data_6GQP # _entry.id 6GQP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.299 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6GQP WWPDB D_1200010417 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6GQP _pdbx_database_status.recvd_initial_deposition_date 2018-06-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hardy, C.J.' 1 ? 'Schimpl, M.' 2 ? 'Ogg, D.J.' 3 ? 'Overman, R.C.' 4 ? 'Packer, M.J.' 5 ? 'Kettle, J.G.' 6 ? 'Anjum, R.' 7 ? 'Barry, E.' 8 ? 'Bhavsar, D.' 9 ? 'Brown, C.' 10 ? 'Campbell, A.' 11 ? 'Goldberg, K.' 12 ? 'Grondine, M.' 13 ? 'Guichard, S.' 14 ? 'Hunt, T.' 15 ? 'Jones, O.' 16 ? 'Li, X.' 17 ? 'Moleva, O.' 18 ? 'Pearson, S.' 19 ? 'Shao, W.' 20 ? 'Smith, A.' 21 ? 'Smith, J.' 22 ? 'Stead, D.' 23 ? 'Stokes, S.' 24 ? 'Tucker, M.' 25 ? 'Ye, Y.' 26 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Med. Chem.' _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 1520-4804 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 61 _citation.language ? _citation.page_first 8797 _citation.page_last 8810 _citation.title ;Discovery of N-(4-{[5-Fluoro-7-(2-methoxyethoxy)quinazolin-4-yl]amino}phenyl)-2-[4-(propan-2-yl)-1 H-1,2,3-triazol-1-yl]acetamide (AZD3229), a Potent Pan-KIT Mutant Inhibitor for the Treatment of Gastrointestinal Stromal Tumors. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.8b00938 _citation.pdbx_database_id_PubMed 30204441 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kettle, J.G.' 1 0000-0001-7373-0758 primary 'Anjum, R.' 2 ? primary 'Barry, E.' 3 ? primary 'Bhavsar, D.' 4 ? primary 'Brown, C.' 5 ? primary 'Boyd, S.' 6 ? primary 'Campbell, A.' 7 ? primary 'Goldberg, K.' 8 ? primary 'Grondine, M.' 9 ? primary 'Guichard, S.' 10 ? primary 'Hardy, C.J.' 11 ? primary 'Hunt, T.' 12 ? primary 'Jones, R.D.O.' 13 ? primary 'Li, X.' 14 ? primary 'Moleva, O.' 15 ? primary 'Ogg, D.' 16 ? primary 'Overman, R.C.' 17 ? primary 'Packer, M.J.' 18 ? primary 'Pearson, S.' 19 ? primary 'Schimpl, M.' 20 ? primary 'Shao, W.' 21 ? primary 'Smith, A.' 22 ? primary 'Smith, J.M.' 23 ? primary 'Stead, D.' 24 ? primary 'Stokes, S.' 25 ? primary 'Tucker, M.' 26 ? primary 'Ye, Y.' 27 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 109.80 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6GQP _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.160 _cell.length_a_esd ? _cell.length_b 57.200 _cell.length_b_esd ? _cell.length_c 60.790 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6GQP _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Vascular endothelial growth factor receptor 2' 36989.609 1 2.7.10.1 ? ? 'Human KDR kinase domain D807-D1171 with an internal deletion of T940-E990, replaced by a single valine' 2 non-polymer syn '~{N}-[4-(6,7-dimethoxyquinazolin-4-yl)oxyphenyl]-2-(1-ethylpyrazol-4-yl)ethanamide' 433.460 1 ? ? ? ? 3 water nat water 18.015 72 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'VEGFR-2,Fetal liver kinase 1,FLK-1,Kinase insert domain receptor,KDR,Protein-tyrosine kinase receptor flk-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSE LKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSFQVAKG MEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLL WEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDENLY FQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSE LKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSFQVAKG MEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLL WEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDENLY FQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 PRO n 1 4 ASP n 1 5 GLU n 1 6 LEU n 1 7 PRO n 1 8 LEU n 1 9 ASP n 1 10 GLU n 1 11 HIS n 1 12 CYS n 1 13 GLU n 1 14 ARG n 1 15 LEU n 1 16 PRO n 1 17 TYR n 1 18 ASP n 1 19 ALA n 1 20 SER n 1 21 LYS n 1 22 TRP n 1 23 GLU n 1 24 PHE n 1 25 PRO n 1 26 ARG n 1 27 ASP n 1 28 ARG n 1 29 LEU n 1 30 LYS n 1 31 LEU n 1 32 GLY n 1 33 LYS n 1 34 PRO n 1 35 LEU n 1 36 GLY n 1 37 ARG n 1 38 GLY n 1 39 ALA n 1 40 PHE n 1 41 GLY n 1 42 GLN n 1 43 VAL n 1 44 ILE n 1 45 GLU n 1 46 ALA n 1 47 ASP n 1 48 ALA n 1 49 PHE n 1 50 GLY n 1 51 ILE n 1 52 ASP n 1 53 LYS n 1 54 THR n 1 55 ALA n 1 56 THR n 1 57 CYS n 1 58 ARG n 1 59 THR n 1 60 VAL n 1 61 ALA n 1 62 VAL n 1 63 LYS n 1 64 MET n 1 65 LEU n 1 66 LYS n 1 67 GLU n 1 68 GLY n 1 69 ALA n 1 70 THR n 1 71 HIS n 1 72 SER n 1 73 GLU n 1 74 HIS n 1 75 ARG n 1 76 ALA n 1 77 LEU n 1 78 MET n 1 79 SER n 1 80 GLU n 1 81 LEU n 1 82 LYS n 1 83 ILE n 1 84 LEU n 1 85 ILE n 1 86 HIS n 1 87 ILE n 1 88 GLY n 1 89 HIS n 1 90 HIS n 1 91 LEU n 1 92 ASN n 1 93 VAL n 1 94 VAL n 1 95 ASN n 1 96 LEU n 1 97 LEU n 1 98 GLY n 1 99 ALA n 1 100 CYS n 1 101 THR n 1 102 LYS n 1 103 PRO n 1 104 GLY n 1 105 GLY n 1 106 PRO n 1 107 LEU n 1 108 MET n 1 109 VAL n 1 110 ILE n 1 111 VAL n 1 112 GLU n 1 113 PHE n 1 114 CYS n 1 115 LYS n 1 116 PHE n 1 117 GLY n 1 118 ASN n 1 119 LEU n 1 120 SER n 1 121 THR n 1 122 TYR n 1 123 LEU n 1 124 ARG n 1 125 SER n 1 126 LYS n 1 127 ARG n 1 128 ASN n 1 129 GLU n 1 130 PHE n 1 131 VAL n 1 132 PRO n 1 133 TYR n 1 134 LYS n 1 135 VAL n 1 136 ALA n 1 137 PRO n 1 138 GLU n 1 139 ASP n 1 140 LEU n 1 141 TYR n 1 142 LYS n 1 143 ASP n 1 144 PHE n 1 145 LEU n 1 146 THR n 1 147 LEU n 1 148 GLU n 1 149 HIS n 1 150 LEU n 1 151 ILE n 1 152 CYS n 1 153 TYR n 1 154 SER n 1 155 PHE n 1 156 GLN n 1 157 VAL n 1 158 ALA n 1 159 LYS n 1 160 GLY n 1 161 MET n 1 162 GLU n 1 163 PHE n 1 164 LEU n 1 165 ALA n 1 166 SER n 1 167 ARG n 1 168 LYS n 1 169 CYS n 1 170 ILE n 1 171 HIS n 1 172 ARG n 1 173 ASP n 1 174 LEU n 1 175 ALA n 1 176 ALA n 1 177 ARG n 1 178 ASN n 1 179 ILE n 1 180 LEU n 1 181 LEU n 1 182 SER n 1 183 GLU n 1 184 LYS n 1 185 ASN n 1 186 VAL n 1 187 VAL n 1 188 LYS n 1 189 ILE n 1 190 CYS n 1 191 ASP n 1 192 PHE n 1 193 GLY n 1 194 LEU n 1 195 ALA n 1 196 ARG n 1 197 ASP n 1 198 ILE n 1 199 TYR n 1 200 LYS n 1 201 ASP n 1 202 PRO n 1 203 ASP n 1 204 TYR n 1 205 VAL n 1 206 ARG n 1 207 LYS n 1 208 GLY n 1 209 ASP n 1 210 ALA n 1 211 ARG n 1 212 LEU n 1 213 PRO n 1 214 LEU n 1 215 LYS n 1 216 TRP n 1 217 MET n 1 218 ALA n 1 219 PRO n 1 220 GLU n 1 221 THR n 1 222 ILE n 1 223 PHE n 1 224 ASP n 1 225 ARG n 1 226 VAL n 1 227 TYR n 1 228 THR n 1 229 ILE n 1 230 GLN n 1 231 SER n 1 232 ASP n 1 233 VAL n 1 234 TRP n 1 235 SER n 1 236 PHE n 1 237 GLY n 1 238 VAL n 1 239 LEU n 1 240 LEU n 1 241 TRP n 1 242 GLU n 1 243 ILE n 1 244 PHE n 1 245 SER n 1 246 LEU n 1 247 GLY n 1 248 ALA n 1 249 SER n 1 250 PRO n 1 251 TYR n 1 252 PRO n 1 253 GLY n 1 254 VAL n 1 255 LYS n 1 256 ILE n 1 257 ASP n 1 258 GLU n 1 259 GLU n 1 260 PHE n 1 261 CYS n 1 262 ARG n 1 263 ARG n 1 264 LEU n 1 265 LYS n 1 266 GLU n 1 267 GLY n 1 268 THR n 1 269 ARG n 1 270 MET n 1 271 ARG n 1 272 ALA n 1 273 PRO n 1 274 ASP n 1 275 TYR n 1 276 THR n 1 277 THR n 1 278 PRO n 1 279 GLU n 1 280 MET n 1 281 TYR n 1 282 GLN n 1 283 THR n 1 284 MET n 1 285 LEU n 1 286 ASP n 1 287 CYS n 1 288 TRP n 1 289 HIS n 1 290 GLY n 1 291 GLU n 1 292 PRO n 1 293 SER n 1 294 GLN n 1 295 ARG n 1 296 PRO n 1 297 THR n 1 298 PHE n 1 299 SER n 1 300 GLU n 1 301 LEU n 1 302 VAL n 1 303 GLU n 1 304 HIS n 1 305 LEU n 1 306 GLY n 1 307 ASN n 1 308 LEU n 1 309 LEU n 1 310 GLN n 1 311 ALA n 1 312 ASN n 1 313 ALA n 1 314 GLN n 1 315 GLN n 1 316 ASP n 1 317 GLU n 1 318 ASN n 1 319 LEU n 1 320 TYR n 1 321 PHE n 1 322 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 322 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KDR, FLK1, VEGFR2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line Sf21 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VGFR2_HUMAN _struct_ref.pdbx_db_accession P35968 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSE LKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDS ITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKIC DFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRM RAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQD ; _struct_ref.pdbx_align_begin 806 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6GQP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 316 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P35968 _struct_ref_seq.db_align_beg 806 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1171 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 806 _struct_ref_seq.pdbx_auth_seq_align_end 1171 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6GQP ? A ? ? UNP P35968 THR 940 deletion ? 1 1 6GQP ? A ? ? UNP P35968 LYS 941 deletion ? 2 1 6GQP ? A ? ? UNP P35968 GLY 942 deletion ? 3 1 6GQP ? A ? ? UNP P35968 ALA 943 deletion ? 4 1 6GQP ? A ? ? UNP P35968 ARG 944 deletion ? 5 1 6GQP ? A ? ? UNP P35968 PHE 945 deletion ? 6 1 6GQP ? A ? ? UNP P35968 ARG 946 deletion ? 7 1 6GQP ? A ? ? UNP P35968 GLN 947 deletion ? 8 1 6GQP ? A ? ? UNP P35968 GLY 948 deletion ? 9 1 6GQP ? A ? ? UNP P35968 LYS 949 deletion ? 10 1 6GQP ? A ? ? UNP P35968 ASP 950 deletion ? 11 1 6GQP ? A ? ? UNP P35968 TYR 951 deletion ? 12 1 6GQP ? A ? ? UNP P35968 VAL 952 deletion ? 13 1 6GQP ? A ? ? UNP P35968 GLY 953 deletion ? 14 1 6GQP ? A ? ? UNP P35968 ALA 954 deletion ? 15 1 6GQP ? A ? ? UNP P35968 ILE 955 deletion ? 16 1 6GQP ? A ? ? UNP P35968 PRO 956 deletion ? 17 1 6GQP ? A ? ? UNP P35968 VAL 957 deletion ? 18 1 6GQP ? A ? ? UNP P35968 ASP 958 deletion ? 19 1 6GQP ? A ? ? UNP P35968 LEU 959 deletion ? 20 1 6GQP ? A ? ? UNP P35968 LYS 960 deletion ? 21 1 6GQP ? A ? ? UNP P35968 ARG 961 deletion ? 22 1 6GQP ? A ? ? UNP P35968 ARG 962 deletion ? 23 1 6GQP ? A ? ? UNP P35968 LEU 963 deletion ? 24 1 6GQP ? A ? ? UNP P35968 ASP 964 deletion ? 25 1 6GQP ? A ? ? UNP P35968 SER 965 deletion ? 26 1 6GQP ? A ? ? UNP P35968 ILE 966 deletion ? 27 1 6GQP ? A ? ? UNP P35968 THR 967 deletion ? 28 1 6GQP ? A ? ? UNP P35968 SER 968 deletion ? 29 1 6GQP ? A ? ? UNP P35968 SER 969 deletion ? 30 1 6GQP ? A ? ? UNP P35968 GLN 970 deletion ? 31 1 6GQP ? A ? ? UNP P35968 SER 971 deletion ? 32 1 6GQP ? A ? ? UNP P35968 SER 972 deletion ? 33 1 6GQP ? A ? ? UNP P35968 ALA 973 deletion ? 34 1 6GQP ? A ? ? UNP P35968 SER 974 deletion ? 35 1 6GQP ? A ? ? UNP P35968 SER 975 deletion ? 36 1 6GQP ? A ? ? UNP P35968 GLY 976 deletion ? 37 1 6GQP ? A ? ? UNP P35968 PHE 977 deletion ? 38 1 6GQP ? A ? ? UNP P35968 VAL 978 deletion ? 39 1 6GQP ? A ? ? UNP P35968 GLU 979 deletion ? 40 1 6GQP ? A ? ? UNP P35968 GLU 980 deletion ? 41 1 6GQP ? A ? ? UNP P35968 LYS 981 deletion ? 42 1 6GQP ? A ? ? UNP P35968 SER 982 deletion ? 43 1 6GQP ? A ? ? UNP P35968 LEU 983 deletion ? 44 1 6GQP ? A ? ? UNP P35968 SER 984 deletion ? 45 1 6GQP ? A ? ? UNP P35968 ASP 985 deletion ? 46 1 6GQP ? A ? ? UNP P35968 VAL 986 deletion ? 47 1 6GQP ? A ? ? UNP P35968 GLU 987 deletion ? 48 1 6GQP ? A ? ? UNP P35968 GLU 988 deletion ? 49 1 6GQP ? A ? ? UNP P35968 GLU 989 deletion ? 50 1 6GQP VAL A 135 ? UNP P35968 GLU 990 conflict 940 51 1 6GQP GLU A 317 ? UNP P35968 ? ? 'expression tag' 1172 52 1 6GQP ASN A 318 ? UNP P35968 ? ? 'expression tag' 1173 53 1 6GQP LEU A 319 ? UNP P35968 ? ? 'expression tag' 1174 54 1 6GQP TYR A 320 ? UNP P35968 ? ? 'expression tag' 1175 55 1 6GQP PHE A 321 ? UNP P35968 ? ? 'expression tag' 1176 56 1 6GQP GLN A 322 ? UNP P35968 ? ? 'expression tag' 1177 57 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 F88 non-polymer . '~{N}-[4-(6,7-dimethoxyquinazolin-4-yl)oxyphenyl]-2-(1-ethylpyrazol-4-yl)ethanamide' ? 'C23 H23 N5 O4' 433.460 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6GQP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.35 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.68 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '7 % PEG 8000, 0.1 M PCTP (sodium propionate, sodium cacodylate trihydrate, bis-tris propane) pH 7.8' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-11-28 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92819 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.92819 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 37.27 _reflns.entry_id 6GQP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.87 _reflns.d_resolution_low 57.19 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 27358 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.87 _reflns_shell.d_res_low 1.97 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 96.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 1.04970 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.01200 _refine.aniso_B[2][2] 4.18510 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] -5.23470 _refine.B_iso_max ? _refine.B_iso_mean 47.99 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.946 _refine.correlation_coeff_Fo_to_Fc_free 0.930 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6GQP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.09 _refine.ls_d_res_low 57.19 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19924 _refine.ls_number_reflns_R_free 961 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.2 _refine.ls_percent_reflns_R_free 4.820 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.201 _refine.ls_R_factor_R_free 0.234 _refine.ls_R_factor_R_free_error 0.000 _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.199 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3WZD _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.175 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.171 _refine.pdbx_overall_SU_R_Blow_DPI 0.205 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.211 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 6GQP _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.28 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2386 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.number_atoms_solvent 72 _refine_hist.number_atoms_total 2490 _refine_hist.d_res_high 2.09 _refine_hist.d_res_low 57.19 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 2499 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 0.96 ? 3382 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 875 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 50 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 364 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2499 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 3.08 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 16.67 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 309 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 2581 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.09 _refine_ls_shell.d_res_low 2.20 _refine_ls_shell.number_reflns_all 2887 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 156 _refine_ls_shell.number_reflns_R_work 2731 _refine_ls_shell.percent_reflns_obs 96.72 _refine_ls_shell.percent_reflns_R_free 5.40 _refine_ls_shell.R_factor_all 0.253 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.290 _refine_ls_shell.R_factor_R_free_error 0.000 _refine_ls_shell.R_factor_R_work 0.251 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6GQP _struct.title 'Crystal structure of human KDR (VEGFR2) kinase domain in complex with AZD3229-analogue (compound 23)' _struct.pdbx_descriptor 'Vascular endothelial growth factor receptor 2 (E.C.2.7.10.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6GQP _struct_keywords.text 'receptor tyrosine kinase, inhibitor, oncology, gastrointestinal stromal tumour, structure-based drug design, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 18 ? GLU A 23 ? ASP A 823 GLU A 828 1 ? 6 HELX_P HELX_P2 AA2 PRO A 25 ? ASP A 27 ? PRO A 830 ASP A 832 5 ? 3 HELX_P HELX_P3 AA3 THR A 70 ? GLY A 88 ? THR A 875 GLY A 893 1 ? 19 HELX_P HELX_P4 AA4 ASN A 118 ? LYS A 126 ? ASN A 923 LYS A 931 1 ? 9 HELX_P HELX_P5 AA5 PRO A 137 ? TYR A 141 ? PRO A 942 TYR A 946 5 ? 5 HELX_P HELX_P6 AA6 THR A 146 ? ARG A 167 ? THR A 1001 ARG A 1022 1 ? 22 HELX_P HELX_P7 AA7 ALA A 175 ? ARG A 177 ? ALA A 1030 ARG A 1032 5 ? 3 HELX_P HELX_P8 AA8 GLU A 183 ? ASN A 185 ? GLU A 1038 ASN A 1040 5 ? 3 HELX_P HELX_P9 AA9 PHE A 192 ? ARG A 196 ? PHE A 1047 ARG A 1051 5 ? 5 HELX_P HELX_P10 AB1 PRO A 213 ? MET A 217 ? PRO A 1068 MET A 1072 5 ? 5 HELX_P HELX_P11 AB2 ALA A 218 ? ARG A 225 ? ALA A 1073 ARG A 1080 1 ? 8 HELX_P HELX_P12 AB3 THR A 228 ? PHE A 244 ? THR A 1083 PHE A 1099 1 ? 17 HELX_P HELX_P13 AB4 ASP A 257 ? GLY A 267 ? ASP A 1112 GLY A 1122 1 ? 11 HELX_P HELX_P14 AB5 THR A 277 ? TRP A 288 ? THR A 1132 TRP A 1143 1 ? 12 HELX_P HELX_P15 AB6 GLU A 291 ? ARG A 295 ? GLU A 1146 ARG A 1150 5 ? 5 HELX_P HELX_P16 AB7 THR A 297 ? ALA A 313 ? THR A 1152 ALA A 1168 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 136 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 941 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 137 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 942 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.10 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 29 ? LEU A 35 ? LEU A 834 LEU A 840 AA1 2 GLY A 41 ? PHE A 49 ? GLY A 846 PHE A 854 AA1 3 CYS A 57 ? LEU A 65 ? CYS A 862 LEU A 870 AA1 4 MET A 108 ? GLU A 112 ? MET A 913 GLU A 917 AA1 5 LEU A 96 ? CYS A 100 ? LEU A 901 CYS A 905 AA2 1 ILE A 179 ? LEU A 181 ? ILE A 1034 LEU A 1036 AA2 2 VAL A 187 ? ILE A 189 ? VAL A 1042 ILE A 1044 AA3 1 VAL A 205 ? LYS A 207 ? VAL A 1060 LYS A 1062 AA3 2 ALA A 210 ? LEU A 212 ? ALA A 1065 LEU A 1067 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 35 ? N LEU A 840 O VAL A 43 ? O VAL A 848 AA1 2 3 N ALA A 46 ? N ALA A 851 O VAL A 60 ? O VAL A 865 AA1 3 4 N LYS A 63 ? N LYS A 868 O VAL A 109 ? O VAL A 914 AA1 4 5 O ILE A 110 ? O ILE A 915 N LEU A 97 ? N LEU A 902 AA2 1 2 N LEU A 180 ? N LEU A 1035 O LYS A 188 ? O LYS A 1043 AA3 1 2 N LYS A 207 ? N LYS A 1062 O ALA A 210 ? O ALA A 1065 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id F88 _struct_site.pdbx_auth_seq_id 1201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 15 _struct_site.details 'binding site for residue F88 A 1201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 LEU A 35 ? LEU A 840 . ? 1_555 ? 2 AC1 15 VAL A 43 ? VAL A 848 . ? 1_555 ? 3 AC1 15 ALA A 61 ? ALA A 866 . ? 1_555 ? 4 AC1 15 LYS A 63 ? LYS A 868 . ? 1_555 ? 5 AC1 15 GLU A 80 ? GLU A 885 . ? 1_555 ? 6 AC1 15 VAL A 94 ? VAL A 899 . ? 1_555 ? 7 AC1 15 VAL A 111 ? VAL A 916 . ? 1_555 ? 8 AC1 15 GLU A 112 ? GLU A 917 . ? 1_555 ? 9 AC1 15 CYS A 114 ? CYS A 919 . ? 1_555 ? 10 AC1 15 LEU A 180 ? LEU A 1035 . ? 1_555 ? 11 AC1 15 CYS A 190 ? CYS A 1045 . ? 1_555 ? 12 AC1 15 ASP A 191 ? ASP A 1046 . ? 1_555 ? 13 AC1 15 HOH C . ? HOH A 1301 . ? 1_555 ? 14 AC1 15 HOH C . ? HOH A 1329 . ? 1_555 ? 15 AC1 15 HOH C . ? HOH A 1352 . ? 1_555 ? # _atom_sites.entry_id 6GQP _atom_sites.fract_transf_matrix[1][1] 0.018811 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.006772 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017483 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017484 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 806 ? ? ? A . n A 1 2 ASP 2 807 ? ? ? A . n A 1 3 PRO 3 808 ? ? ? A . n A 1 4 ASP 4 809 ? ? ? A . n A 1 5 GLU 5 810 ? ? ? A . n A 1 6 LEU 6 811 ? ? ? A . n A 1 7 PRO 7 812 ? ? ? A . n A 1 8 LEU 8 813 ? ? ? A . n A 1 9 ASP 9 814 ? ? ? A . n A 1 10 GLU 10 815 ? ? ? A . n A 1 11 HIS 11 816 ? ? ? A . n A 1 12 CYS 12 817 ? ? ? A . n A 1 13 GLU 13 818 ? ? ? A . n A 1 14 ARG 14 819 ? ? ? A . n A 1 15 LEU 15 820 ? ? ? A . n A 1 16 PRO 16 821 821 PRO PRO A . n A 1 17 TYR 17 822 822 TYR TYR A . n A 1 18 ASP 18 823 823 ASP ASP A . n A 1 19 ALA 19 824 824 ALA ALA A . n A 1 20 SER 20 825 825 SER SER A . n A 1 21 LYS 21 826 826 LYS LYS A . n A 1 22 TRP 22 827 827 TRP TRP A . n A 1 23 GLU 23 828 828 GLU GLU A . n A 1 24 PHE 24 829 829 PHE PHE A . n A 1 25 PRO 25 830 830 PRO PRO A . n A 1 26 ARG 26 831 831 ARG ARG A . n A 1 27 ASP 27 832 832 ASP ASP A . n A 1 28 ARG 28 833 833 ARG ARG A . n A 1 29 LEU 29 834 834 LEU LEU A . n A 1 30 LYS 30 835 835 LYS LYS A . n A 1 31 LEU 31 836 836 LEU LEU A . n A 1 32 GLY 32 837 837 GLY GLY A . n A 1 33 LYS 33 838 838 LYS LYS A . n A 1 34 PRO 34 839 839 PRO PRO A . n A 1 35 LEU 35 840 840 LEU LEU A . n A 1 36 GLY 36 841 841 GLY GLY A . n A 1 37 ARG 37 842 842 ARG ARG A . n A 1 38 GLY 38 843 843 GLY GLY A . n A 1 39 ALA 39 844 844 ALA ALA A . n A 1 40 PHE 40 845 845 PHE PHE A . n A 1 41 GLY 41 846 846 GLY GLY A . n A 1 42 GLN 42 847 847 GLN GLN A . n A 1 43 VAL 43 848 848 VAL VAL A . n A 1 44 ILE 44 849 849 ILE ILE A . n A 1 45 GLU 45 850 850 GLU GLU A . n A 1 46 ALA 46 851 851 ALA ALA A . n A 1 47 ASP 47 852 852 ASP ASP A . n A 1 48 ALA 48 853 853 ALA ALA A . n A 1 49 PHE 49 854 854 PHE PHE A . n A 1 50 GLY 50 855 855 GLY GLY A . n A 1 51 ILE 51 856 856 ILE ILE A . n A 1 52 ASP 52 857 857 ASP ASP A . n A 1 53 LYS 53 858 858 LYS LYS A . n A 1 54 THR 54 859 859 THR THR A . n A 1 55 ALA 55 860 860 ALA ALA A . n A 1 56 THR 56 861 861 THR THR A . n A 1 57 CYS 57 862 862 CYS CYS A . n A 1 58 ARG 58 863 863 ARG ARG A . n A 1 59 THR 59 864 864 THR THR A . n A 1 60 VAL 60 865 865 VAL VAL A . n A 1 61 ALA 61 866 866 ALA ALA A . n A 1 62 VAL 62 867 867 VAL VAL A . n A 1 63 LYS 63 868 868 LYS LYS A . n A 1 64 MET 64 869 869 MET MET A . n A 1 65 LEU 65 870 870 LEU LEU A . n A 1 66 LYS 66 871 871 LYS LYS A . n A 1 67 GLU 67 872 872 GLU GLU A . n A 1 68 GLY 68 873 873 GLY GLY A . n A 1 69 ALA 69 874 874 ALA ALA A . n A 1 70 THR 70 875 875 THR THR A . n A 1 71 HIS 71 876 876 HIS HIS A . n A 1 72 SER 72 877 877 SER SER A . n A 1 73 GLU 73 878 878 GLU GLU A . n A 1 74 HIS 74 879 879 HIS HIS A . n A 1 75 ARG 75 880 880 ARG ARG A . n A 1 76 ALA 76 881 881 ALA ALA A . n A 1 77 LEU 77 882 882 LEU LEU A . n A 1 78 MET 78 883 883 MET MET A . n A 1 79 SER 79 884 884 SER SER A . n A 1 80 GLU 80 885 885 GLU GLU A . n A 1 81 LEU 81 886 886 LEU LEU A . n A 1 82 LYS 82 887 887 LYS LYS A . n A 1 83 ILE 83 888 888 ILE ILE A . n A 1 84 LEU 84 889 889 LEU LEU A . n A 1 85 ILE 85 890 890 ILE ILE A . n A 1 86 HIS 86 891 891 HIS HIS A . n A 1 87 ILE 87 892 892 ILE ILE A . n A 1 88 GLY 88 893 893 GLY GLY A . n A 1 89 HIS 89 894 894 HIS HIS A . n A 1 90 HIS 90 895 895 HIS HIS A . n A 1 91 LEU 91 896 896 LEU LEU A . n A 1 92 ASN 92 897 897 ASN ASN A . n A 1 93 VAL 93 898 898 VAL VAL A . n A 1 94 VAL 94 899 899 VAL VAL A . n A 1 95 ASN 95 900 900 ASN ASN A . n A 1 96 LEU 96 901 901 LEU LEU A . n A 1 97 LEU 97 902 902 LEU LEU A . n A 1 98 GLY 98 903 903 GLY GLY A . n A 1 99 ALA 99 904 904 ALA ALA A . n A 1 100 CYS 100 905 905 CYS CYS A . n A 1 101 THR 101 906 906 THR THR A . n A 1 102 LYS 102 907 907 LYS LYS A . n A 1 103 PRO 103 908 908 PRO PRO A . n A 1 104 GLY 104 909 909 GLY GLY A . n A 1 105 GLY 105 910 910 GLY GLY A . n A 1 106 PRO 106 911 911 PRO PRO A . n A 1 107 LEU 107 912 912 LEU LEU A . n A 1 108 MET 108 913 913 MET MET A . n A 1 109 VAL 109 914 914 VAL VAL A . n A 1 110 ILE 110 915 915 ILE ILE A . n A 1 111 VAL 111 916 916 VAL VAL A . n A 1 112 GLU 112 917 917 GLU GLU A . n A 1 113 PHE 113 918 918 PHE PHE A . n A 1 114 CYS 114 919 919 CYS CYS A . n A 1 115 LYS 115 920 920 LYS LYS A . n A 1 116 PHE 116 921 921 PHE PHE A . n A 1 117 GLY 117 922 922 GLY GLY A . n A 1 118 ASN 118 923 923 ASN ASN A . n A 1 119 LEU 119 924 924 LEU LEU A . n A 1 120 SER 120 925 925 SER SER A . n A 1 121 THR 121 926 926 THR THR A . n A 1 122 TYR 122 927 927 TYR TYR A . n A 1 123 LEU 123 928 928 LEU LEU A . n A 1 124 ARG 124 929 929 ARG ARG A . n A 1 125 SER 125 930 930 SER SER A . n A 1 126 LYS 126 931 931 LYS LYS A . n A 1 127 ARG 127 932 932 ARG ARG A . n A 1 128 ASN 128 933 933 ASN ASN A . n A 1 129 GLU 129 934 934 GLU GLU A . n A 1 130 PHE 130 935 935 PHE PHE A . n A 1 131 VAL 131 936 936 VAL VAL A . n A 1 132 PRO 132 937 937 PRO PRO A . n A 1 133 TYR 133 938 938 TYR TYR A . n A 1 134 LYS 134 939 939 LYS LYS A . n A 1 135 VAL 135 940 940 VAL VAL A . n A 1 136 ALA 136 941 941 ALA ALA A . n A 1 137 PRO 137 942 942 PRO PRO A . n A 1 138 GLU 138 943 943 GLU GLU A . n A 1 139 ASP 139 944 944 ASP ASP A . n A 1 140 LEU 140 945 945 LEU LEU A . n A 1 141 TYR 141 946 946 TYR TYR A . n A 1 142 LYS 142 997 997 LYS LYS A . n A 1 143 ASP 143 998 998 ASP ASP A . n A 1 144 PHE 144 999 999 PHE PHE A . n A 1 145 LEU 145 1000 1000 LEU LEU A . n A 1 146 THR 146 1001 1001 THR THR A . n A 1 147 LEU 147 1002 1002 LEU LEU A . n A 1 148 GLU 148 1003 1003 GLU GLU A . n A 1 149 HIS 149 1004 1004 HIS HIS A . n A 1 150 LEU 150 1005 1005 LEU LEU A . n A 1 151 ILE 151 1006 1006 ILE ILE A . n A 1 152 CYS 152 1007 1007 CYS CYS A . n A 1 153 TYR 153 1008 1008 TYR TYR A . n A 1 154 SER 154 1009 1009 SER SER A . n A 1 155 PHE 155 1010 1010 PHE PHE A . n A 1 156 GLN 156 1011 1011 GLN GLN A . n A 1 157 VAL 157 1012 1012 VAL VAL A . n A 1 158 ALA 158 1013 1013 ALA ALA A . n A 1 159 LYS 159 1014 1014 LYS LYS A . n A 1 160 GLY 160 1015 1015 GLY GLY A . n A 1 161 MET 161 1016 1016 MET MET A . n A 1 162 GLU 162 1017 1017 GLU GLU A . n A 1 163 PHE 163 1018 1018 PHE PHE A . n A 1 164 LEU 164 1019 1019 LEU LEU A . n A 1 165 ALA 165 1020 1020 ALA ALA A . n A 1 166 SER 166 1021 1021 SER SER A . n A 1 167 ARG 167 1022 1022 ARG ARG A . n A 1 168 LYS 168 1023 1023 LYS LYS A . n A 1 169 CYS 169 1024 1024 CYS CYS A . n A 1 170 ILE 170 1025 1025 ILE ILE A . n A 1 171 HIS 171 1026 1026 HIS HIS A . n A 1 172 ARG 172 1027 1027 ARG ARG A . n A 1 173 ASP 173 1028 1028 ASP ASP A . n A 1 174 LEU 174 1029 1029 LEU LEU A . n A 1 175 ALA 175 1030 1030 ALA ALA A . n A 1 176 ALA 176 1031 1031 ALA ALA A . n A 1 177 ARG 177 1032 1032 ARG ARG A . n A 1 178 ASN 178 1033 1033 ASN ASN A . n A 1 179 ILE 179 1034 1034 ILE ILE A . n A 1 180 LEU 180 1035 1035 LEU LEU A . n A 1 181 LEU 181 1036 1036 LEU LEU A . n A 1 182 SER 182 1037 1037 SER SER A . n A 1 183 GLU 183 1038 1038 GLU GLU A . n A 1 184 LYS 184 1039 1039 LYS LYS A . n A 1 185 ASN 185 1040 1040 ASN ASN A . n A 1 186 VAL 186 1041 1041 VAL VAL A . n A 1 187 VAL 187 1042 1042 VAL VAL A . n A 1 188 LYS 188 1043 1043 LYS LYS A . n A 1 189 ILE 189 1044 1044 ILE ILE A . n A 1 190 CYS 190 1045 1045 CYS CYS A . n A 1 191 ASP 191 1046 1046 ASP ASP A . n A 1 192 PHE 192 1047 1047 PHE PHE A . n A 1 193 GLY 193 1048 1048 GLY GLY A . n A 1 194 LEU 194 1049 1049 LEU LEU A . n A 1 195 ALA 195 1050 1050 ALA ALA A . n A 1 196 ARG 196 1051 1051 ARG ARG A . n A 1 197 ASP 197 1052 1052 ASP ASP A . n A 1 198 ILE 198 1053 1053 ILE ILE A . n A 1 199 TYR 199 1054 1054 TYR TYR A . n A 1 200 LYS 200 1055 1055 LYS LYS A . n A 1 201 ASP 201 1056 1056 ASP ASP A . n A 1 202 PRO 202 1057 1057 PRO PRO A . n A 1 203 ASP 203 1058 1058 ASP ASP A . n A 1 204 TYR 204 1059 1059 TYR TYR A . n A 1 205 VAL 205 1060 1060 VAL VAL A . n A 1 206 ARG 206 1061 1061 ARG ARG A . n A 1 207 LYS 207 1062 1062 LYS LYS A . n A 1 208 GLY 208 1063 1063 GLY GLY A . n A 1 209 ASP 209 1064 1064 ASP ASP A . n A 1 210 ALA 210 1065 1065 ALA ALA A . n A 1 211 ARG 211 1066 1066 ARG ARG A . n A 1 212 LEU 212 1067 1067 LEU LEU A . n A 1 213 PRO 213 1068 1068 PRO PRO A . n A 1 214 LEU 214 1069 1069 LEU LEU A . n A 1 215 LYS 215 1070 1070 LYS LYS A . n A 1 216 TRP 216 1071 1071 TRP TRP A . n A 1 217 MET 217 1072 1072 MET MET A . n A 1 218 ALA 218 1073 1073 ALA ALA A . n A 1 219 PRO 219 1074 1074 PRO PRO A . n A 1 220 GLU 220 1075 1075 GLU GLU A . n A 1 221 THR 221 1076 1076 THR THR A . n A 1 222 ILE 222 1077 1077 ILE ILE A . n A 1 223 PHE 223 1078 1078 PHE PHE A . n A 1 224 ASP 224 1079 1079 ASP ASP A . n A 1 225 ARG 225 1080 1080 ARG ARG A . n A 1 226 VAL 226 1081 1081 VAL VAL A . n A 1 227 TYR 227 1082 1082 TYR TYR A . n A 1 228 THR 228 1083 1083 THR THR A . n A 1 229 ILE 229 1084 1084 ILE ILE A . n A 1 230 GLN 230 1085 1085 GLN GLN A . n A 1 231 SER 231 1086 1086 SER SER A . n A 1 232 ASP 232 1087 1087 ASP ASP A . n A 1 233 VAL 233 1088 1088 VAL VAL A . n A 1 234 TRP 234 1089 1089 TRP TRP A . n A 1 235 SER 235 1090 1090 SER SER A . n A 1 236 PHE 236 1091 1091 PHE PHE A . n A 1 237 GLY 237 1092 1092 GLY GLY A . n A 1 238 VAL 238 1093 1093 VAL VAL A . n A 1 239 LEU 239 1094 1094 LEU LEU A . n A 1 240 LEU 240 1095 1095 LEU LEU A . n A 1 241 TRP 241 1096 1096 TRP TRP A . n A 1 242 GLU 242 1097 1097 GLU GLU A . n A 1 243 ILE 243 1098 1098 ILE ILE A . n A 1 244 PHE 244 1099 1099 PHE PHE A . n A 1 245 SER 245 1100 1100 SER SER A . n A 1 246 LEU 246 1101 1101 LEU LEU A . n A 1 247 GLY 247 1102 1102 GLY GLY A . n A 1 248 ALA 248 1103 1103 ALA ALA A . n A 1 249 SER 249 1104 1104 SER SER A . n A 1 250 PRO 250 1105 1105 PRO PRO A . n A 1 251 TYR 251 1106 1106 TYR TYR A . n A 1 252 PRO 252 1107 1107 PRO PRO A . n A 1 253 GLY 253 1108 1108 GLY GLY A . n A 1 254 VAL 254 1109 1109 VAL VAL A . n A 1 255 LYS 255 1110 1110 LYS LYS A . n A 1 256 ILE 256 1111 1111 ILE ILE A . n A 1 257 ASP 257 1112 1112 ASP ASP A . n A 1 258 GLU 258 1113 1113 GLU GLU A . n A 1 259 GLU 259 1114 1114 GLU GLU A . n A 1 260 PHE 260 1115 1115 PHE PHE A . n A 1 261 CYS 261 1116 1116 CYS CYS A . n A 1 262 ARG 262 1117 1117 ARG ARG A . n A 1 263 ARG 263 1118 1118 ARG ARG A . n A 1 264 LEU 264 1119 1119 LEU LEU A . n A 1 265 LYS 265 1120 1120 LYS LYS A . n A 1 266 GLU 266 1121 1121 GLU GLU A . n A 1 267 GLY 267 1122 1122 GLY GLY A . n A 1 268 THR 268 1123 1123 THR THR A . n A 1 269 ARG 269 1124 1124 ARG ARG A . n A 1 270 MET 270 1125 1125 MET MET A . n A 1 271 ARG 271 1126 1126 ARG ARG A . n A 1 272 ALA 272 1127 1127 ALA ALA A . n A 1 273 PRO 273 1128 1128 PRO PRO A . n A 1 274 ASP 274 1129 1129 ASP ASP A . n A 1 275 TYR 275 1130 1130 TYR TYR A . n A 1 276 THR 276 1131 1131 THR THR A . n A 1 277 THR 277 1132 1132 THR THR A . n A 1 278 PRO 278 1133 1133 PRO PRO A . n A 1 279 GLU 279 1134 1134 GLU GLU A . n A 1 280 MET 280 1135 1135 MET MET A . n A 1 281 TYR 281 1136 1136 TYR TYR A . n A 1 282 GLN 282 1137 1137 GLN GLN A . n A 1 283 THR 283 1138 1138 THR THR A . n A 1 284 MET 284 1139 1139 MET MET A . n A 1 285 LEU 285 1140 1140 LEU LEU A . n A 1 286 ASP 286 1141 1141 ASP ASP A . n A 1 287 CYS 287 1142 1142 CYS CYS A . n A 1 288 TRP 288 1143 1143 TRP TRP A . n A 1 289 HIS 289 1144 1144 HIS HIS A . n A 1 290 GLY 290 1145 1145 GLY GLY A . n A 1 291 GLU 291 1146 1146 GLU GLU A . n A 1 292 PRO 292 1147 1147 PRO PRO A . n A 1 293 SER 293 1148 1148 SER SER A . n A 1 294 GLN 294 1149 1149 GLN GLN A . n A 1 295 ARG 295 1150 1150 ARG ARG A . n A 1 296 PRO 296 1151 1151 PRO PRO A . n A 1 297 THR 297 1152 1152 THR THR A . n A 1 298 PHE 298 1153 1153 PHE PHE A . n A 1 299 SER 299 1154 1154 SER SER A . n A 1 300 GLU 300 1155 1155 GLU GLU A . n A 1 301 LEU 301 1156 1156 LEU LEU A . n A 1 302 VAL 302 1157 1157 VAL VAL A . n A 1 303 GLU 303 1158 1158 GLU GLU A . n A 1 304 HIS 304 1159 1159 HIS HIS A . n A 1 305 LEU 305 1160 1160 LEU LEU A . n A 1 306 GLY 306 1161 1161 GLY GLY A . n A 1 307 ASN 307 1162 1162 ASN ASN A . n A 1 308 LEU 308 1163 1163 LEU LEU A . n A 1 309 LEU 309 1164 1164 LEU LEU A . n A 1 310 GLN 310 1165 1165 GLN GLN A . n A 1 311 ALA 311 1166 1166 ALA ALA A . n A 1 312 ASN 312 1167 1167 ASN ASN A . n A 1 313 ALA 313 1168 1168 ALA ALA A . n A 1 314 GLN 314 1169 ? ? ? A . n A 1 315 GLN 315 1170 ? ? ? A . n A 1 316 ASP 316 1171 ? ? ? A . n A 1 317 GLU 317 1172 ? ? ? A . n A 1 318 ASN 318 1173 ? ? ? A . n A 1 319 LEU 319 1174 ? ? ? A . n A 1 320 TYR 320 1175 ? ? ? A . n A 1 321 PHE 321 1176 ? ? ? A . n A 1 322 GLN 322 1177 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 F88 1 1201 1 F88 INH A . C 3 HOH 1 1301 89 HOH HOH A . C 3 HOH 2 1302 54 HOH HOH A . C 3 HOH 3 1303 92 HOH HOH A . C 3 HOH 4 1304 45 HOH HOH A . C 3 HOH 5 1305 1 HOH HOH A . C 3 HOH 6 1306 12 HOH HOH A . C 3 HOH 7 1307 86 HOH HOH A . C 3 HOH 8 1308 5 HOH HOH A . C 3 HOH 9 1309 58 HOH HOH A . C 3 HOH 10 1310 79 HOH HOH A . C 3 HOH 11 1311 80 HOH HOH A . C 3 HOH 12 1312 44 HOH HOH A . C 3 HOH 13 1313 16 HOH HOH A . C 3 HOH 14 1314 57 HOH HOH A . C 3 HOH 15 1315 61 HOH HOH A . C 3 HOH 16 1316 88 HOH HOH A . C 3 HOH 17 1317 3 HOH HOH A . C 3 HOH 18 1318 33 HOH HOH A . C 3 HOH 19 1319 27 HOH HOH A . C 3 HOH 20 1320 19 HOH HOH A . C 3 HOH 21 1321 93 HOH HOH A . C 3 HOH 22 1322 59 HOH HOH A . C 3 HOH 23 1323 6 HOH HOH A . C 3 HOH 24 1324 35 HOH HOH A . C 3 HOH 25 1325 2 HOH HOH A . C 3 HOH 26 1326 48 HOH HOH A . C 3 HOH 27 1327 96 HOH HOH A . C 3 HOH 28 1328 7 HOH HOH A . C 3 HOH 29 1329 75 HOH HOH A . C 3 HOH 30 1330 21 HOH HOH A . C 3 HOH 31 1331 25 HOH HOH A . C 3 HOH 32 1332 37 HOH HOH A . C 3 HOH 33 1333 51 HOH HOH A . C 3 HOH 34 1334 46 HOH HOH A . C 3 HOH 35 1335 52 HOH HOH A . C 3 HOH 36 1336 66 HOH HOH A . C 3 HOH 37 1337 11 HOH HOH A . C 3 HOH 38 1338 65 HOH HOH A . C 3 HOH 39 1339 63 HOH HOH A . C 3 HOH 40 1340 20 HOH HOH A . C 3 HOH 41 1341 31 HOH HOH A . C 3 HOH 42 1342 18 HOH HOH A . C 3 HOH 43 1343 71 HOH HOH A . C 3 HOH 44 1344 55 HOH HOH A . C 3 HOH 45 1345 77 HOH HOH A . C 3 HOH 46 1346 50 HOH HOH A . C 3 HOH 47 1347 8 HOH HOH A . C 3 HOH 48 1348 95 HOH HOH A . C 3 HOH 49 1349 32 HOH HOH A . C 3 HOH 50 1350 34 HOH HOH A . C 3 HOH 51 1351 85 HOH HOH A . C 3 HOH 52 1352 73 HOH HOH A . C 3 HOH 53 1353 40 HOH HOH A . C 3 HOH 54 1354 53 HOH HOH A . C 3 HOH 55 1355 4 HOH HOH A . C 3 HOH 56 1356 94 HOH HOH A . C 3 HOH 57 1357 78 HOH HOH A . C 3 HOH 58 1358 47 HOH HOH A . C 3 HOH 59 1359 49 HOH HOH A . C 3 HOH 60 1360 42 HOH HOH A . C 3 HOH 61 1361 82 HOH HOH A . C 3 HOH 62 1362 38 HOH HOH A . C 3 HOH 63 1363 29 HOH HOH A . C 3 HOH 64 1364 84 HOH HOH A . C 3 HOH 65 1365 36 HOH HOH A . C 3 HOH 66 1366 39 HOH HOH A . C 3 HOH 67 1367 91 HOH HOH A . C 3 HOH 68 1368 10 HOH HOH A . C 3 HOH 69 1369 76 HOH HOH A . C 3 HOH 70 1370 81 HOH HOH A . C 3 HOH 71 1371 70 HOH HOH A . C 3 HOH 72 1372 90 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 15590 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-09-19 2 'Structure model' 1 1 2018-10-03 3 'Structure model' 1 2 2018-10-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.title' 2 2 'Structure model' '_citation_author.identifier_ORCID' 3 2 'Structure model' '_citation_author.name' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 21.5136 _pdbx_refine_tls.origin_y -0.5025 _pdbx_refine_tls.origin_z 12.2711 _pdbx_refine_tls.T[1][1] -0.2085 _pdbx_refine_tls.T[2][2] -0.2721 _pdbx_refine_tls.T[3][3] -0.2167 _pdbx_refine_tls.T[1][2] -0.0239 _pdbx_refine_tls.T[1][3] 0.0266 _pdbx_refine_tls.T[2][3] 0.0114 _pdbx_refine_tls.L[1][1] 1.8346 _pdbx_refine_tls.L[2][2] 1.9632 _pdbx_refine_tls.L[3][3] 2.1799 _pdbx_refine_tls.L[1][2] -0.3094 _pdbx_refine_tls.L[1][3] 0.6029 _pdbx_refine_tls.L[2][3] -0.5496 _pdbx_refine_tls.S[1][1] 0.0139 _pdbx_refine_tls.S[1][2] -0.1218 _pdbx_refine_tls.S[1][3] -0.0117 _pdbx_refine_tls.S[2][1] 0.0840 _pdbx_refine_tls.S[2][2] -0.0598 _pdbx_refine_tls.S[2][3] -0.0753 _pdbx_refine_tls.S[3][1] -0.0698 _pdbx_refine_tls.S[3][2] 0.2609 _pdbx_refine_tls.S[3][3] 0.0458 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|* }' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.6 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 826 ? ? -93.76 -60.06 2 1 ALA A 844 ? ? -90.26 -70.49 3 1 ARG A 1027 ? ? 82.33 -13.78 4 1 ASP A 1028 ? ? -141.60 46.62 5 1 SER A 1037 ? ? -100.44 -168.96 6 1 ASP A 1112 ? ? -133.98 -156.71 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 943 ? CG ? A GLU 138 CG 2 1 Y 1 A GLU 943 ? CD ? A GLU 138 CD 3 1 Y 1 A GLU 943 ? OE1 ? A GLU 138 OE1 4 1 Y 1 A GLU 943 ? OE2 ? A GLU 138 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 806 ? A MET 1 2 1 Y 1 A ASP 807 ? A ASP 2 3 1 Y 1 A PRO 808 ? A PRO 3 4 1 Y 1 A ASP 809 ? A ASP 4 5 1 Y 1 A GLU 810 ? A GLU 5 6 1 Y 1 A LEU 811 ? A LEU 6 7 1 Y 1 A PRO 812 ? A PRO 7 8 1 Y 1 A LEU 813 ? A LEU 8 9 1 Y 1 A ASP 814 ? A ASP 9 10 1 Y 1 A GLU 815 ? A GLU 10 11 1 Y 1 A HIS 816 ? A HIS 11 12 1 Y 1 A CYS 817 ? A CYS 12 13 1 Y 1 A GLU 818 ? A GLU 13 14 1 Y 1 A ARG 819 ? A ARG 14 15 1 Y 1 A LEU 820 ? A LEU 15 16 1 Y 1 A GLN 1169 ? A GLN 314 17 1 Y 1 A GLN 1170 ? A GLN 315 18 1 Y 1 A ASP 1171 ? A ASP 316 19 1 Y 1 A GLU 1172 ? A GLU 317 20 1 Y 1 A ASN 1173 ? A ASN 318 21 1 Y 1 A LEU 1174 ? A LEU 319 22 1 Y 1 A TYR 1175 ? A TYR 320 23 1 Y 1 A PHE 1176 ? A PHE 321 24 1 Y 1 A GLN 1177 ? A GLN 322 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id F88 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id F88 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '~{N}-[4-(6,7-dimethoxyquinazolin-4-yl)oxyphenyl]-2-(1-ethylpyrazol-4-yl)ethanamide' F88 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #