-[(4-aminophenyl)methyl]-3-[2-[(2~{R})-2-(2-bromophenyl)pyrrolidin-1-yl]-2-oxidanylidene-ethyl]-1-[(2-methyl-1,2,3,4-tetrazol-5-yl)methyl]urea ; 527.417 1 ? ? ? ? 3 non-polymer syn 'FORMIC ACID' 46.025 2 ? ? ? ? 4 non-polymer nat GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 241 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PPIase A,Cyclophilin A,Cyclosporin A-binding protein,Rotamase A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD CGQLE ; _entity_poly.pdbx_seq_one_letter_code_can ;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD CGQLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 ASN n 1 4 PRO n 1 5 THR n 1 6 VAL n 1 7 PHE n 1 8 PHE n 1 9 ASP n 1 10 ILE n 1 11 ALA n 1 12 VAL n 1 13 ASP n 1 14 GLY n 1 15 GLU n 1 16 PRO n 1 17 LEU n 1 18 GLY n 1 19 ARG n 1 20 VAL n 1 21 SER n 1 22 PHE n 1 23 GLU n 1 24 LEU n 1 25 PHE n 1 26 ALA n 1 27 ASP n 1 28 LYS n 1 29 VAL n 1 30 PRO n 1 31 LYS n 1 32 THR n 1 33 ALA n 1 34 GLU n 1 35 ASN n 1 36 PHE n 1 37 ARG n 1 38 ALA n 1 39 LEU n 1 40 SER n 1 41 THR n 1 42 GLY n 1 43 GLU n 1 44 LYS n 1 45 GLY n 1 46 PHE n 1 47 GLY n 1 48 TYR n 1 49 LYS n 1 50 GLY n 1 51 SER n 1 52 CYS n 1 53 PHE n 1 54 HIS n 1 55 ARG n 1 56 ILE n 1 57 ILE n 1 58 PRO n 1 59 GLY n 1 60 PHE n 1 61 MET n 1 62 CYS n 1 63 GLN n 1 64 GLY n 1 65 GLY n 1 66 ASP n 1 67 PHE n 1 68 THR n 1 69 ARG n 1 70 HIS n 1 71 ASN n 1 72 GLY n 1 73 THR n 1 74 GLY n 1 75 GLY n 1 76 LYS n 1 77 SER n 1 78 ILE n 1 79 TYR n 1 80 GLY n 1 81 GLU n 1 82 LYS n 1 83 PHE n 1 84 GLU n 1 85 ASP n 1 86 GLU n 1 87 ASN n 1 88 PHE n 1 89 ILE n 1 90 LEU n 1 91 LYS n 1 92 HIS n 1 93 THR n 1 94 GLY n 1 95 PRO n 1 96 GLY n 1 97 ILE n 1 98 LEU n 1 99 SER n 1 100 MET n 1 101 ALA n 1 102 ASN n 1 103 ALA n 1 104 GLY n 1 105 PRO n 1 106 ASN n 1 107 THR n 1 108 ASN n 1 109 GLY n 1 110 SER n 1 111 GLN n 1 112 PHE n 1 113 PHE n 1 114 ILE n 1 115 CYS n 1 116 THR n 1 117 ALA n 1 118 LYS n 1 119 THR n 1 120 GLU n 1 121 TRP n 1 122 LEU n 1 123 ASP n 1 124 GLY n 1 125 LYS n 1 126 HIS n 1 127 VAL n 1 128 VAL n 1 129 PHE n 1 130 GLY n 1 131 LYS n 1 132 VAL n 1 133 LYS n 1 134 GLU n 1 135 GLY n 1 136 MET n 1 137 ASN n 1 138 ILE n 1 139 VAL n 1 140 GLU n 1 141 ALA n 1 142 MET n 1 143 GLU n 1 144 ARG n 1 145 PHE n 1 146 GLY n 1 147 SER n 1 148 ARG n 1 149 ASN n 1 150 GLY n 1 151 LYS n 1 152 THR n 1 153 SER n 1 154 LYS n 1 155 LYS n 1 156 ILE n 1 157 THR n 1 158 ILE n 1 159 ALA n 1 160 ASP n 1 161 CYS n 1 162 GLY n 1 163 GLN n 1 164 LEU n 1 165 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 165 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PPIA, CYPA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PPIA_HUMAN _struct_ref.pdbx_db_accession P62937 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD CGQLE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6GJN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 165 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62937 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 165 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 165 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 F0Q non-polymer . ;1-[(4-aminophenyl)methyl]-3-[2-[(2~{R})-2-(2-bromophenyl)pyrrolidin-1-yl]-2-oxidanylidene-ethyl]-1-[(2-methyl-1,2,3,4-tetrazol-5-yl)methyl]urea ; ? 'C23 H27 Br N8 O2' 527.417 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6GJN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.76 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.40 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 279.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 8000, Tris-HCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-09-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6GJN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.70 _reflns.d_resolution_low 45.75 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22682 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.0 _reflns.pdbx_Rmerge_I_obs 0.186 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.206 _reflns.pdbx_Rpim_I_all 0.086 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.70 _reflns_shell.d_res_low 1.73 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 13.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1178 _reflns_shell.percent_possible_all 100.00 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.600 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.678 _reflns_shell.pdbx_Rpim_I_all 0.312 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.01 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.03 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.04 _refine.B_iso_max ? _refine.B_iso_mean 17.689 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.956 _refine.correlation_coeff_Fo_to_Fc_free 0.937 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6GJN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.70 _refine.ls_d_res_low 45.74 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21393 _refine.ls_number_reflns_R_free 1155 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.06 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.17122 _refine.ls_R_factor_R_free 0.20290 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.16954 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5NOY _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.095 _refine.pdbx_overall_ESU_R_Free 0.096 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.251 _refine.overall_SU_ML 0.078 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1266 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 46 _refine_hist.number_atoms_solvent 241 _refine_hist.number_atoms_total 1553 _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 45.74 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.019 0.019 1376 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1301 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.107 1.979 1846 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.182 3.000 3008 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.594 5.000 174 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.182 23.770 61 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.213 15.000 238 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.342 15.000 8 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.123 0.200 186 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.011 0.020 1582 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 336 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.682 1.482 670 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.681 1.483 671 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.695 2.201 837 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.709 2.209 838 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.048 1.736 706 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.031 1.737 706 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.114 2.517 1005 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.675 12.900 1514 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 5.674 12.922 1515 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.697 _refine_ls_shell.d_res_low 1.741 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 79 _refine_ls_shell.number_reflns_R_work 1558 _refine_ls_shell.percent_reflns_obs 98.91 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.203 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.155 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6GJN _struct.title 'Cyclophilin A complexed with tri-vector ligand 15.' _struct.pdbx_descriptor 'Peptidyl-prolyl cis-trans isomerase A (E.C.5.2.1.8)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6GJN _struct_keywords.text 'Cyclophilins, CypA, inhibitor, PPIase, complex, isomerase' _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 29 ? GLY A 42 ? VAL A 29 GLY A 42 1 ? 14 HELX_P HELX_P2 AA2 THR A 119 ? ASP A 123 ? THR A 119 ASP A 123 5 ? 5 HELX_P HELX_P3 AA3 GLY A 135 ? ARG A 144 ? GLY A 135 ARG A 144 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 55 ? ILE A 57 ? ARG A 55 ILE A 57 AA1 2 MET A 61 ? GLY A 64 ? MET A 61 GLY A 64 AA1 3 PHE A 112 ? CYS A 115 ? PHE A 112 CYS A 115 AA1 4 ILE A 97 ? MET A 100 ? ILE A 97 MET A 100 AA1 5 VAL A 128 ? GLU A 134 ? VAL A 128 GLU A 134 AA1 6 GLU A 15 ? LEU A 24 ? GLU A 15 LEU A 24 AA1 7 THR A 5 ? VAL A 12 ? THR A 5 VAL A 12 AA1 8 ILE A 156 ? LEU A 164 ? ILE A 156 LEU A 164 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 55 ? N ARG A 55 O GLN A 63 ? O GLN A 63 AA1 2 3 N CYS A 62 ? N CYS A 62 O ILE A 114 ? O ILE A 114 AA1 3 4 O CYS A 115 ? O CYS A 115 N ILE A 97 ? N ILE A 97 AA1 4 5 N LEU A 98 ? N LEU A 98 O PHE A 129 ? O PHE A 129 AA1 5 6 O LYS A 133 ? O LYS A 133 N SER A 21 ? N SER A 21 AA1 6 7 O GLY A 18 ? O GLY A 18 N ILE A 10 ? N ILE A 10 AA1 7 8 N ASP A 9 ? N ASP A 9 O ASP A 160 ? O ASP A 160 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A F0Q 201 ? 15 'binding site for residue F0Q A 201' AC2 Software A FMT 202 ? 2 'binding site for residue FMT A 202' AC3 Software A FMT 203 ? 6 'binding site for residue FMT A 203' AC4 Software A GOL 204 ? 10 'binding site for residue GOL A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 HIS A 54 ? HIS A 54 . ? 1_555 ? 2 AC1 15 ARG A 55 ? ARG A 55 . ? 1_555 ? 3 AC1 15 GLN A 63 ? GLN A 63 . ? 1_555 ? 4 AC1 15 GLY A 72 ? GLY A 72 . ? 1_555 ? 5 AC1 15 ASP A 85 ? ASP A 85 . ? 4_555 ? 6 AC1 15 GLU A 86 ? GLU A 86 . ? 4_555 ? 7 AC1 15 ALA A 101 ? ALA A 101 . ? 1_555 ? 8 AC1 15 ASN A 102 ? ASN A 102 . ? 1_555 ? 9 AC1 15 THR A 107 ? THR A 107 . ? 1_555 ? 10 AC1 15 GLN A 111 ? GLN A 111 . ? 1_555 ? 11 AC1 15 PHE A 113 ? PHE A 113 . ? 1_555 ? 12 AC1 15 HIS A 126 ? HIS A 126 . ? 1_555 ? 13 AC1 15 HOH F . ? HOH A 305 . ? 1_555 ? 14 AC1 15 HOH F . ? HOH A 383 . ? 1_555 ? 15 AC1 15 HOH F . ? HOH A 432 . ? 1_555 ? 16 AC2 2 THR A 68 ? THR A 68 . ? 1_555 ? 17 AC2 2 ARG A 69 ? ARG A 69 . ? 1_555 ? 18 AC3 6 ARG A 55 ? ARG A 55 . ? 1_555 ? 19 AC3 6 ASN A 87 ? ASN A 87 . ? 4_555 ? 20 AC3 6 PHE A 88 ? PHE A 88 . ? 4_555 ? 21 AC3 6 ILE A 89 ? ILE A 89 . ? 4_555 ? 22 AC3 6 HOH F . ? HOH A 305 . ? 1_555 ? 23 AC3 6 HOH F . ? HOH A 461 . ? 1_555 ? 24 AC4 10 LYS A 82 ? LYS A 82 . ? 1_555 ? 25 AC4 10 PHE A 83 ? PHE A 83 . ? 1_555 ? 26 AC4 10 GLU A 84 ? GLU A 84 . ? 1_555 ? 27 AC4 10 ASN A 106 ? ASN A 106 . ? 1_555 ? 28 AC4 10 GLU A 120 ? GLU A 120 . ? 4_455 ? 29 AC4 10 TRP A 121 ? TRP A 121 . ? 4_455 ? 30 AC4 10 HOH F . ? HOH A 307 . ? 1_555 ? 31 AC4 10 HOH F . ? HOH A 311 . ? 1_555 ? 32 AC4 10 HOH F . ? HOH A 352 . ? 1_555 ? 33 AC4 10 HOH F . ? HOH A 382 . ? 1_555 ? # _atom_sites.entry_id 6GJN _atom_sites.fract_transf_matrix[1][1] 0.023836 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018745 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011249 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol BR C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 CYS 115 115 115 CYS CYS A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 TRP 121 121 121 TRP TRP A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 MET 142 142 142 MET MET A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 CYS 161 161 161 CYS CYS A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 GLU 165 165 165 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 F0Q 1 201 1 F0Q l44 A . C 3 FMT 1 202 1 FMT FMT A . D 3 FMT 1 203 2 FMT FMT A . E 4 GOL 1 204 1 GOL GOL A . F 5 HOH 1 301 219 HOH HOH A . F 5 HOH 2 302 218 HOH HOH A . F 5 HOH 3 303 176 HOH HOH A . F 5 HOH 4 304 111 HOH HOH A . F 5 HOH 5 305 250 HOH HOH A . F 5 HOH 6 306 237 HOH HOH A . F 5 HOH 7 307 71 HOH HOH A . F 5 HOH 8 308 223 HOH HOH A . F 5 HOH 9 309 184 HOH HOH A . F 5 HOH 10 310 30 HOH HOH A . F 5 HOH 11 311 149 HOH HOH A . F 5 HOH 12 312 95 HOH HOH A . F 5 HOH 13 313 175 HOH HOH A . F 5 HOH 14 314 101 HOH HOH A . F 5 HOH 15 315 204 HOH HOH A . F 5 HOH 16 316 28 HOH HOH A . F 5 HOH 17 317 195 HOH HOH A . F 5 HOH 18 318 23 HOH HOH A . F 5 HOH 19 319 24 HOH HOH A . F 5 HOH 20 320 45 HOH HOH A . F 5 HOH 21 321 61 HOH HOH A . F 5 HOH 22 322 29 HOH HOH A . F 5 HOH 23 323 115 HOH HOH A . F 5 HOH 24 324 113 HOH HOH A . F 5 HOH 25 325 9 HOH HOH A . F 5 HOH 26 326 2 HOH HOH A . F 5 HOH 27 327 132 HOH HOH A . F 5 HOH 28 328 85 HOH HOH A . F 5 HOH 29 329 62 HOH HOH A . F 5 HOH 30 330 134 HOH HOH A . F 5 HOH 31 331 8 HOH HOH A . F 5 HOH 32 332 142 HOH HOH A . F 5 HOH 33 333 100 HOH HOH A . F 5 HOH 34 334 215 HOH HOH A . F 5 HOH 35 335 191 HOH HOH A . F 5 HOH 36 336 35 HOH HOH A . F 5 HOH 37 337 4 HOH HOH A . F 5 HOH 38 338 162 HOH HOH A . F 5 HOH 39 339 17 HOH HOH A . F 5 HOH 40 340 214 HOH HOH A . F 5 HOH 41 341 64 HOH HOH A . F 5 HOH 42 342 201 HOH HOH A . F 5 HOH 43 343 109 HOH HOH A . F 5 HOH 44 344 114 HOH HOH A . F 5 HOH 45 345 230 HOH HOH A . F 5 HOH 46 346 3 HOH HOH A . F 5 HOH 47 347 116 HOH HOH A . F 5 HOH 48 348 33 HOH HOH A . F 5 HOH 49 349 54 HOH HOH A . F 5 HOH 50 350 146 HOH HOH A . F 5 HOH 51 351 11 HOH HOH A . F 5 HOH 52 352 118 HOH HOH A . F 5 HOH 53 353 21 HOH HOH A . F 5 HOH 54 354 139 HOH HOH A . F 5 HOH 55 355 14 HOH HOH A . F 5 HOH 56 356 202 HOH HOH A . F 5 HOH 57 357 46 HOH HOH A . F 5 HOH 58 358 56 HOH HOH A . F 5 HOH 59 359 91 HOH HOH A . F 5 HOH 60 360 213 HOH HOH A . F 5 HOH 61 361 135 HOH HOH A . F 5 HOH 62 362 34 HOH HOH A . F 5 HOH 63 363 51 HOH HOH A . F 5 HOH 64 364 136 HOH HOH A . F 5 HOH 65 365 49 HOH HOH A . F 5 HOH 66 366 220 HOH HOH A . F 5 HOH 67 367 234 HOH HOH A . F 5 HOH 68 368 81 HOH HOH A . F 5 HOH 69 369 127 HOH HOH A . F 5 HOH 70 370 206 HOH HOH A . F 5 HOH 71 371 44 HOH HOH A . F 5 HOH 72 372 145 HOH HOH A . F 5 HOH 73 373 188 HOH HOH A . F 5 HOH 74 374 43 HOH HOH A . F 5 HOH 75 375 5 HOH HOH A . F 5 HOH 76 376 183 HOH HOH A . F 5 HOH 77 377 31 HOH HOH A . F 5 HOH 78 378 41 HOH HOH A . F 5 HOH 79 379 105 HOH HOH A . F 5 HOH 80 380 18 HOH HOH A . F 5 HOH 81 381 216 HOH HOH A . F 5 HOH 82 382 82 HOH HOH A . F 5 HOH 83 383 1 HOH HOH A . F 5 HOH 84 384 6 HOH HOH A . F 5 HOH 85 385 164 HOH HOH A . F 5 HOH 86 386 10 HOH HOH A . F 5 HOH 87 387 7 HOH HOH A . F 5 HOH 88 388 128 HOH HOH A . F 5 HOH 89 389 66 HOH HOH A . F 5 HOH 90 390 172 HOH HOH A . F 5 HOH 91 391 243 HOH HOH A . F 5 HOH 92 392 48 HOH HOH A . F 5 HOH 93 393 22 HOH HOH A . F 5 HOH 94 394 88 HOH HOH A . F 5 HOH 95 395 199 HOH HOH A . F 5 HOH 96 396 203 HOH HOH A . F 5 HOH 97 397 36 HOH HOH A . F 5 HOH 98 398 122 HOH HOH A . F 5 HOH 99 399 87 HOH HOH A . F 5 HOH 100 400 57 HOH HOH A . F 5 HOH 101 401 138 HOH HOH A . F 5 HOH 102 402 212 HOH HOH A . F 5 HOH 103 403 169 HOH HOH A . F 5 HOH 104 404 106 HOH HOH A . F 5 HOH 105 405 226 HOH HOH A . F 5 HOH 106 406 200 HOH HOH A . F 5 HOH 107 407 16 HOH HOH A . F 5 HOH 108 408 93 HOH HOH A . F 5 HOH 109 409 89 HOH HOH A . F 5 HOH 110 410 55 HOH HOH A . F 5 HOH 111 411 83 HOH HOH A . F 5 HOH 112 412 186 HOH HOH A . F 5 HOH 113 413 246 HOH HOH A . F 5 HOH 114 414 110 HOH HOH A . F 5 HOH 115 415 192 HOH HOH A . F 5 HOH 116 416 170 HOH HOH A . F 5 HOH 117 417 245 HOH HOH A . F 5 HOH 118 418 12 HOH HOH A . F 5 HOH 119 419 133 HOH HOH A . F 5 HOH 120 420 248 HOH HOH A . F 5 HOH 121 421 26 HOH HOH A . F 5 HOH 122 422 126 HOH HOH A . F 5 HOH 123 423 76 HOH HOH A . F 5 HOH 124 424 37 HOH HOH A . F 5 HOH 125 425 25 HOH HOH A . F 5 HOH 126 426 59 HOH HOH A . F 5 HOH 127 427 120 HOH HOH A . F 5 HOH 128 428 15 HOH HOH A . F 5 HOH 129 429 60 HOH HOH A . F 5 HOH 130 430 58 HOH HOH A . F 5 HOH 131 431 244 HOH HOH A . F 5 HOH 132 432 224 HOH HOH A . F 5 HOH 133 433 228 HOH HOH A . F 5 HOH 134 434 69 HOH HOH A . F 5 HOH 135 435 108 HOH HOH A . F 5 HOH 136 436 39 HOH HOH A . F 5 HOH 137 437 181 HOH HOH A . F 5 HOH 138 438 99 HOH HOH A . F 5 HOH 139 439 182 HOH HOH A . F 5 HOH 140 440 47 HOH HOH A . F 5 HOH 141 441 40 HOH HOH A . F 5 HOH 142 442 231 HOH HOH A . F 5 HOH 143 443 205 HOH HOH A . F 5 HOH 144 444 75 HOH HOH A . F 5 HOH 145 445 70 HOH HOH A . F 5 HOH 146 446 147 HOH HOH A . F 5 HOH 147 447 217 HOH HOH A . F 5 HOH 148 448 92 HOH HOH A . F 5 HOH 149 449 242 HOH HOH A . F 5 HOH 150 450 20 HOH HOH A . F 5 HOH 151 451 174 HOH HOH A . F 5 HOH 152 452 90 HOH HOH A . F 5 HOH 153 453 19 HOH HOH A . F 5 HOH 154 454 168 HOH HOH A . F 5 HOH 155 455 13 HOH HOH A . F 5 HOH 156 456 94 HOH HOH A . F 5 HOH 157 457 190 HOH HOH A . F 5 HOH 158 458 177 HOH HOH A . F 5 HOH 159 459 53 HOH HOH A . F 5 HOH 160 460 50 HOH HOH A . F 5 HOH 161 461 208 HOH HOH A . F 5 HOH 162 462 137 HOH HOH A . F 5 HOH 163 463 52 HOH HOH A . F 5 HOH 164 464 209 HOH HOH A . F 5 HOH 165 465 167 HOH HOH A . F 5 HOH 166 466 107 HOH HOH A . F 5 HOH 167 467 160 HOH HOH A . F 5 HOH 168 468 148 HOH HOH A . F 5 HOH 169 469 152 HOH HOH A . F 5 HOH 170 470 249 HOH HOH A . F 5 HOH 171 471 163 HOH HOH A . F 5 HOH 172 472 150 HOH HOH A . F 5 HOH 173 473 32 HOH HOH A . F 5 HOH 174 474 102 HOH HOH A . F 5 HOH 175 475 180 HOH HOH A . F 5 HOH 176 476 125 HOH HOH A . F 5 HOH 177 477 197 HOH HOH A . F 5 HOH 178 478 98 HOH HOH A . F 5 HOH 179 479 155 HOH HOH A . F 5 HOH 180 480 96 HOH HOH A . F 5 HOH 181 481 42 HOH HOH A . F 5 HOH 182 482 229 HOH HOH A . F 5 HOH 183 483 227 HOH HOH A . F 5 HOH 184 484 196 HOH HOH A . F 5 HOH 185 485 179 HOH HOH A . F 5 HOH 186 486 103 HOH HOH A . F 5 HOH 187 487 123 HOH HOH A . F 5 HOH 188 488 211 HOH HOH A . F 5 HOH 189 489 233 HOH HOH A . F 5 HOH 190 490 158 HOH HOH A . F 5 HOH 191 491 210 HOH HOH A . F 5 HOH 192 492 151 HOH HOH A . F 5 HOH 193 493 80 HOH HOH A . F 5 HOH 194 494 112 HOH HOH A . F 5 HOH 195 495 38 HOH HOH A . F 5 HOH 196 496 153 HOH HOH A . F 5 HOH 197 497 74 HOH HOH A . F 5 HOH 198 498 189 HOH HOH A . F 5 HOH 199 499 130 HOH HOH A . F 5 HOH 200 500 78 HOH HOH A . F 5 HOH 201 501 124 HOH HOH A . F 5 HOH 202 502 156 HOH HOH A . F 5 HOH 203 503 129 HOH HOH A . F 5 HOH 204 504 207 HOH HOH A . F 5 HOH 205 505 117 HOH HOH A . F 5 HOH 206 506 131 HOH HOH A . F 5 HOH 207 507 173 HOH HOH A . F 5 HOH 208 508 67 HOH HOH A . F 5 HOH 209 509 235 HOH HOH A . F 5 HOH 210 510 221 HOH HOH A . F 5 HOH 211 511 86 HOH HOH A . F 5 HOH 212 512 185 HOH HOH A . F 5 HOH 213 513 27 HOH HOH A . F 5 HOH 214 514 187 HOH HOH A . F 5 HOH 215 515 178 HOH HOH A . F 5 HOH 216 516 72 HOH HOH A . F 5 HOH 217 517 65 HOH HOH A . F 5 HOH 218 518 143 HOH HOH A . F 5 HOH 219 519 84 HOH HOH A . F 5 HOH 220 520 144 HOH HOH A . F 5 HOH 221 521 194 HOH HOH A . F 5 HOH 222 522 119 HOH HOH A . F 5 HOH 223 523 171 HOH HOH A . F 5 HOH 224 524 157 HOH HOH A . F 5 HOH 225 525 165 HOH HOH A . F 5 HOH 226 526 232 HOH HOH A . F 5 HOH 227 527 198 HOH HOH A . F 5 HOH 228 528 73 HOH HOH A . F 5 HOH 229 529 77 HOH HOH A . F 5 HOH 230 530 121 HOH HOH A . F 5 HOH 231 531 241 HOH HOH A . F 5 HOH 232 532 141 HOH HOH A . F 5 HOH 233 533 104 HOH HOH A . F 5 HOH 234 534 161 HOH HOH A . F 5 HOH 235 535 159 HOH HOH A . F 5 HOH 236 536 247 HOH HOH A . F 5 HOH 237 537 79 HOH HOH A . F 5 HOH 238 538 166 HOH HOH A . F 5 HOH 239 539 154 HOH HOH A . F 5 HOH 240 540 63 HOH HOH A . F 5 HOH 241 541 97 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 440 ? 1 MORE 0 ? 1 'SSA (A^2)' 7680 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-11-07 2 'Structure model' 1 1 2019-02-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_database_proc # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_ISSN' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 60 ? ? -134.88 -75.52 2 1 ASN A 71 ? ? -143.25 10.58 # _pdbx_audit_support.funding_organization 'European Research Council' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 'No. 336289' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;1-[(4-aminophenyl)methyl]-3-[2-[(2~{R})-2-(2-bromophenyl)pyrrolidin-1-yl]-2-oxidanylidene-ethyl]-1-[(2-methyl-1,2,3,4-tetrazol-5-yl)methyl]urea ; F0Q 3 'FORMIC ACID' FMT 4 GLYCEROL GOL 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #