data_6GKQ # _entry.id 6GKQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.308 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6GKQ WWPDB D_1200010135 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6GKQ _pdbx_database_status.recvd_initial_deposition_date 2018-05-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Verstraete, K.' 1 ? 'Verschueren, K.' 2 ? 'Savvides, S.N.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 364 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Protein crystallization promotes type 2 immunity and is reversible by antibody treatment.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.aaw4295 _citation.pdbx_database_id_PubMed 31123109 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Persson, E.K.' 1 0000-0002-9874-7991 primary 'Verstraete, K.' 2 0000-0001-6544-6458 primary 'Heyndrickx, I.' 3 0000-0001-8091-6390 primary 'Gevaert, E.' 4 0000-0002-0992-3085 primary 'Aegerter, H.' 5 0000-0002-5755-9126 primary 'Percier, J.M.' 6 ? primary 'Deswarte, K.' 7 ? primary 'Verschueren, K.H.G.' 8 0000-0002-3522-9169 primary 'Dansercoer, A.' 9 ? primary 'Gras, D.' 10 0000-0002-6630-2955 primary 'Chanez, P.' 11 0000-0003-4059-0917 primary 'Bachert, C.' 12 ? primary 'Goncalves, A.' 13 0000-0003-2748-3033 primary 'Van Gorp, H.' 14 ? primary 'De Haard, H.' 15 ? primary 'Blanchetot, C.' 16 ? primary 'Saunders, M.' 17 ? primary 'Hammad, H.' 18 ? primary 'Savvides, S.N.' 19 0000-0003-3420-5947 primary 'Lambrecht, B.N.' 20 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6GKQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.941 _cell.length_a_esd ? _cell.length_b 48.941 _cell.length_b_esd ? _cell.length_c 258.337 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6GKQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat Galectin-10 16499.887 1 ? 'Ala28Val (Natural variant)' ? 'This X-ray data was collected from an ex vivo Charcot-Leyden crystal.' 2 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 3 water nat water 18.015 112 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Gal-10,Charcot-Leyden crystal protein,CLC,Eosinophil lysophospholipase,Lysolecithin acylhydrolase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKN MPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKN MPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LEU n 1 4 LEU n 1 5 PRO n 1 6 VAL n 1 7 PRO n 1 8 TYR n 1 9 THR n 1 10 GLU n 1 11 ALA n 1 12 ALA n 1 13 SER n 1 14 LEU n 1 15 SER n 1 16 THR n 1 17 GLY n 1 18 SER n 1 19 THR n 1 20 VAL n 1 21 THR n 1 22 ILE n 1 23 LYS n 1 24 GLY n 1 25 ARG n 1 26 PRO n 1 27 LEU n 1 28 VAL n 1 29 CYS n 1 30 PHE n 1 31 LEU n 1 32 ASN n 1 33 GLU n 1 34 PRO n 1 35 TYR n 1 36 LEU n 1 37 GLN n 1 38 VAL n 1 39 ASP n 1 40 PHE n 1 41 HIS n 1 42 THR n 1 43 GLU n 1 44 MET n 1 45 LYS n 1 46 GLU n 1 47 GLU n 1 48 SER n 1 49 ASP n 1 50 ILE n 1 51 VAL n 1 52 PHE n 1 53 HIS n 1 54 PHE n 1 55 GLN n 1 56 VAL n 1 57 CYS n 1 58 PHE n 1 59 GLY n 1 60 ARG n 1 61 ARG n 1 62 VAL n 1 63 VAL n 1 64 MET n 1 65 ASN n 1 66 SER n 1 67 ARG n 1 68 GLU n 1 69 TYR n 1 70 GLY n 1 71 ALA n 1 72 TRP n 1 73 LYS n 1 74 GLN n 1 75 GLN n 1 76 VAL n 1 77 GLU n 1 78 SER n 1 79 LYS n 1 80 ASN n 1 81 MET n 1 82 PRO n 1 83 PHE n 1 84 GLN n 1 85 ASP n 1 86 GLY n 1 87 GLN n 1 88 GLU n 1 89 PHE n 1 90 GLU n 1 91 LEU n 1 92 SER n 1 93 ILE n 1 94 SER n 1 95 VAL n 1 96 LEU n 1 97 PRO n 1 98 ASP n 1 99 LYS n 1 100 TYR n 1 101 GLN n 1 102 VAL n 1 103 MET n 1 104 VAL n 1 105 ASN n 1 106 GLY n 1 107 GLN n 1 108 SER n 1 109 SER n 1 110 TYR n 1 111 THR n 1 112 PHE n 1 113 ASP n 1 114 HIS n 1 115 ARG n 1 116 ILE n 1 117 LYS n 1 118 PRO n 1 119 GLU n 1 120 ALA n 1 121 VAL n 1 122 LYS n 1 123 MET n 1 124 VAL n 1 125 GLN n 1 126 VAL n 1 127 TRP n 1 128 ARG n 1 129 ASP n 1 130 ILE n 1 131 SER n 1 132 LEU n 1 133 THR n 1 134 LYS n 1 135 PHE n 1 136 ASN n 1 137 VAL n 1 138 SER n 1 139 TYR n 1 140 LEU n 1 141 LYS n 1 142 ARG n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 142 _entity_src_nat.common_name Human _entity_src_nat.pdbx_organism_scientific 'Homo sapiens' _entity_src_nat.pdbx_ncbi_taxonomy_id 9606 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LEG10_HUMAN _struct_ref.pdbx_db_accession Q05315 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKN MPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6GKQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 142 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q05315 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 142 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 142 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6GKQ _struct_ref_seq_dif.mon_id VAL _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 28 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q05315 _struct_ref_seq_dif.db_mon_id ALA _struct_ref_seq_dif.pdbx_seq_db_seq_num 28 _struct_ref_seq_dif.details variant _struct_ref_seq_dif.pdbx_auth_seq_num 28 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6GKQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.71 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.55 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'IN CELL' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 310 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Data was collected from ex vivo Charcot-Leyden crystals. Sticky allergic mucin type mucus was obtained from CRSwNP patients undergoing endoscopic sinus surgery. One g of the allergic mucin was cut thoroughly in 10 ml RPMI-1640 (Sigma-Aldrich) containing antibiotics (50 IU/mL penicillin and 50 mg/mL streptomycin; One g of the allergic mucin was cut thoroughly in 10 ml RPMI-1640 (Sigma-Aldrich) containing antibiotics (50 IU/mL penicillin and 50 mg/mL streptomycin; Thermo Fisher Scientific), 0.1 percent BSA (Sigma-Aldrich) and 1 mg/ml Collagen type 2 (Worthington), and further homogenized using a GentleMACS Dissociator (Myltenyi Biotec) and subsequently incubed at 37 degrees for 45 minutes under continuous rotation. After centrifugation the pellet was dissolved in 3 ml PBS containing antibiotics, to which 6 ml Ficoll-Paque (GE Healthcare) was added. After centrifugation at 250g and removal of the supernatant and most of the Ficoll layer, the pellet was dissolved 1:10 in PBS with antibiotics. This precipitation process was repeated 5 more times. The final pellet containing the crystals was resuspended in PBS with antibiotics. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-09-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9763 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P14 (MX2)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9763 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P14 (MX2)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL C/O DESY' # _reflns.B_iso_Wilson_estimate 23.36 _reflns.entry_id 6GKQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.22 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9972 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.86 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.85 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.31 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.22 _reflns_shell.d_res_low 2.35 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.29 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1533 _reflns_shell.percent_possible_all 99.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 12.20 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.195 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.48 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -5.73700 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][2] -5.73700 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] 11.47410 _refine.B_iso_max ? _refine.B_iso_mean 29.85 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.919 _refine.correlation_coeff_Fo_to_Fc_free 0.878 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6GKQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 43.06 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8984 _refine.ls_number_reflns_R_free 896 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100.0 _refine.ls_percent_reflns_R_free 9.970 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.191 _refine.ls_R_factor_R_free 0.232 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.187 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1LCL _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.197 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.215 _refine.pdbx_overall_SU_R_Blow_DPI 0.304 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.237 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 6GKQ _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.28 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1110 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 113 _refine_hist.number_atoms_total 1229 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 43.06 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1151 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.13 ? 1558 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 402 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 31 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 163 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1151 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 4.27 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 17.52 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 143 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1302 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.30 _refine_ls_shell.d_res_low 2.57 _refine_ls_shell.number_reflns_all 2460 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 257 _refine_ls_shell.number_reflns_R_work 2203 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free 10.45 _refine_ls_shell.R_factor_all 0.208 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.237 _refine_ls_shell.R_factor_R_free_error 0.000 _refine_ls_shell.R_factor_R_work 0.205 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6GKQ _struct.title 'X-ray structure determined from ex vivo Charcot-Leyden crystal' _struct.pdbx_descriptor Galectin-10 _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6GKQ _struct_keywords.text 'Galectin-10, ex vivo crystal, SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 29 ? GLU A 33 ? CYS A 29 GLU A 33 5 ? 5 HELX_P HELX_P2 AA2 LYS A 117 ? VAL A 121 ? LYS A 117 VAL A 121 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 6 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 6 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 7 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 7 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.48 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 6 ? AA3 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 8 ? ALA A 11 ? TYR A 8 ALA A 11 AA1 2 MET A 123 ? ARG A 128 ? MET A 123 ARG A 128 AA1 3 TYR A 35 ? HIS A 41 ? TYR A 35 HIS A 41 AA1 4 ILE A 50 ? CYS A 57 ? ILE A 50 CYS A 57 AA1 5 ARG A 61 ? GLU A 68 ? ARG A 61 GLU A 68 AA1 6 ALA A 71 ? TRP A 72 ? ALA A 71 TRP A 72 AA2 1 TYR A 8 ? ALA A 11 ? TYR A 8 ALA A 11 AA2 2 MET A 123 ? ARG A 128 ? MET A 123 ARG A 128 AA2 3 TYR A 35 ? HIS A 41 ? TYR A 35 HIS A 41 AA2 4 ILE A 50 ? CYS A 57 ? ILE A 50 CYS A 57 AA2 5 ARG A 61 ? GLU A 68 ? ARG A 61 GLU A 68 AA2 6 VAL A 76 ? SER A 78 ? VAL A 76 SER A 78 AA3 1 GLN A 107 ? ASP A 113 ? GLN A 107 ASP A 113 AA3 2 LYS A 99 ? VAL A 104 ? LYS A 99 VAL A 104 AA3 3 PHE A 89 ? VAL A 95 ? PHE A 89 VAL A 95 AA3 4 THR A 19 ? PRO A 26 ? THR A 19 PRO A 26 AA3 5 ILE A 130 ? VAL A 137 ? ILE A 130 VAL A 137 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 8 ? N TYR A 8 O VAL A 126 ? O VAL A 126 AA1 2 3 O GLN A 125 ? O GLN A 125 N ASP A 39 ? N ASP A 39 AA1 3 4 N LEU A 36 ? N LEU A 36 O VAL A 56 ? O VAL A 56 AA1 4 5 N CYS A 57 ? N CYS A 57 O ARG A 61 ? O ARG A 61 AA1 5 6 N GLU A 68 ? N GLU A 68 O ALA A 71 ? O ALA A 71 AA2 1 2 N TYR A 8 ? N TYR A 8 O VAL A 126 ? O VAL A 126 AA2 2 3 O GLN A 125 ? O GLN A 125 N ASP A 39 ? N ASP A 39 AA2 3 4 N LEU A 36 ? N LEU A 36 O VAL A 56 ? O VAL A 56 AA2 4 5 N CYS A 57 ? N CYS A 57 O ARG A 61 ? O ARG A 61 AA2 5 6 N VAL A 62 ? N VAL A 62 O SER A 78 ? O SER A 78 AA3 1 2 O TYR A 110 ? O TYR A 110 N VAL A 102 ? N VAL A 102 AA3 2 3 O GLN A 101 ? O GLN A 101 N SER A 94 ? N SER A 94 AA3 3 4 O PHE A 89 ? O PHE A 89 N GLY A 24 ? N GLY A 24 AA3 4 5 N THR A 21 ? N THR A 21 O ASN A 136 ? O ASN A 136 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id GOL _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'binding site for residue GOL A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 HIS A 53 ? HIS A 53 . ? 1_555 ? 2 AC1 5 ASN A 65 ? ASN A 65 . ? 1_555 ? 3 AC1 5 GLN A 75 ? GLN A 75 . ? 1_555 ? 4 AC1 5 HOH C . ? HOH A 331 . ? 1_555 ? 5 AC1 5 HOH C . ? HOH A 337 . ? 1_555 ? # _atom_sites.entry_id 6GKQ _atom_sites.fract_transf_matrix[1][1] 0.020433 _atom_sites.fract_transf_matrix[1][2] 0.011797 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023594 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003871 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 TRP 72 72 72 TRP TRP A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 MET 123 123 123 MET MET A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 TRP 127 127 127 TRP TRP A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 ASN 136 136 136 ASN ASN A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 TYR 139 139 ? ? ? A . n A 1 140 LEU 140 140 ? ? ? A . n A 1 141 LYS 141 141 ? ? ? A . n A 1 142 ARG 142 142 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 201 1 GOL GOL A . C 3 HOH 1 301 63 HOH HOH A . C 3 HOH 2 302 2 HOH HOH A . C 3 HOH 3 303 23 HOH HOH A . C 3 HOH 4 304 1 HOH HOH A . C 3 HOH 5 305 4 HOH HOH A . C 3 HOH 6 306 10 HOH HOH A . C 3 HOH 7 307 47 HOH HOH A . C 3 HOH 8 308 64 HOH HOH A . C 3 HOH 9 309 71 HOH HOH A . C 3 HOH 10 310 36 HOH HOH A . C 3 HOH 11 311 82 HOH HOH A . C 3 HOH 12 312 83 HOH HOH A . C 3 HOH 13 313 110 HOH HOH A . C 3 HOH 14 314 65 HOH HOH A . C 3 HOH 15 315 19 HOH HOH A . C 3 HOH 16 316 30 HOH HOH A . C 3 HOH 17 317 27 HOH HOH A . C 3 HOH 18 318 95 HOH HOH A . C 3 HOH 19 319 39 HOH HOH A . C 3 HOH 20 320 62 HOH HOH A . C 3 HOH 21 321 81 HOH HOH A . C 3 HOH 22 322 35 HOH HOH A . C 3 HOH 23 323 26 HOH HOH A . C 3 HOH 24 324 8 HOH HOH A . C 3 HOH 25 325 93 HOH HOH A . C 3 HOH 26 326 87 HOH HOH A . C 3 HOH 27 327 45 HOH HOH A . C 3 HOH 28 328 22 HOH HOH A . C 3 HOH 29 329 56 HOH HOH A . C 3 HOH 30 330 46 HOH HOH A . C 3 HOH 31 331 107 HOH HOH A . C 3 HOH 32 332 5 HOH HOH A . C 3 HOH 33 333 96 HOH HOH A . C 3 HOH 34 334 15 HOH HOH A . C 3 HOH 35 335 55 HOH HOH A . C 3 HOH 36 336 29 HOH HOH A . C 3 HOH 37 337 48 HOH HOH A . C 3 HOH 38 338 6 HOH HOH A . C 3 HOH 39 339 3 HOH HOH A . C 3 HOH 40 340 44 HOH HOH A . C 3 HOH 41 341 69 HOH HOH A . C 3 HOH 42 342 85 HOH HOH A . C 3 HOH 43 343 106 HOH HOH A . C 3 HOH 44 344 32 HOH HOH A . C 3 HOH 45 345 108 HOH HOH A . C 3 HOH 46 346 51 HOH HOH A . C 3 HOH 47 347 14 HOH HOH A . C 3 HOH 48 348 40 HOH HOH A . C 3 HOH 49 349 104 HOH HOH A . C 3 HOH 50 350 34 HOH HOH A . C 3 HOH 51 351 84 HOH HOH A . C 3 HOH 52 352 43 HOH HOH A . C 3 HOH 53 353 50 HOH HOH A . C 3 HOH 54 354 67 HOH HOH A . C 3 HOH 55 355 18 HOH HOH A . C 3 HOH 56 356 79 HOH HOH A . C 3 HOH 57 357 37 HOH HOH A . C 3 HOH 58 358 25 HOH HOH A . C 3 HOH 59 359 90 HOH HOH A . C 3 HOH 60 360 16 HOH HOH A . C 3 HOH 61 361 11 HOH HOH A . C 3 HOH 62 362 33 HOH HOH A . C 3 HOH 63 363 105 HOH HOH A . C 3 HOH 64 364 38 HOH HOH A . C 3 HOH 65 365 41 HOH HOH A . C 3 HOH 66 366 77 HOH HOH A . C 3 HOH 67 367 73 HOH HOH A . C 3 HOH 68 368 94 HOH HOH A . C 3 HOH 69 369 57 HOH HOH A . C 3 HOH 70 370 9 HOH HOH A . C 3 HOH 71 371 17 HOH HOH A . C 3 HOH 72 372 21 HOH HOH A . C 3 HOH 73 373 99 HOH HOH A . C 3 HOH 74 374 80 HOH HOH A . C 3 HOH 75 375 103 HOH HOH A . C 3 HOH 76 376 13 HOH HOH A . C 3 HOH 77 377 88 HOH HOH A . C 3 HOH 78 378 92 HOH HOH A . C 3 HOH 79 379 49 HOH HOH A . C 3 HOH 80 380 24 HOH HOH A . C 3 HOH 81 381 42 HOH HOH A . C 3 HOH 82 382 113 HOH HOH A . C 3 HOH 83 383 58 HOH HOH A . C 3 HOH 84 384 31 HOH HOH A . C 3 HOH 85 385 74 HOH HOH A . C 3 HOH 86 386 111 HOH HOH A . C 3 HOH 87 387 60 HOH HOH A . C 3 HOH 88 388 76 HOH HOH A . C 3 HOH 89 389 68 HOH HOH A . C 3 HOH 90 390 97 HOH HOH A . C 3 HOH 91 391 101 HOH HOH A . C 3 HOH 92 392 75 HOH HOH A . C 3 HOH 93 393 112 HOH HOH A . C 3 HOH 94 394 100 HOH HOH A . C 3 HOH 95 395 91 HOH HOH A . C 3 HOH 96 396 53 HOH HOH A . C 3 HOH 97 397 20 HOH HOH A . C 3 HOH 98 398 61 HOH HOH A . C 3 HOH 99 399 70 HOH HOH A . C 3 HOH 100 400 109 HOH HOH A . C 3 HOH 101 401 98 HOH HOH A . C 3 HOH 102 402 102 HOH HOH A . C 3 HOH 103 403 12 HOH HOH A . C 3 HOH 104 404 89 HOH HOH A . C 3 HOH 105 405 7 HOH HOH A . C 3 HOH 106 406 86 HOH HOH A . C 3 HOH 107 407 72 HOH HOH A . C 3 HOH 108 408 54 HOH HOH A . C 3 HOH 109 409 78 HOH HOH A . C 3 HOH 110 410 66 HOH HOH A . C 3 HOH 111 411 52 HOH HOH A . C 3 HOH 112 412 28 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2250 ? 1 MORE -9 ? 1 'SSA (A^2)' 11750 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_555 -y,-x,-z+1/6 0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 43.0561666667 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 314 ? C HOH . 2 1 A HOH 342 ? C HOH . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2019-06-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -35.7066 21.4431 11.3530 0.0056 0.0176 -0.0175 0.0361 -0.0256 -0.0159 1.8822 -0.4808 1.4022 -1.4912 0.3019 0.8752 0.0428 -0.0514 0.0800 0.0027 -0.0333 0.0251 -0.0148 0.0034 -0.0095 'X-RAY DIFFRACTION' 2 ? refined -24.2942 22.9613 11.9216 0.0170 -0.0626 0.0121 0.0215 0.0067 -0.0205 1.7622 0.6914 0.0398 0.1909 -0.5809 0.9318 0.0941 -0.1105 0.1030 -0.0661 0.0000 -0.0359 -0.0728 -0.0070 -0.0941 'X-RAY DIFFRACTION' 3 ? refined -26.4431 11.3569 8.9139 -0.0123 -0.0114 0.0103 -0.0141 -0.0079 -0.0065 1.6612 3.2143 1.1009 0.6027 0.4746 0.2015 -0.0513 -0.0533 -0.0665 0.0766 0.0614 0.0751 0.0244 -0.0997 -0.0101 'X-RAY DIFFRACTION' 4 ? refined -16.6185 14.0795 12.5139 -0.0233 -0.0269 0.0109 -0.0096 -0.0099 -0.0016 1.3574 1.3165 2.5819 -0.1056 -0.3420 1.1331 0.1069 -0.0482 -0.0578 -0.0586 0.0557 -0.1675 0.1266 0.2108 -0.1625 'X-RAY DIFFRACTION' 5 ? refined -22.6660 25.6363 6.4543 0.0195 -0.0212 0.0024 0.0102 0.0179 -0.0130 -0.8712 2.1657 0.1247 0.4811 0.5981 -0.5989 -0.0730 0.0486 0.0917 0.0109 0.0501 -0.0409 -0.0911 0.0146 0.0229 'X-RAY DIFFRACTION' 6 ? refined -21.0927 16.5326 3.1200 -0.0131 -0.0521 -0.0081 -0.0048 0.0027 -0.0131 1.4605 1.7729 1.6354 0.5105 0.6080 0.2394 0.0338 0.1737 0.0262 -0.1661 0.0473 -0.1289 -0.1262 0.0197 -0.0811 'X-RAY DIFFRACTION' 7 ? refined -30.9837 25.4311 7.3967 0.0861 -0.0412 -0.0137 0.0086 0.0112 0.0003 2.4281 -0.3197 0.0775 0.4240 -1.7449 -0.3947 -0.0163 0.0177 0.1320 0.0218 0.0227 0.0379 -0.0560 0.0235 -0.0064 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '{ A|2 - A|11 }' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '{ A|12 - A|34 }' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '{ A|35 - A|57 }' 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '{ A|58 - A|87 }' 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? '{ A|88 - A|95 }' 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? '{ A|96 - A|129 }' 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? '{ A|130 - A|138 }' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.2 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 60 ? ? -117.86 -70.52 2 1 LYS A 73 ? ? -96.39 -146.64 3 1 ARG A 128 ? ? 87.94 -149.84 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A TYR 139 ? A TYR 139 3 1 Y 1 A LEU 140 ? A LEU 140 4 1 Y 1 A LYS 141 ? A LYS 141 5 1 Y 1 A ARG 142 ? A ARG 142 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 SAXS SAXS 2 1 'light scattering' SEC-MALLS #