data_6GPS # _entry.id 6GPS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.305 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6GPS WWPDB D_1200010392 # _pdbx_database_related.db_name PDB _pdbx_database_related.details '5t1a contains structure of CCR2B' _pdbx_database_related.db_id 5t1a _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6GPS _pdbx_database_status.recvd_initial_deposition_date 2018-06-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pautsch, A.' 1 ? 'Schnapp, G.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 1878-4186 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 427 _citation.page_last 438.e5 _citation.title ;Crystal Structure of CC Chemokine Receptor 2A in Complex with an Orthosteric Antagonist Provides Insights for the Design of Selective Antagonists. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2018.10.027 _citation.pdbx_database_id_PubMed 30581043 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Apel, A.K.' 1 ? primary 'Cheng, R.K.Y.' 2 ? primary 'Tautermann, C.S.' 3 ? primary 'Brauchle, M.' 4 ? primary 'Huang, C.Y.' 5 ? primary 'Pautsch, A.' 6 ? primary 'Hennig, M.' 7 ? primary 'Nar, H.' 8 ? primary 'Schnapp, G.' 9 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 97.66 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6GPS _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.500 _cell.length_a_esd ? _cell.length_b 61.200 _cell.length_b_esd ? _cell.length_c 123.570 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6GPS _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'C-C chemokine receptor type 2,Rubredoxin,C-C chemokine receptor type 2' 48278.184 1 ? ;N14Q, C70Y, G175N, A241D, K311E,N14Q, C70Y, G175N, A241D, K311E,N14Q, C70Y, G175N, A241D, K311E,N14Q, C70Y, G175N, A241D, K311E,N14Q, C70Y, G175N, A241D, K311E,N14Q, C70Y, G175N, A241D, K311E,N14Q, C70Y, G175N, A241D, K311E,N14Q, C70Y, G175N, A241D, K311E,N14Q, C70Y, G175N, A241D, K311E ; ;RUBREDOXIN INSERTED INTO CCR2A BETWEEN RESIDUE 231 AND 235,RUBREDOXIN INSERTED INTO CCR2A BETWEEN RESIDUE 231 AND 235,RUBREDOXIN INSERTED INTO CCR2A BETWEEN RESIDUE 231 AND 235,RUBREDOXIN INSERTED INTO CCR2A BETWEEN RESIDUE 231 AND 235,RUBREDOXIN INSERTED INTO CCR2A BETWEEN RESIDUE 231 AND 235,RUBREDOXIN INSERTED INTO CCR2A BETWEEN RESIDUE 231 AND 235,RUBREDOXIN INSERTED INTO CCR2A BETWEEN RESIDUE 231 AND 235,RUBREDOXIN INSERTED INTO CCR2A BETWEEN RESIDUE 231 AND 235,RUBREDOXIN INSERTED INTO CCR2A BETWEEN RESIDUE 231 AND 235 ; ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn ;[(3~{S},4~{S})-3-methoxyoxan-4-yl]-[(1~{R},3~{S})-3-propan-2-yl-3-[[3-(trifluoromethyl)-7,8-dihydro-5~{H}-1,6-naphthyridin-6-yl]carbonyl]cyclopentyl]azanium ; 470.548 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CCR2,Monocyte chemoattractant protein 1 receptor,MCP-1-R,Rd,CCR2,Monocyte chemoattractant protein 1 receptor,MCP-1-R' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;LSTSRSRFIRNTQESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINYKKLKCLTDIYL LNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTS VITWLVAVFASVPNIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRMKKYTCTVCG YIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEEEKKRHRDVRVIFTIMIVYFLFWTPYNIVILLNTFQE FFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEEFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGL LDGRGKGKSIGRAPEASLQDKEGAEVLFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;LSTSRSRFIRNTQESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINYKKLKCLTDIYL LNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTS VITWLVAVFASVPNIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRMKKYTCTVCG YIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEEEKKRHRDVRVIFTIMIVYFLFWTPYNIVILLNTFQE FFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEEFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGL LDGRGKGKSIGRAPEASLQDKEGAEVLFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 SER n 1 3 THR n 1 4 SER n 1 5 ARG n 1 6 SER n 1 7 ARG n 1 8 PHE n 1 9 ILE n 1 10 ARG n 1 11 ASN n 1 12 THR n 1 13 GLN n 1 14 GLU n 1 15 SER n 1 16 GLY n 1 17 GLU n 1 18 GLU n 1 19 VAL n 1 20 THR n 1 21 THR n 1 22 PHE n 1 23 PHE n 1 24 ASP n 1 25 TYR n 1 26 ASP n 1 27 TYR n 1 28 GLY n 1 29 ALA n 1 30 PRO n 1 31 CYS n 1 32 HIS n 1 33 LYS n 1 34 PHE n 1 35 ASP n 1 36 VAL n 1 37 LYS n 1 38 GLN n 1 39 ILE n 1 40 GLY n 1 41 ALA n 1 42 GLN n 1 43 LEU n 1 44 LEU n 1 45 PRO n 1 46 PRO n 1 47 LEU n 1 48 TYR n 1 49 SER n 1 50 LEU n 1 51 VAL n 1 52 PHE n 1 53 ILE n 1 54 PHE n 1 55 GLY n 1 56 PHE n 1 57 VAL n 1 58 GLY n 1 59 ASN n 1 60 MET n 1 61 LEU n 1 62 VAL n 1 63 VAL n 1 64 LEU n 1 65 ILE n 1 66 LEU n 1 67 ILE n 1 68 ASN n 1 69 TYR n 1 70 LYS n 1 71 LYS n 1 72 LEU n 1 73 LYS n 1 74 CYS n 1 75 LEU n 1 76 THR n 1 77 ASP n 1 78 ILE n 1 79 TYR n 1 80 LEU n 1 81 LEU n 1 82 ASN n 1 83 LEU n 1 84 ALA n 1 85 ILE n 1 86 SER n 1 87 ASP n 1 88 LEU n 1 89 LEU n 1 90 PHE n 1 91 LEU n 1 92 ILE n 1 93 THR n 1 94 LEU n 1 95 PRO n 1 96 LEU n 1 97 TRP n 1 98 ALA n 1 99 HIS n 1 100 SER n 1 101 ALA n 1 102 ALA n 1 103 ASN n 1 104 GLU n 1 105 TRP n 1 106 VAL n 1 107 PHE n 1 108 GLY n 1 109 ASN n 1 110 ALA n 1 111 MET n 1 112 CYS n 1 113 LYS n 1 114 LEU n 1 115 PHE n 1 116 THR n 1 117 GLY n 1 118 LEU n 1 119 TYR n 1 120 HIS n 1 121 ILE n 1 122 GLY n 1 123 TYR n 1 124 PHE n 1 125 GLY n 1 126 GLY n 1 127 ILE n 1 128 PHE n 1 129 PHE n 1 130 ILE n 1 131 ILE n 1 132 LEU n 1 133 LEU n 1 134 THR n 1 135 ILE n 1 136 ASP n 1 137 ARG n 1 138 TYR n 1 139 LEU n 1 140 ALA n 1 141 ILE n 1 142 VAL n 1 143 HIS n 1 144 ALA n 1 145 VAL n 1 146 PHE n 1 147 ALA n 1 148 LEU n 1 149 LYS n 1 150 ALA n 1 151 ARG n 1 152 THR n 1 153 VAL n 1 154 THR n 1 155 PHE n 1 156 GLY n 1 157 VAL n 1 158 VAL n 1 159 THR n 1 160 SER n 1 161 VAL n 1 162 ILE n 1 163 THR n 1 164 TRP n 1 165 LEU n 1 166 VAL n 1 167 ALA n 1 168 VAL n 1 169 PHE n 1 170 ALA n 1 171 SER n 1 172 VAL n 1 173 PRO n 1 174 ASN n 1 175 ILE n 1 176 ILE n 1 177 PHE n 1 178 THR n 1 179 LYS n 1 180 CYS n 1 181 GLN n 1 182 LYS n 1 183 GLU n 1 184 ASP n 1 185 SER n 1 186 VAL n 1 187 TYR n 1 188 VAL n 1 189 CYS n 1 190 GLY n 1 191 PRO n 1 192 TYR n 1 193 PHE n 1 194 PRO n 1 195 ARG n 1 196 GLY n 1 197 TRP n 1 198 ASN n 1 199 ASN n 1 200 PHE n 1 201 HIS n 1 202 THR n 1 203 ILE n 1 204 MET n 1 205 ARG n 1 206 ASN n 1 207 ILE n 1 208 LEU n 1 209 GLY n 1 210 LEU n 1 211 VAL n 1 212 LEU n 1 213 PRO n 1 214 LEU n 1 215 LEU n 1 216 ILE n 1 217 MET n 1 218 VAL n 1 219 ILE n 1 220 CYS n 1 221 TYR n 1 222 SER n 1 223 GLY n 1 224 ILE n 1 225 LEU n 1 226 LYS n 1 227 THR n 1 228 LEU n 1 229 LEU n 1 230 ARG n 1 231 MET n 1 232 LYS n 1 233 LYS n 1 234 TYR n 1 235 THR n 1 236 CYS n 1 237 THR n 1 238 VAL n 1 239 CYS n 1 240 GLY n 1 241 TYR n 1 242 ILE n 1 243 TYR n 1 244 ASN n 1 245 PRO n 1 246 GLU n 1 247 ASP n 1 248 GLY n 1 249 ASP n 1 250 PRO n 1 251 ASP n 1 252 ASN n 1 253 GLY n 1 254 VAL n 1 255 ASN n 1 256 PRO n 1 257 GLY n 1 258 THR n 1 259 ASP n 1 260 PHE n 1 261 LYS n 1 262 ASP n 1 263 ILE n 1 264 PRO n 1 265 ASP n 1 266 ASP n 1 267 TRP n 1 268 VAL n 1 269 CYS n 1 270 PRO n 1 271 LEU n 1 272 CYS n 1 273 GLY n 1 274 VAL n 1 275 GLY n 1 276 LYS n 1 277 ASP n 1 278 GLN n 1 279 PHE n 1 280 GLU n 1 281 GLU n 1 282 VAL n 1 283 GLU n 1 284 GLU n 1 285 GLU n 1 286 LYS n 1 287 LYS n 1 288 ARG n 1 289 HIS n 1 290 ARG n 1 291 ASP n 1 292 VAL n 1 293 ARG n 1 294 VAL n 1 295 ILE n 1 296 PHE n 1 297 THR n 1 298 ILE n 1 299 MET n 1 300 ILE n 1 301 VAL n 1 302 TYR n 1 303 PHE n 1 304 LEU n 1 305 PHE n 1 306 TRP n 1 307 THR n 1 308 PRO n 1 309 TYR n 1 310 ASN n 1 311 ILE n 1 312 VAL n 1 313 ILE n 1 314 LEU n 1 315 LEU n 1 316 ASN n 1 317 THR n 1 318 PHE n 1 319 GLN n 1 320 GLU n 1 321 PHE n 1 322 PHE n 1 323 GLY n 1 324 LEU n 1 325 SER n 1 326 ASN n 1 327 CYS n 1 328 GLU n 1 329 SER n 1 330 THR n 1 331 SER n 1 332 GLN n 1 333 LEU n 1 334 ASP n 1 335 GLN n 1 336 ALA n 1 337 THR n 1 338 GLN n 1 339 VAL n 1 340 THR n 1 341 GLU n 1 342 THR n 1 343 LEU n 1 344 GLY n 1 345 MET n 1 346 THR n 1 347 HIS n 1 348 CYS n 1 349 CYS n 1 350 ILE n 1 351 ASN n 1 352 PRO n 1 353 ILE n 1 354 ILE n 1 355 TYR n 1 356 ALA n 1 357 PHE n 1 358 VAL n 1 359 GLY n 1 360 GLU n 1 361 GLU n 1 362 PHE n 1 363 ARG n 1 364 SER n 1 365 LEU n 1 366 PHE n 1 367 HIS n 1 368 ILE n 1 369 ALA n 1 370 LEU n 1 371 GLY n 1 372 CYS n 1 373 ARG n 1 374 ILE n 1 375 ALA n 1 376 PRO n 1 377 LEU n 1 378 GLN n 1 379 LYS n 1 380 PRO n 1 381 VAL n 1 382 CYS n 1 383 GLY n 1 384 GLY n 1 385 PRO n 1 386 GLY n 1 387 VAL n 1 388 ARG n 1 389 PRO n 1 390 GLY n 1 391 LYS n 1 392 ASN n 1 393 VAL n 1 394 LYS n 1 395 VAL n 1 396 THR n 1 397 THR n 1 398 GLN n 1 399 GLY n 1 400 LEU n 1 401 LEU n 1 402 ASP n 1 403 GLY n 1 404 ARG n 1 405 GLY n 1 406 LYS n 1 407 GLY n 1 408 LYS n 1 409 SER n 1 410 ILE n 1 411 GLY n 1 412 ARG n 1 413 ALA n 1 414 PRO n 1 415 GLU n 1 416 ALA n 1 417 SER n 1 418 LEU n 1 419 GLN n 1 420 ASP n 1 421 LYS n 1 422 GLU n 1 423 GLY n 1 424 ALA n 1 425 GLU n 1 426 VAL n 1 427 LEU n 1 428 PHE n 1 429 GLN n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 230 Human ? 'CCR2, CMKBR2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 231 284 ? ? ? ? ? ? ? ? ? 'Clostridium pasteurianum' 1501 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 3 sample 'Biological sequence' 285 424 Human ? 'CCR2, CMKBR2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP CCR2_HUMAN P41597 ? 1 ;LSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYL LNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTS VITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLR ; 2 2 UNP RUBR_CLOPA P00268 ? 1 MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE 1 3 UNP CCR2_HUMAN P41597 ? 1 ;EKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRS LFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA ; 235 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6GPS A 1 ? 230 ? P41597 2 ? 231 ? 2 231 2 2 6GPS A 231 ? 284 ? P00268 1 ? 54 ? 1001 1054 3 3 6GPS A 285 ? 424 ? P41597 235 ? 374 ? 235 374 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6GPS GLN A 13 ? UNP P41597 ASN 14 'engineered mutation' 14 1 1 6GPS TYR A 69 ? UNP P41597 CYS 70 'engineered mutation' 70 2 1 6GPS ASN A 174 ? UNP P41597 GLY 175 'engineered mutation' 175 3 3 6GPS ASP A 291 ? UNP P41597 ALA 241 'engineered mutation' 241 4 3 6GPS GLU A 361 ? UNP P41597 LYS 311 'engineered mutation' 311 5 3 6GPS GLU A 425 ? UNP P41597 ? ? 'expression tag' 375 6 3 6GPS VAL A 426 ? UNP P41597 ? ? 'expression tag' 376 7 3 6GPS LEU A 427 ? UNP P41597 ? ? 'expression tag' 377 8 3 6GPS PHE A 428 ? UNP P41597 ? ? 'expression tag' 378 9 3 6GPS GLN A 429 ? UNP P41597 ? ? 'expression tag' 379 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 F7N non-polymer . ;[(3~{S},4~{S})-3-methoxyoxan-4-yl]-[(1~{R},3~{S})-3-propan-2-yl-3-[[3-(trifluoromethyl)-7,8-dihydro-5~{H}-1,6-naphthyridin-6-yl]carbonyl]cyclopentyl]azanium ; ? 'C24 H35 F3 N3 O3 1' 470.548 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6GPS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.99 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.84 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'LIPIDIC CUBIC PHASE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;reconstituted into lipidic cubic phase (LCP) by mixing with 9.9 MAG (Monoolein, Sigma) using a syringe mixer as described previously (Caffrey and Cherezov, 2009). 35 % (w/w) of the receptor solution was mixed with 61.5 % monoolein (w/w), additionally supplemented with 3.5 % cholesterol (w/w). Crystallization trials were performed in 96-well glass sandwich plates (Molecular Dimensions). The LCP drops were pipetted in a bolus volume of 50 nl using a gryphon robot and overlaid with 800 nl of precipitant solution per well. Diffracting quality crystals were obtained with 0.1 M MES pH 6.0, 0.2 M ammonium acetate and 40 % PEG400 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-07-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06DA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06DA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 99.49 _reflns.entry_id 6GPS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.30 _reflns.d_resolution_low 43.29 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8271 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.1 _reflns.pdbx_Rmerge_I_obs 0.131 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.087 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.30 _reflns_shell.d_res_low 3.57 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.479 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 24.16420 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 7.67710 _refine.aniso_B[2][2] -34.11460 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] 9.95040 _refine.B_iso_max ? _refine.B_iso_mean 111.76 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.897 _refine.correlation_coeff_Fo_to_Fc_free 0.783 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6GPS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.30 _refine.ls_d_res_low 37.89 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8261 _refine.ls_number_reflns_R_free 372 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.6 _refine.ls_percent_reflns_R_free 4.500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.245 _refine.ls_R_factor_R_free 0.296 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.243 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI 0.545 _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 6GPS _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.57 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2649 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2683 _refine_hist.d_res_high 3.30 _refine_hist.d_res_low 37.89 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 5481 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 0.77 ? 9941 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1194 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_trig_c_planes ? ? 'X-RAY DIFFRACTION' ? ? ? 810 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 5481 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1 ? t_nbd 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 1.99 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 16.35 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 366 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 5440 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.30 _refine_ls_shell.d_res_low 3.37 _refine_ls_shell.number_reflns_all 459 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_R_work 439 _refine_ls_shell.percent_reflns_obs 93.09 _refine_ls_shell.percent_reflns_R_free 4.36 _refine_ls_shell.R_factor_all 0.2365 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2583 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2355 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 18 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6GPS _struct.title 'CRYSTAL STRUCTURE OF CCR2A IN COMPLEX WITH MK-0812' _struct.pdbx_descriptor 'C-C chemokine receptor type 2,Rubredoxin,C-C chemokine receptor type 2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6GPS _struct_keywords.text 'GPCR, Signalling, Drug-design, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 36 ? TYR A 69 ? VAL A 37 TYR A 70 1 ? 34 HELX_P HELX_P2 AA2 CYS A 74 ? ILE A 92 ? CYS A 75 ILE A 93 1 ? 19 HELX_P HELX_P3 AA3 THR A 93 ? ALA A 101 ? THR A 94 ALA A 102 1 ? 9 HELX_P HELX_P4 AA4 GLY A 108 ? VAL A 142 ? GLY A 109 VAL A 143 1 ? 35 HELX_P HELX_P5 AA5 ARG A 151 ? PHE A 177 ? ARG A 152 PHE A 178 1 ? 27 HELX_P HELX_P6 AA6 PRO A 194 ? LEU A 210 ? PRO A 195 LEU A 211 1 ? 17 HELX_P HELX_P7 AA7 LEU A 210 ? LYS A 232 ? LEU A 211 LYS A 1002 1 ? 23 HELX_P HELX_P8 AA8 ASP A 249 ? GLY A 253 ? ASP A 1019 GLY A 1023 5 ? 5 HELX_P HELX_P9 AA9 GLY A 275 ? ASP A 277 ? GLY A 1045 ASP A 1047 5 ? 3 HELX_P HELX_P10 AB1 LYS A 286 ? ASP A 291 ? LYS A 236 ASP A 241 1 ? 6 HELX_P HELX_P11 AB2 ASP A 291 ? PHE A 318 ? ASP A 241 PHE A 268 1 ? 28 HELX_P HELX_P12 AB3 THR A 330 ? HIS A 347 ? THR A 280 HIS A 297 1 ? 18 HELX_P HELX_P13 AB4 ILE A 350 ? VAL A 358 ? ILE A 300 VAL A 308 1 ? 9 HELX_P HELX_P14 AB5 GLU A 360 ? ALA A 369 ? GLU A 310 ALA A 319 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 112 SG ? ? ? 1_555 A CYS 189 SG ? ? A CYS 113 A CYS 190 1_555 ? ? ? ? ? ? ? 2.035 ? metalc1 metalc ? ? A CYS 236 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 1006 A ZN 1101 1_555 ? ? ? ? ? ? ? 2.810 ? metalc2 metalc ? ? A CYS 239 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 1009 A ZN 1101 1_555 ? ? ? ? ? ? ? 2.427 ? metalc3 metalc ? ? A CYS 269 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 1039 A ZN 1101 1_555 ? ? ? ? ? ? ? 2.528 ? metalc4 metalc ? ? A CYS 272 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 1042 A ZN 1101 1_555 ? ? ? ? ? ? ? 2.180 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 178 ? GLU A 183 ? THR A 179 GLU A 184 AA1 2 VAL A 186 ? PRO A 191 ? VAL A 187 PRO A 192 AA2 1 ILE A 242 ? TYR A 243 ? ILE A 1012 TYR A 1013 AA2 2 TYR A 234 ? CYS A 236 ? TYR A 1004 CYS A 1006 AA2 3 PHE A 279 ? GLU A 281 ? PHE A 1049 GLU A 1051 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 181 ? N GLN A 182 O VAL A 188 ? O VAL A 189 AA2 1 2 O TYR A 243 ? O TYR A 1013 N TYR A 234 ? N TYR A 1004 AA2 2 3 N THR A 235 ? N THR A 1005 O GLU A 280 ? O GLU A 1050 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 1101 ? 5 'binding site for residue ZN A 1101' AC2 Software A F7N 1102 ? 15 'binding site for residue F7N A 1102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 236 ? CYS A 1006 . ? 1_555 ? 2 AC1 5 CYS A 239 ? CYS A 1009 . ? 1_555 ? 3 AC1 5 CYS A 269 ? CYS A 1039 . ? 1_555 ? 4 AC1 5 CYS A 272 ? CYS A 1042 . ? 1_555 ? 5 AC1 5 VAL A 274 ? VAL A 1044 . ? 1_555 ? 6 AC2 15 VAL A 36 ? VAL A 37 . ? 1_555 ? 7 AC2 15 ILE A 39 ? ILE A 40 . ? 1_555 ? 8 AC2 15 GLY A 40 ? GLY A 41 . ? 1_555 ? 9 AC2 15 LEU A 43 ? LEU A 44 . ? 1_555 ? 10 AC2 15 LEU A 44 ? LEU A 45 . ? 1_555 ? 11 AC2 15 TYR A 48 ? TYR A 49 . ? 1_555 ? 12 AC2 15 TRP A 97 ? TRP A 98 . ? 1_555 ? 13 AC2 15 THR A 116 ? THR A 117 . ? 1_555 ? 14 AC2 15 HIS A 120 ? HIS A 121 . ? 1_555 ? 15 AC2 15 CYS A 189 ? CYS A 190 . ? 1_555 ? 16 AC2 15 GLN A 338 ? GLN A 288 . ? 1_555 ? 17 AC2 15 VAL A 339 ? VAL A 289 . ? 1_555 ? 18 AC2 15 GLU A 341 ? GLU A 291 . ? 1_555 ? 19 AC2 15 THR A 342 ? THR A 292 . ? 1_555 ? 20 AC2 15 MET A 345 ? MET A 295 . ? 1_555 ? # _atom_sites.entry_id 6GPS _atom_sites.fract_transf_matrix[1][1] 0.025974 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003493 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016340 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008165 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 2 ? ? ? A . n A 1 2 SER 2 3 ? ? ? A . n A 1 3 THR 3 4 ? ? ? A . n A 1 4 SER 4 5 ? ? ? A . n A 1 5 ARG 5 6 ? ? ? A . n A 1 6 SER 6 7 ? ? ? A . n A 1 7 ARG 7 8 ? ? ? A . n A 1 8 PHE 8 9 ? ? ? A . n A 1 9 ILE 9 10 ? ? ? A . n A 1 10 ARG 10 11 ? ? ? A . n A 1 11 ASN 11 12 ? ? ? A . n A 1 12 THR 12 13 ? ? ? A . n A 1 13 GLN 13 14 ? ? ? A . n A 1 14 GLU 14 15 ? ? ? A . n A 1 15 SER 15 16 ? ? ? A . n A 1 16 GLY 16 17 ? ? ? A . n A 1 17 GLU 17 18 ? ? ? A . n A 1 18 GLU 18 19 ? ? ? A . n A 1 19 VAL 19 20 ? ? ? A . n A 1 20 THR 20 21 ? ? ? A . n A 1 21 THR 21 22 ? ? ? A . n A 1 22 PHE 22 23 ? ? ? A . n A 1 23 PHE 23 24 ? ? ? A . n A 1 24 ASP 24 25 ? ? ? A . n A 1 25 TYR 25 26 ? ? ? A . n A 1 26 ASP 26 27 ? ? ? A . n A 1 27 TYR 27 28 ? ? ? A . n A 1 28 GLY 28 29 ? ? ? A . n A 1 29 ALA 29 30 ? ? ? A . n A 1 30 PRO 30 31 ? ? ? A . n A 1 31 CYS 31 32 ? ? ? A . n A 1 32 HIS 32 33 ? ? ? A . n A 1 33 LYS 33 34 ? ? ? A . n A 1 34 PHE 34 35 ? ? ? A . n A 1 35 ASP 35 36 ? ? ? A . n A 1 36 VAL 36 37 37 VAL VAL A . n A 1 37 LYS 37 38 38 LYS LYS A . n A 1 38 GLN 38 39 39 GLN GLN A . n A 1 39 ILE 39 40 40 ILE ILE A . n A 1 40 GLY 40 41 41 GLY GLY A . n A 1 41 ALA 41 42 42 ALA ALA A . n A 1 42 GLN 42 43 43 GLN GLN A . n A 1 43 LEU 43 44 44 LEU LEU A . n A 1 44 LEU 44 45 45 LEU LEU A . n A 1 45 PRO 45 46 46 PRO PRO A . n A 1 46 PRO 46 47 47 PRO PRO A . n A 1 47 LEU 47 48 48 LEU LEU A . n A 1 48 TYR 48 49 49 TYR TYR A . n A 1 49 SER 49 50 50 SER SER A . n A 1 50 LEU 50 51 51 LEU LEU A . n A 1 51 VAL 51 52 52 VAL VAL A . n A 1 52 PHE 52 53 53 PHE PHE A . n A 1 53 ILE 53 54 54 ILE ILE A . n A 1 54 PHE 54 55 55 PHE PHE A . n A 1 55 GLY 55 56 56 GLY GLY A . n A 1 56 PHE 56 57 57 PHE PHE A . n A 1 57 VAL 57 58 58 VAL VAL A . n A 1 58 GLY 58 59 59 GLY GLY A . n A 1 59 ASN 59 60 60 ASN ASN A . n A 1 60 MET 60 61 61 MET MET A . n A 1 61 LEU 61 62 62 LEU LEU A . n A 1 62 VAL 62 63 63 VAL VAL A . n A 1 63 VAL 63 64 64 VAL VAL A . n A 1 64 LEU 64 65 65 LEU LEU A . n A 1 65 ILE 65 66 66 ILE ILE A . n A 1 66 LEU 66 67 67 LEU LEU A . n A 1 67 ILE 67 68 68 ILE ILE A . n A 1 68 ASN 68 69 69 ASN ASN A . n A 1 69 TYR 69 70 70 TYR TYR A . n A 1 70 LYS 70 71 71 LYS LYS A . n A 1 71 LYS 71 72 72 LYS LYS A . n A 1 72 LEU 72 73 73 LEU LEU A . n A 1 73 LYS 73 74 74 LYS LYS A . n A 1 74 CYS 74 75 75 CYS CYS A . n A 1 75 LEU 75 76 76 LEU LEU A . n A 1 76 THR 76 77 77 THR THR A . n A 1 77 ASP 77 78 78 ASP ASP A . n A 1 78 ILE 78 79 79 ILE ILE A . n A 1 79 TYR 79 80 80 TYR TYR A . n A 1 80 LEU 80 81 81 LEU LEU A . n A 1 81 LEU 81 82 82 LEU LEU A . n A 1 82 ASN 82 83 83 ASN ASN A . n A 1 83 LEU 83 84 84 LEU LEU A . n A 1 84 ALA 84 85 85 ALA ALA A . n A 1 85 ILE 85 86 86 ILE ILE A . n A 1 86 SER 86 87 87 SER SER A . n A 1 87 ASP 87 88 88 ASP ASP A . n A 1 88 LEU 88 89 89 LEU LEU A . n A 1 89 LEU 89 90 90 LEU LEU A . n A 1 90 PHE 90 91 91 PHE PHE A . n A 1 91 LEU 91 92 92 LEU LEU A . n A 1 92 ILE 92 93 93 ILE ILE A . n A 1 93 THR 93 94 94 THR THR A . n A 1 94 LEU 94 95 95 LEU LEU A . n A 1 95 PRO 95 96 96 PRO PRO A . n A 1 96 LEU 96 97 97 LEU LEU A . n A 1 97 TRP 97 98 98 TRP TRP A . n A 1 98 ALA 98 99 99 ALA ALA A . n A 1 99 HIS 99 100 100 HIS HIS A . n A 1 100 SER 100 101 101 SER SER A . n A 1 101 ALA 101 102 102 ALA ALA A . n A 1 102 ALA 102 103 103 ALA ALA A . n A 1 103 ASN 103 104 104 ASN ASN A . n A 1 104 GLU 104 105 105 GLU GLU A . n A 1 105 TRP 105 106 106 TRP TRP A . n A 1 106 VAL 106 107 107 VAL VAL A . n A 1 107 PHE 107 108 108 PHE PHE A . n A 1 108 GLY 108 109 109 GLY GLY A . n A 1 109 ASN 109 110 110 ASN ASN A . n A 1 110 ALA 110 111 111 ALA ALA A . n A 1 111 MET 111 112 112 MET MET A . n A 1 112 CYS 112 113 113 CYS CYS A . n A 1 113 LYS 113 114 114 LYS LYS A . n A 1 114 LEU 114 115 115 LEU LEU A . n A 1 115 PHE 115 116 116 PHE PHE A . n A 1 116 THR 116 117 117 THR THR A . n A 1 117 GLY 117 118 118 GLY GLY A . n A 1 118 LEU 118 119 119 LEU LEU A . n A 1 119 TYR 119 120 120 TYR TYR A . n A 1 120 HIS 120 121 121 HIS HIS A . n A 1 121 ILE 121 122 122 ILE ILE A . n A 1 122 GLY 122 123 123 GLY GLY A . n A 1 123 TYR 123 124 124 TYR TYR A . n A 1 124 PHE 124 125 125 PHE PHE A . n A 1 125 GLY 125 126 126 GLY GLY A . n A 1 126 GLY 126 127 127 GLY GLY A . n A 1 127 ILE 127 128 128 ILE ILE A . n A 1 128 PHE 128 129 129 PHE PHE A . n A 1 129 PHE 129 130 130 PHE PHE A . n A 1 130 ILE 130 131 131 ILE ILE A . n A 1 131 ILE 131 132 132 ILE ILE A . n A 1 132 LEU 132 133 133 LEU LEU A . n A 1 133 LEU 133 134 134 LEU LEU A . n A 1 134 THR 134 135 135 THR THR A . n A 1 135 ILE 135 136 136 ILE ILE A . n A 1 136 ASP 136 137 137 ASP ASP A . n A 1 137 ARG 137 138 138 ARG ARG A . n A 1 138 TYR 138 139 139 TYR TYR A . n A 1 139 LEU 139 140 140 LEU LEU A . n A 1 140 ALA 140 141 141 ALA ALA A . n A 1 141 ILE 141 142 142 ILE ILE A . n A 1 142 VAL 142 143 143 VAL VAL A . n A 1 143 HIS 143 144 144 HIS HIS A . n A 1 144 ALA 144 145 145 ALA ALA A . n A 1 145 VAL 145 146 146 VAL VAL A . n A 1 146 PHE 146 147 147 PHE PHE A . n A 1 147 ALA 147 148 148 ALA ALA A . n A 1 148 LEU 148 149 149 LEU LEU A . n A 1 149 LYS 149 150 150 LYS LYS A . n A 1 150 ALA 150 151 151 ALA ALA A . n A 1 151 ARG 151 152 152 ARG ARG A . n A 1 152 THR 152 153 153 THR THR A . n A 1 153 VAL 153 154 154 VAL VAL A . n A 1 154 THR 154 155 155 THR THR A . n A 1 155 PHE 155 156 156 PHE PHE A . n A 1 156 GLY 156 157 157 GLY GLY A . n A 1 157 VAL 157 158 158 VAL VAL A . n A 1 158 VAL 158 159 159 VAL VAL A . n A 1 159 THR 159 160 160 THR THR A . n A 1 160 SER 160 161 161 SER SER A . n A 1 161 VAL 161 162 162 VAL VAL A . n A 1 162 ILE 162 163 163 ILE ILE A . n A 1 163 THR 163 164 164 THR THR A . n A 1 164 TRP 164 165 165 TRP TRP A . n A 1 165 LEU 165 166 166 LEU LEU A . n A 1 166 VAL 166 167 167 VAL VAL A . n A 1 167 ALA 167 168 168 ALA ALA A . n A 1 168 VAL 168 169 169 VAL VAL A . n A 1 169 PHE 169 170 170 PHE PHE A . n A 1 170 ALA 170 171 171 ALA ALA A . n A 1 171 SER 171 172 172 SER SER A . n A 1 172 VAL 172 173 173 VAL VAL A . n A 1 173 PRO 173 174 174 PRO PRO A . n A 1 174 ASN 174 175 175 ASN ASN A . n A 1 175 ILE 175 176 176 ILE ILE A . n A 1 176 ILE 176 177 177 ILE ILE A . n A 1 177 PHE 177 178 178 PHE PHE A . n A 1 178 THR 178 179 179 THR THR A . n A 1 179 LYS 179 180 180 LYS LYS A . n A 1 180 CYS 180 181 181 CYS CYS A . n A 1 181 GLN 181 182 182 GLN GLN A . n A 1 182 LYS 182 183 183 LYS LYS A . n A 1 183 GLU 183 184 184 GLU GLU A . n A 1 184 ASP 184 185 185 ASP ASP A . n A 1 185 SER 185 186 186 SER SER A . n A 1 186 VAL 186 187 187 VAL VAL A . n A 1 187 TYR 187 188 188 TYR TYR A . n A 1 188 VAL 188 189 189 VAL VAL A . n A 1 189 CYS 189 190 190 CYS CYS A . n A 1 190 GLY 190 191 191 GLY GLY A . n A 1 191 PRO 191 192 192 PRO PRO A . n A 1 192 TYR 192 193 193 TYR TYR A . n A 1 193 PHE 193 194 194 PHE PHE A . n A 1 194 PRO 194 195 195 PRO PRO A . n A 1 195 ARG 195 196 196 ARG ARG A . n A 1 196 GLY 196 197 197 GLY GLY A . n A 1 197 TRP 197 198 198 TRP TRP A . n A 1 198 ASN 198 199 199 ASN ASN A . n A 1 199 ASN 199 200 200 ASN ASN A . n A 1 200 PHE 200 201 201 PHE PHE A . n A 1 201 HIS 201 202 202 HIS HIS A . n A 1 202 THR 202 203 203 THR THR A . n A 1 203 ILE 203 204 204 ILE ILE A . n A 1 204 MET 204 205 205 MET MET A . n A 1 205 ARG 205 206 206 ARG ARG A . n A 1 206 ASN 206 207 207 ASN ASN A . n A 1 207 ILE 207 208 208 ILE ILE A . n A 1 208 LEU 208 209 209 LEU LEU A . n A 1 209 GLY 209 210 210 GLY GLY A . n A 1 210 LEU 210 211 211 LEU LEU A . n A 1 211 VAL 211 212 212 VAL VAL A . n A 1 212 LEU 212 213 213 LEU LEU A . n A 1 213 PRO 213 214 214 PRO PRO A . n A 1 214 LEU 214 215 215 LEU LEU A . n A 1 215 LEU 215 216 216 LEU LEU A . n A 1 216 ILE 216 217 217 ILE ILE A . n A 1 217 MET 217 218 218 MET MET A . n A 1 218 VAL 218 219 219 VAL VAL A . n A 1 219 ILE 219 220 220 ILE ILE A . n A 1 220 CYS 220 221 221 CYS CYS A . n A 1 221 TYR 221 222 222 TYR TYR A . n A 1 222 SER 222 223 223 SER SER A . n A 1 223 GLY 223 224 224 GLY GLY A . n A 1 224 ILE 224 225 225 ILE ILE A . n A 1 225 LEU 225 226 226 LEU LEU A . n A 1 226 LYS 226 227 227 LYS LYS A . n A 1 227 THR 227 228 228 THR THR A . n A 1 228 LEU 228 229 229 LEU LEU A . n A 1 229 LEU 229 230 230 LEU LEU A . n A 1 230 ARG 230 231 231 ARG ARG A . n A 1 231 MET 231 1001 1001 MET MET A . n A 1 232 LYS 232 1002 1002 LYS LYS A . n A 1 233 LYS 233 1003 1003 LYS LYS A . n A 1 234 TYR 234 1004 1004 TYR TYR A . n A 1 235 THR 235 1005 1005 THR THR A . n A 1 236 CYS 236 1006 1006 CYS CYS A . n A 1 237 THR 237 1007 1007 THR THR A . n A 1 238 VAL 238 1008 1008 VAL VAL A . n A 1 239 CYS 239 1009 1009 CYS CYS A . n A 1 240 GLY 240 1010 1010 GLY GLY A . n A 1 241 TYR 241 1011 1011 TYR TYR A . n A 1 242 ILE 242 1012 1012 ILE ILE A . n A 1 243 TYR 243 1013 1013 TYR TYR A . n A 1 244 ASN 244 1014 1014 ASN ASN A . n A 1 245 PRO 245 1015 1015 PRO PRO A . n A 1 246 GLU 246 1016 1016 GLU GLU A . n A 1 247 ASP 247 1017 1017 ASP ASP A . n A 1 248 GLY 248 1018 1018 GLY GLY A . n A 1 249 ASP 249 1019 1019 ASP ASP A . n A 1 250 PRO 250 1020 1020 PRO PRO A . n A 1 251 ASP 251 1021 1021 ASP ASP A . n A 1 252 ASN 252 1022 1022 ASN ASN A . n A 1 253 GLY 253 1023 1023 GLY GLY A . n A 1 254 VAL 254 1024 1024 VAL VAL A . n A 1 255 ASN 255 1025 1025 ASN ASN A . n A 1 256 PRO 256 1026 1026 PRO PRO A . n A 1 257 GLY 257 1027 1027 GLY GLY A . n A 1 258 THR 258 1028 1028 THR THR A . n A 1 259 ASP 259 1029 1029 ASP ASP A . n A 1 260 PHE 260 1030 1030 PHE PHE A . n A 1 261 LYS 261 1031 1031 LYS LYS A . n A 1 262 ASP 262 1032 1032 ASP ASP A . n A 1 263 ILE 263 1033 1033 ILE ILE A . n A 1 264 PRO 264 1034 1034 PRO PRO A . n A 1 265 ASP 265 1035 1035 ASP ASP A . n A 1 266 ASP 266 1036 1036 ASP ASP A . n A 1 267 TRP 267 1037 1037 TRP TRP A . n A 1 268 VAL 268 1038 1038 VAL VAL A . n A 1 269 CYS 269 1039 1039 CYS CYS A . n A 1 270 PRO 270 1040 1040 PRO PRO A . n A 1 271 LEU 271 1041 1041 LEU LEU A . n A 1 272 CYS 272 1042 1042 CYS CYS A . n A 1 273 GLY 273 1043 1043 GLY GLY A . n A 1 274 VAL 274 1044 1044 VAL VAL A . n A 1 275 GLY 275 1045 1045 GLY GLY A . n A 1 276 LYS 276 1046 1046 LYS LYS A . n A 1 277 ASP 277 1047 1047 ASP ASP A . n A 1 278 GLN 278 1048 1048 GLN GLN A . n A 1 279 PHE 279 1049 1049 PHE PHE A . n A 1 280 GLU 280 1050 1050 GLU GLU A . n A 1 281 GLU 281 1051 1051 GLU GLU A . n A 1 282 VAL 282 1052 1052 VAL VAL A . n A 1 283 GLU 283 1053 1053 GLU GLU A . n A 1 284 GLU 284 1054 1054 GLU GLU A . n A 1 285 GLU 285 235 235 GLU GLU A . n A 1 286 LYS 286 236 236 LYS LYS A . n A 1 287 LYS 287 237 237 LYS LYS A . n A 1 288 ARG 288 238 238 ARG ARG A . n A 1 289 HIS 289 239 239 HIS HIS A . n A 1 290 ARG 290 240 240 ARG ARG A . n A 1 291 ASP 291 241 241 ASP ASP A . n A 1 292 VAL 292 242 242 VAL VAL A . n A 1 293 ARG 293 243 243 ARG ARG A . n A 1 294 VAL 294 244 244 VAL VAL A . n A 1 295 ILE 295 245 245 ILE ILE A . n A 1 296 PHE 296 246 246 PHE PHE A . n A 1 297 THR 297 247 247 THR THR A . n A 1 298 ILE 298 248 248 ILE ILE A . n A 1 299 MET 299 249 249 MET MET A . n A 1 300 ILE 300 250 250 ILE ILE A . n A 1 301 VAL 301 251 251 VAL VAL A . n A 1 302 TYR 302 252 252 TYR TYR A . n A 1 303 PHE 303 253 253 PHE PHE A . n A 1 304 LEU 304 254 254 LEU LEU A . n A 1 305 PHE 305 255 255 PHE PHE A . n A 1 306 TRP 306 256 256 TRP TRP A . n A 1 307 THR 307 257 257 THR THR A . n A 1 308 PRO 308 258 258 PRO PRO A . n A 1 309 TYR 309 259 259 TYR TYR A . n A 1 310 ASN 310 260 260 ASN ASN A . n A 1 311 ILE 311 261 261 ILE ILE A . n A 1 312 VAL 312 262 262 VAL VAL A . n A 1 313 ILE 313 263 263 ILE ILE A . n A 1 314 LEU 314 264 264 LEU LEU A . n A 1 315 LEU 315 265 265 LEU LEU A . n A 1 316 ASN 316 266 266 ASN ASN A . n A 1 317 THR 317 267 267 THR THR A . n A 1 318 PHE 318 268 268 PHE PHE A . n A 1 319 GLN 319 269 269 GLN GLN A . n A 1 320 GLU 320 270 270 GLU GLU A . n A 1 321 PHE 321 271 271 PHE PHE A . n A 1 322 PHE 322 272 272 PHE PHE A . n A 1 323 GLY 323 273 ? ? ? A . n A 1 324 LEU 324 274 ? ? ? A . n A 1 325 SER 325 275 ? ? ? A . n A 1 326 ASN 326 276 ? ? ? A . n A 1 327 CYS 327 277 ? ? ? A . n A 1 328 GLU 328 278 ? ? ? A . n A 1 329 SER 329 279 279 SER SER A . n A 1 330 THR 330 280 280 THR THR A . n A 1 331 SER 331 281 281 SER SER A . n A 1 332 GLN 332 282 282 GLN GLN A . n A 1 333 LEU 333 283 283 LEU LEU A . n A 1 334 ASP 334 284 284 ASP ASP A . n A 1 335 GLN 335 285 285 GLN GLN A . n A 1 336 ALA 336 286 286 ALA ALA A . n A 1 337 THR 337 287 287 THR THR A . n A 1 338 GLN 338 288 288 GLN GLN A . n A 1 339 VAL 339 289 289 VAL VAL A . n A 1 340 THR 340 290 290 THR THR A . n A 1 341 GLU 341 291 291 GLU GLU A . n A 1 342 THR 342 292 292 THR THR A . n A 1 343 LEU 343 293 293 LEU LEU A . n A 1 344 GLY 344 294 294 GLY GLY A . n A 1 345 MET 345 295 295 MET MET A . n A 1 346 THR 346 296 296 THR THR A . n A 1 347 HIS 347 297 297 HIS HIS A . n A 1 348 CYS 348 298 298 CYS CYS A . n A 1 349 CYS 349 299 299 CYS CYS A . n A 1 350 ILE 350 300 300 ILE ILE A . n A 1 351 ASN 351 301 301 ASN ASN A . n A 1 352 PRO 352 302 302 PRO PRO A . n A 1 353 ILE 353 303 303 ILE ILE A . n A 1 354 ILE 354 304 304 ILE ILE A . n A 1 355 TYR 355 305 305 TYR TYR A . n A 1 356 ALA 356 306 306 ALA ALA A . n A 1 357 PHE 357 307 307 PHE PHE A . n A 1 358 VAL 358 308 308 VAL VAL A . n A 1 359 GLY 359 309 309 GLY GLY A . n A 1 360 GLU 360 310 310 GLU GLU A . n A 1 361 GLU 361 311 311 GLU GLU A . n A 1 362 PHE 362 312 312 PHE PHE A . n A 1 363 ARG 363 313 313 ARG ARG A . n A 1 364 SER 364 314 314 SER SER A . n A 1 365 LEU 365 315 315 LEU LEU A . n A 1 366 PHE 366 316 316 PHE PHE A . n A 1 367 HIS 367 317 317 HIS HIS A . n A 1 368 ILE 368 318 318 ILE ILE A . n A 1 369 ALA 369 319 319 ALA ALA A . n A 1 370 LEU 370 320 320 LEU LEU A . n A 1 371 GLY 371 321 321 GLY GLY A . n A 1 372 CYS 372 322 ? ? ? A . n A 1 373 ARG 373 323 ? ? ? A . n A 1 374 ILE 374 324 ? ? ? A . n A 1 375 ALA 375 325 ? ? ? A . n A 1 376 PRO 376 326 ? ? ? A . n A 1 377 LEU 377 327 ? ? ? A . n A 1 378 GLN 378 328 ? ? ? A . n A 1 379 LYS 379 329 ? ? ? A . n A 1 380 PRO 380 330 ? ? ? A . n A 1 381 VAL 381 331 ? ? ? A . n A 1 382 CYS 382 332 ? ? ? A . n A 1 383 GLY 383 333 ? ? ? A . n A 1 384 GLY 384 334 ? ? ? A . n A 1 385 PRO 385 335 ? ? ? A . n A 1 386 GLY 386 336 ? ? ? A . n A 1 387 VAL 387 337 ? ? ? A . n A 1 388 ARG 388 338 ? ? ? A . n A 1 389 PRO 389 339 ? ? ? A . n A 1 390 GLY 390 340 ? ? ? A . n A 1 391 LYS 391 341 ? ? ? A . n A 1 392 ASN 392 342 ? ? ? A . n A 1 393 VAL 393 343 ? ? ? A . n A 1 394 LYS 394 344 ? ? ? A . n A 1 395 VAL 395 345 ? ? ? A . n A 1 396 THR 396 346 ? ? ? A . n A 1 397 THR 397 347 ? ? ? A . n A 1 398 GLN 398 348 ? ? ? A . n A 1 399 GLY 399 349 ? ? ? A . n A 1 400 LEU 400 350 ? ? ? A . n A 1 401 LEU 401 351 ? ? ? A . n A 1 402 ASP 402 352 ? ? ? A . n A 1 403 GLY 403 353 ? ? ? A . n A 1 404 ARG 404 354 ? ? ? A . n A 1 405 GLY 405 355 ? ? ? A . n A 1 406 LYS 406 356 ? ? ? A . n A 1 407 GLY 407 357 ? ? ? A . n A 1 408 LYS 408 358 ? ? ? A . n A 1 409 SER 409 359 ? ? ? A . n A 1 410 ILE 410 360 ? ? ? A . n A 1 411 GLY 411 361 ? ? ? A . n A 1 412 ARG 412 362 ? ? ? A . n A 1 413 ALA 413 363 ? ? ? A . n A 1 414 PRO 414 364 ? ? ? A . n A 1 415 GLU 415 365 ? ? ? A . n A 1 416 ALA 416 366 ? ? ? A . n A 1 417 SER 417 367 ? ? ? A . n A 1 418 LEU 418 368 ? ? ? A . n A 1 419 GLN 419 369 ? ? ? A . n A 1 420 ASP 420 370 ? ? ? A . n A 1 421 LYS 421 371 ? ? ? A . n A 1 422 GLU 422 372 ? ? ? A . n A 1 423 GLY 423 373 ? ? ? A . n A 1 424 ALA 424 374 ? ? ? A . n A 1 425 GLU 425 375 ? ? ? A . n A 1 426 VAL 426 376 ? ? ? A . n A 1 427 LEU 427 377 ? ? ? A . n A 1 428 PHE 428 378 ? ? ? A . n A 1 429 GLN 429 379 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 1101 1 ZN ZN A . C 3 F7N 1 1102 1 F7N LIG A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 18020 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 236 ? A CYS 1006 ? 1_555 ZN ? B ZN . ? A ZN 1101 ? 1_555 SG ? A CYS 239 ? A CYS 1009 ? 1_555 96.1 ? 2 SG ? A CYS 236 ? A CYS 1006 ? 1_555 ZN ? B ZN . ? A ZN 1101 ? 1_555 SG ? A CYS 269 ? A CYS 1039 ? 1_555 112.6 ? 3 SG ? A CYS 239 ? A CYS 1009 ? 1_555 ZN ? B ZN . ? A ZN 1101 ? 1_555 SG ? A CYS 269 ? A CYS 1039 ? 1_555 95.9 ? 4 SG ? A CYS 236 ? A CYS 1006 ? 1_555 ZN ? B ZN . ? A ZN 1101 ? 1_555 SG ? A CYS 272 ? A CYS 1042 ? 1_555 118.6 ? 5 SG ? A CYS 239 ? A CYS 1009 ? 1_555 ZN ? B ZN . ? A ZN 1101 ? 1_555 SG ? A CYS 272 ? A CYS 1042 ? 1_555 103.7 ? 6 SG ? A CYS 269 ? A CYS 1039 ? 1_555 ZN ? B ZN . ? A ZN 1101 ? 1_555 SG ? A CYS 272 ? A CYS 1042 ? 1_555 122.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-01-02 2 'Structure model' 1 1 2019-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' database_PDB_rev 3 2 'Structure model' database_PDB_rev_record 4 2 'Structure model' pdbx_database_proc # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.year' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 11.0290 _pdbx_refine_tls.origin_y -6.9402 _pdbx_refine_tls.origin_z -32.6241 _pdbx_refine_tls.T[1][1] -0.0155 _pdbx_refine_tls.T[2][2] 0.0599 _pdbx_refine_tls.T[3][3] -0.1055 _pdbx_refine_tls.T[1][2] -0.0086 _pdbx_refine_tls.T[1][3] -0.0828 _pdbx_refine_tls.T[2][3] -0.0517 _pdbx_refine_tls.L[1][1] 1.1124 _pdbx_refine_tls.L[2][2] 0.0000 _pdbx_refine_tls.L[3][3] 0.5932 _pdbx_refine_tls.L[1][2] -0.2819 _pdbx_refine_tls.L[1][3] 0.3518 _pdbx_refine_tls.L[2][3] -0.7546 _pdbx_refine_tls.S[1][1] 0.0108 _pdbx_refine_tls.S[1][2] -0.0257 _pdbx_refine_tls.S[1][3] -0.0057 _pdbx_refine_tls.S[2][1] -0.0182 _pdbx_refine_tls.S[2][2] -0.0316 _pdbx_refine_tls.S[2][3] -0.0184 _pdbx_refine_tls.S[3][1] 0.0245 _pdbx_refine_tls.S[3][2] -0.0244 _pdbx_refine_tls.S[3][3] 0.0207 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|* }' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.7 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? AutoPROC ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 211 ? ? -136.73 -43.33 2 1 LEU A 320 ? ? -108.64 -66.98 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 2 ? A LEU 1 2 1 Y 1 A SER 3 ? A SER 2 3 1 Y 1 A THR 4 ? A THR 3 4 1 Y 1 A SER 5 ? A SER 4 5 1 Y 1 A ARG 6 ? A ARG 5 6 1 Y 1 A SER 7 ? A SER 6 7 1 Y 1 A ARG 8 ? A ARG 7 8 1 Y 1 A PHE 9 ? A PHE 8 9 1 Y 1 A ILE 10 ? A ILE 9 10 1 Y 1 A ARG 11 ? A ARG 10 11 1 Y 1 A ASN 12 ? A ASN 11 12 1 Y 1 A THR 13 ? A THR 12 13 1 Y 1 A GLN 14 ? A GLN 13 14 1 Y 1 A GLU 15 ? A GLU 14 15 1 Y 1 A SER 16 ? A SER 15 16 1 Y 1 A GLY 17 ? A GLY 16 17 1 Y 1 A GLU 18 ? A GLU 17 18 1 Y 1 A GLU 19 ? A GLU 18 19 1 Y 1 A VAL 20 ? A VAL 19 20 1 Y 1 A THR 21 ? A THR 20 21 1 Y 1 A THR 22 ? A THR 21 22 1 Y 1 A PHE 23 ? A PHE 22 23 1 Y 1 A PHE 24 ? A PHE 23 24 1 Y 1 A ASP 25 ? A ASP 24 25 1 Y 1 A TYR 26 ? A TYR 25 26 1 Y 1 A ASP 27 ? A ASP 26 27 1 Y 1 A TYR 28 ? A TYR 27 28 1 Y 1 A GLY 29 ? A GLY 28 29 1 Y 1 A ALA 30 ? A ALA 29 30 1 Y 1 A PRO 31 ? A PRO 30 31 1 Y 1 A CYS 32 ? A CYS 31 32 1 Y 1 A HIS 33 ? A HIS 32 33 1 Y 1 A LYS 34 ? A LYS 33 34 1 Y 1 A PHE 35 ? A PHE 34 35 1 Y 1 A ASP 36 ? A ASP 35 36 1 Y 1 A GLY 273 ? A GLY 323 37 1 Y 1 A LEU 274 ? A LEU 324 38 1 Y 1 A SER 275 ? A SER 325 39 1 Y 1 A ASN 276 ? A ASN 326 40 1 Y 1 A CYS 277 ? A CYS 327 41 1 Y 1 A GLU 278 ? A GLU 328 42 1 Y 1 A CYS 322 ? A CYS 372 43 1 Y 1 A ARG 323 ? A ARG 373 44 1 Y 1 A ILE 324 ? A ILE 374 45 1 Y 1 A ALA 325 ? A ALA 375 46 1 Y 1 A PRO 326 ? A PRO 376 47 1 Y 1 A LEU 327 ? A LEU 377 48 1 Y 1 A GLN 328 ? A GLN 378 49 1 Y 1 A LYS 329 ? A LYS 379 50 1 Y 1 A PRO 330 ? A PRO 380 51 1 Y 1 A VAL 331 ? A VAL 381 52 1 Y 1 A CYS 332 ? A CYS 382 53 1 Y 1 A GLY 333 ? A GLY 383 54 1 Y 1 A GLY 334 ? A GLY 384 55 1 Y 1 A PRO 335 ? A PRO 385 56 1 Y 1 A GLY 336 ? A GLY 386 57 1 Y 1 A VAL 337 ? A VAL 387 58 1 Y 1 A ARG 338 ? A ARG 388 59 1 Y 1 A PRO 339 ? A PRO 389 60 1 Y 1 A GLY 340 ? A GLY 390 61 1 Y 1 A LYS 341 ? A LYS 391 62 1 Y 1 A ASN 342 ? A ASN 392 63 1 Y 1 A VAL 343 ? A VAL 393 64 1 Y 1 A LYS 344 ? A LYS 394 65 1 Y 1 A VAL 345 ? A VAL 395 66 1 Y 1 A THR 346 ? A THR 396 67 1 Y 1 A THR 347 ? A THR 397 68 1 Y 1 A GLN 348 ? A GLN 398 69 1 Y 1 A GLY 349 ? A GLY 399 70 1 Y 1 A LEU 350 ? A LEU 400 71 1 Y 1 A LEU 351 ? A LEU 401 72 1 Y 1 A ASP 352 ? A ASP 402 73 1 Y 1 A GLY 353 ? A GLY 403 74 1 Y 1 A ARG 354 ? A ARG 404 75 1 Y 1 A GLY 355 ? A GLY 405 76 1 Y 1 A LYS 356 ? A LYS 406 77 1 Y 1 A GLY 357 ? A GLY 407 78 1 Y 1 A LYS 358 ? A LYS 408 79 1 Y 1 A SER 359 ? A SER 409 80 1 Y 1 A ILE 360 ? A ILE 410 81 1 Y 1 A GLY 361 ? A GLY 411 82 1 Y 1 A ARG 362 ? A ARG 412 83 1 Y 1 A ALA 363 ? A ALA 413 84 1 Y 1 A PRO 364 ? A PRO 414 85 1 Y 1 A GLU 365 ? A GLU 415 86 1 Y 1 A ALA 366 ? A ALA 416 87 1 Y 1 A SER 367 ? A SER 417 88 1 Y 1 A LEU 368 ? A LEU 418 89 1 Y 1 A GLN 369 ? A GLN 419 90 1 Y 1 A ASP 370 ? A ASP 420 91 1 Y 1 A LYS 371 ? A LYS 421 92 1 Y 1 A GLU 372 ? A GLU 422 93 1 Y 1 A GLY 373 ? A GLY 423 94 1 Y 1 A ALA 374 ? A ALA 424 95 1 Y 1 A GLU 375 ? A GLU 425 96 1 Y 1 A VAL 376 ? A VAL 426 97 1 Y 1 A LEU 377 ? A LEU 427 98 1 Y 1 A PHE 378 ? A PHE 428 99 1 Y 1 A GLN 379 ? A GLN 429 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 ;[(3~{S},4~{S})-3-methoxyoxan-4-yl]-[(1~{R},3~{S})-3-propan-2-yl-3-[[3-(trifluoromethyl)-7,8-dihydro-5~{H}-1,6-naphthyridin-6-yl]carbonyl]cyclopentyl]azanium ; F7N # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #