data_6H4D # _entry.id 6H4D # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6H4D pdb_00006h4d 10.2210/pdb6h4d/pdb WWPDB D_1200011002 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-06-26 2 'Structure model' 1 1 2020-01-15 3 'Structure model' 1 2 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6H4D _pdbx_database_status.recvd_initial_deposition_date 2018-07-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rocchio, S.' 1 ? 'Santorelli, D.' 2 ? 'Travaglini-Allocatelli, C.' 3 ? 'Federici, L.' 4 ? 'Di Matteo, A.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Febs J.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1742-464X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 286 _citation.language ? _citation.page_first 4245 _citation.page_last 4260 _citation.title 'Structural and functional investigation of the Small Ribosomal Subunit Biogenesis GTPase A (RsgA) from Pseudomonas aeruginosa.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/febs.14959 _citation.pdbx_database_id_PubMed 31199072 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rocchio, S.' 1 ? primary 'Santorelli, D.' 2 ? primary 'Rinaldo, S.' 3 ? primary 'Franceschini, M.' 4 ? primary 'Malatesta, F.' 5 ? primary 'Imperi, F.' 6 ? primary 'Federici, L.' 7 ? primary 'Travaglini-Allocatelli, C.' 8 ? primary 'Di Matteo, A.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Small ribosomal subunit biogenesis GTPase RsgA' 37129.172 1 3.6.1.- ? ? ? 2 non-polymer nat 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE" 443.201 1 ? ? ? ? 4 water nat water 18.015 29 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAKRHLTRRQSWRIEKIQEERAARAARRESRAVEELEGGDLGPEQTGQVIAHFGVQVEVESADGQVSRCHLRANLPALVT GDQVVWRAGNQGIGVIVAQLPRRSELCRPDMRGLLKPVAANVDRIVIVFAPRPEPHANLIDRYLIAAEHAGIQPLLLLNK ADLVDESNAEGIDALLNVYRTLGYPLIEVSAFNGLAMDELRGALDGHVSVFVGQSGVGKSSLVNALLPGVDTRVGDLSTV TGKGTHTTTTARLFHFPGGGDLIDSPGIREFGLGHVSRDDVEAGFIEFRDLLGHCRFRDCKHDREPGCALLQALEDGRIM PQRMASYRHILASMPETDY ; _entity_poly.pdbx_seq_one_letter_code_can ;MAKRHLTRRQSWRIEKIQEERAARAARRESRAVEELEGGDLGPEQTGQVIAHFGVQVEVESADGQVSRCHLRANLPALVT GDQVVWRAGNQGIGVIVAQLPRRSELCRPDMRGLLKPVAANVDRIVIVFAPRPEPHANLIDRYLIAAEHAGIQPLLLLNK ADLVDESNAEGIDALLNVYRTLGYPLIEVSAFNGLAMDELRGALDGHVSVFVGQSGVGKSSLVNALLPGVDTRVGDLSTV TGKGTHTTTTARLFHFPGGGDLIDSPGIREFGLGHVSRDDVEAGFIEFRDLLGHCRFRDCKHDREPGCALLQALEDGRIM PQRMASYRHILASMPETDY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 "GUANOSINE-5'-DIPHOSPHATE" GDP 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 LYS n 1 4 ARG n 1 5 HIS n 1 6 LEU n 1 7 THR n 1 8 ARG n 1 9 ARG n 1 10 GLN n 1 11 SER n 1 12 TRP n 1 13 ARG n 1 14 ILE n 1 15 GLU n 1 16 LYS n 1 17 ILE n 1 18 GLN n 1 19 GLU n 1 20 GLU n 1 21 ARG n 1 22 ALA n 1 23 ALA n 1 24 ARG n 1 25 ALA n 1 26 ALA n 1 27 ARG n 1 28 ARG n 1 29 GLU n 1 30 SER n 1 31 ARG n 1 32 ALA n 1 33 VAL n 1 34 GLU n 1 35 GLU n 1 36 LEU n 1 37 GLU n 1 38 GLY n 1 39 GLY n 1 40 ASP n 1 41 LEU n 1 42 GLY n 1 43 PRO n 1 44 GLU n 1 45 GLN n 1 46 THR n 1 47 GLY n 1 48 GLN n 1 49 VAL n 1 50 ILE n 1 51 ALA n 1 52 HIS n 1 53 PHE n 1 54 GLY n 1 55 VAL n 1 56 GLN n 1 57 VAL n 1 58 GLU n 1 59 VAL n 1 60 GLU n 1 61 SER n 1 62 ALA n 1 63 ASP n 1 64 GLY n 1 65 GLN n 1 66 VAL n 1 67 SER n 1 68 ARG n 1 69 CYS n 1 70 HIS n 1 71 LEU n 1 72 ARG n 1 73 ALA n 1 74 ASN n 1 75 LEU n 1 76 PRO n 1 77 ALA n 1 78 LEU n 1 79 VAL n 1 80 THR n 1 81 GLY n 1 82 ASP n 1 83 GLN n 1 84 VAL n 1 85 VAL n 1 86 TRP n 1 87 ARG n 1 88 ALA n 1 89 GLY n 1 90 ASN n 1 91 GLN n 1 92 GLY n 1 93 ILE n 1 94 GLY n 1 95 VAL n 1 96 ILE n 1 97 VAL n 1 98 ALA n 1 99 GLN n 1 100 LEU n 1 101 PRO n 1 102 ARG n 1 103 ARG n 1 104 SER n 1 105 GLU n 1 106 LEU n 1 107 CYS n 1 108 ARG n 1 109 PRO n 1 110 ASP n 1 111 MET n 1 112 ARG n 1 113 GLY n 1 114 LEU n 1 115 LEU n 1 116 LYS n 1 117 PRO n 1 118 VAL n 1 119 ALA n 1 120 ALA n 1 121 ASN n 1 122 VAL n 1 123 ASP n 1 124 ARG n 1 125 ILE n 1 126 VAL n 1 127 ILE n 1 128 VAL n 1 129 PHE n 1 130 ALA n 1 131 PRO n 1 132 ARG n 1 133 PRO n 1 134 GLU n 1 135 PRO n 1 136 HIS n 1 137 ALA n 1 138 ASN n 1 139 LEU n 1 140 ILE n 1 141 ASP n 1 142 ARG n 1 143 TYR n 1 144 LEU n 1 145 ILE n 1 146 ALA n 1 147 ALA n 1 148 GLU n 1 149 HIS n 1 150 ALA n 1 151 GLY n 1 152 ILE n 1 153 GLN n 1 154 PRO n 1 155 LEU n 1 156 LEU n 1 157 LEU n 1 158 LEU n 1 159 ASN n 1 160 LYS n 1 161 ALA n 1 162 ASP n 1 163 LEU n 1 164 VAL n 1 165 ASP n 1 166 GLU n 1 167 SER n 1 168 ASN n 1 169 ALA n 1 170 GLU n 1 171 GLY n 1 172 ILE n 1 173 ASP n 1 174 ALA n 1 175 LEU n 1 176 LEU n 1 177 ASN n 1 178 VAL n 1 179 TYR n 1 180 ARG n 1 181 THR n 1 182 LEU n 1 183 GLY n 1 184 TYR n 1 185 PRO n 1 186 LEU n 1 187 ILE n 1 188 GLU n 1 189 VAL n 1 190 SER n 1 191 ALA n 1 192 PHE n 1 193 ASN n 1 194 GLY n 1 195 LEU n 1 196 ALA n 1 197 MET n 1 198 ASP n 1 199 GLU n 1 200 LEU n 1 201 ARG n 1 202 GLY n 1 203 ALA n 1 204 LEU n 1 205 ASP n 1 206 GLY n 1 207 HIS n 1 208 VAL n 1 209 SER n 1 210 VAL n 1 211 PHE n 1 212 VAL n 1 213 GLY n 1 214 GLN n 1 215 SER n 1 216 GLY n 1 217 VAL n 1 218 GLY n 1 219 LYS n 1 220 SER n 1 221 SER n 1 222 LEU n 1 223 VAL n 1 224 ASN n 1 225 ALA n 1 226 LEU n 1 227 LEU n 1 228 PRO n 1 229 GLY n 1 230 VAL n 1 231 ASP n 1 232 THR n 1 233 ARG n 1 234 VAL n 1 235 GLY n 1 236 ASP n 1 237 LEU n 1 238 SER n 1 239 THR n 1 240 VAL n 1 241 THR n 1 242 GLY n 1 243 LYS n 1 244 GLY n 1 245 THR n 1 246 HIS n 1 247 THR n 1 248 THR n 1 249 THR n 1 250 THR n 1 251 ALA n 1 252 ARG n 1 253 LEU n 1 254 PHE n 1 255 HIS n 1 256 PHE n 1 257 PRO n 1 258 GLY n 1 259 GLY n 1 260 GLY n 1 261 ASP n 1 262 LEU n 1 263 ILE n 1 264 ASP n 1 265 SER n 1 266 PRO n 1 267 GLY n 1 268 ILE n 1 269 ARG n 1 270 GLU n 1 271 PHE n 1 272 GLY n 1 273 LEU n 1 274 GLY n 1 275 HIS n 1 276 VAL n 1 277 SER n 1 278 ARG n 1 279 ASP n 1 280 ASP n 1 281 VAL n 1 282 GLU n 1 283 ALA n 1 284 GLY n 1 285 PHE n 1 286 ILE n 1 287 GLU n 1 288 PHE n 1 289 ARG n 1 290 ASP n 1 291 LEU n 1 292 LEU n 1 293 GLY n 1 294 HIS n 1 295 CYS n 1 296 ARG n 1 297 PHE n 1 298 ARG n 1 299 ASP n 1 300 CYS n 1 301 LYS n 1 302 HIS n 1 303 ASP n 1 304 ARG n 1 305 GLU n 1 306 PRO n 1 307 GLY n 1 308 CYS n 1 309 ALA n 1 310 LEU n 1 311 LEU n 1 312 GLN n 1 313 ALA n 1 314 LEU n 1 315 GLU n 1 316 ASP n 1 317 GLY n 1 318 ARG n 1 319 ILE n 1 320 MET n 1 321 PRO n 1 322 GLN n 1 323 ARG n 1 324 MET n 1 325 ALA n 1 326 SER n 1 327 TYR n 1 328 ARG n 1 329 HIS n 1 330 ILE n 1 331 LEU n 1 332 ALA n 1 333 SER n 1 334 MET n 1 335 PRO n 1 336 GLU n 1 337 THR n 1 338 ASP n 1 339 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 339 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rsgA, PA4952' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa PAO1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 208964 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GDP 'RNA linking' n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 ARG 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 THR 7 7 ? ? ? A . n A 1 8 ARG 8 8 ? ? ? A . n A 1 9 ARG 9 9 ? ? ? A . n A 1 10 GLN 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 TRP 12 12 ? ? ? A . n A 1 13 ARG 13 13 ? ? ? A . n A 1 14 ILE 14 14 ? ? ? A . n A 1 15 GLU 15 15 ? ? ? A . n A 1 16 LYS 16 16 ? ? ? A . n A 1 17 ILE 17 17 ? ? ? A . n A 1 18 GLN 18 18 ? ? ? A . n A 1 19 GLU 19 19 ? ? ? A . n A 1 20 GLU 20 20 ? ? ? A . n A 1 21 ARG 21 21 ? ? ? A . n A 1 22 ALA 22 22 ? ? ? A . n A 1 23 ALA 23 23 ? ? ? A . n A 1 24 ARG 24 24 ? ? ? A . n A 1 25 ALA 25 25 ? ? ? A . n A 1 26 ALA 26 26 ? ? ? A . n A 1 27 ARG 27 27 ? ? ? A . n A 1 28 ARG 28 28 ? ? ? A . n A 1 29 GLU 29 29 ? ? ? A . n A 1 30 SER 30 30 ? ? ? A . n A 1 31 ARG 31 31 ? ? ? A . n A 1 32 ALA 32 32 ? ? ? A . n A 1 33 VAL 33 33 ? ? ? A . n A 1 34 GLU 34 34 ? ? ? A . n A 1 35 GLU 35 35 ? ? ? A . n A 1 36 LEU 36 36 ? ? ? A . n A 1 37 GLU 37 37 ? ? ? A . n A 1 38 GLY 38 38 ? ? ? A . n A 1 39 GLY 39 39 ? ? ? A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ASP 63 63 63 ASP ALA A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 ASN 90 90 ? ? ? A . n A 1 91 GLN 91 91 ? ? ? A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 CYS 107 107 107 CYS CYS A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 TYR 143 143 143 TYR TYR A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 HIS 149 149 149 HIS HIS A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 PRO 154 154 154 PRO PRO A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 ASN 168 168 168 ASN ASN A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 ASP 173 173 173 ASP ASP A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ASN 177 177 177 ASN ASN A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 TYR 179 179 179 TYR TYR A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 TYR 184 184 184 TYR TYR A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 MET 197 197 197 MET MET A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 GLY 206 206 206 GLY GLY A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 SER 209 209 209 SER SER A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 GLN 214 214 214 GLN GLN A . n A 1 215 SER 215 215 215 SER SER A . n A 1 216 GLY 216 216 216 GLY GLY A . n A 1 217 VAL 217 217 217 VAL VAL A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 SER 221 221 221 SER SER A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 VAL 223 223 223 VAL VAL A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 ALA 225 225 225 ALA ALA A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 PRO 228 228 228 PRO PRO A . n A 1 229 GLY 229 229 229 GLY GLY A . n A 1 230 VAL 230 230 ? ? ? A . n A 1 231 ASP 231 231 ? ? ? A . n A 1 232 THR 232 232 ? ? ? A . n A 1 233 ARG 233 233 ? ? ? A . n A 1 234 VAL 234 234 ? ? ? A . n A 1 235 GLY 235 235 ? ? ? A . n A 1 236 ASP 236 236 ? ? ? A . n A 1 237 LEU 237 237 ? ? ? A . n A 1 238 SER 238 238 ? ? ? A . n A 1 239 THR 239 239 ? ? ? A . n A 1 240 VAL 240 240 ? ? ? A . n A 1 241 THR 241 241 ? ? ? A . n A 1 242 GLY 242 242 ? ? ? A . n A 1 243 LYS 243 243 ? ? ? A . n A 1 244 GLY 244 244 ? ? ? A . n A 1 245 THR 245 245 ? ? ? A . n A 1 246 HIS 246 246 ? ? ? A . n A 1 247 THR 247 247 ? ? ? A . n A 1 248 THR 248 248 ? ? ? A . n A 1 249 THR 249 249 ? ? ? A . n A 1 250 THR 250 250 250 THR THR A . n A 1 251 ALA 251 251 251 ALA ALA A . n A 1 252 ARG 252 252 252 ARG ARG A . n A 1 253 LEU 253 253 253 LEU LEU A . n A 1 254 PHE 254 254 254 PHE PHE A . n A 1 255 HIS 255 255 255 HIS HIS A . n A 1 256 PHE 256 256 256 PHE PHE A . n A 1 257 PRO 257 257 257 PRO PRO A . n A 1 258 GLY 258 258 258 GLY GLY A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 GLY 260 260 260 GLY GLY A . n A 1 261 ASP 261 261 261 ASP ASP A . n A 1 262 LEU 262 262 262 LEU LEU A . n A 1 263 ILE 263 263 263 ILE ILE A . n A 1 264 ASP 264 264 264 ASP ASP A . n A 1 265 SER 265 265 265 SER SER A . n A 1 266 PRO 266 266 266 PRO PRO A . n A 1 267 GLY 267 267 267 GLY GLY A . n A 1 268 ILE 268 268 268 ILE ILE A . n A 1 269 ARG 269 269 269 ARG ARG A . n A 1 270 GLU 270 270 270 GLU GLU A . n A 1 271 PHE 271 271 271 PHE PHE A . n A 1 272 GLY 272 272 272 GLY GLY A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 GLY 274 274 274 GLY GLY A . n A 1 275 HIS 275 275 275 HIS HIS A . n A 1 276 VAL 276 276 276 VAL VAL A . n A 1 277 SER 277 277 277 SER SER A . n A 1 278 ARG 278 278 278 ARG ARG A . n A 1 279 ASP 279 279 279 ASP ASP A . n A 1 280 ASP 280 280 280 ASP ASP A . n A 1 281 VAL 281 281 281 VAL VAL A . n A 1 282 GLU 282 282 282 GLU GLU A . n A 1 283 ALA 283 283 283 ALA ALA A . n A 1 284 GLY 284 284 284 GLY GLY A . n A 1 285 PHE 285 285 285 PHE PHE A . n A 1 286 ILE 286 286 286 ILE ILE A . n A 1 287 GLU 287 287 287 GLU GLU A . n A 1 288 PHE 288 288 288 PHE PHE A . n A 1 289 ARG 289 289 289 ARG ARG A . n A 1 290 ASP 290 290 290 ASP ASP A . n A 1 291 LEU 291 291 291 LEU LEU A . n A 1 292 LEU 292 292 292 LEU LEU A . n A 1 293 GLY 293 293 293 GLY GLY A . n A 1 294 HIS 294 294 294 HIS HIS A . n A 1 295 CYS 295 295 295 CYS CYS A . n A 1 296 ARG 296 296 296 ARG ARG A . n A 1 297 PHE 297 297 297 PHE PHE A . n A 1 298 ARG 298 298 298 ARG ALA A . n A 1 299 ASP 299 299 299 ASP ASP A . n A 1 300 CYS 300 300 300 CYS CYS A . n A 1 301 LYS 301 301 301 LYS LYS A . n A 1 302 HIS 302 302 302 HIS HIS A . n A 1 303 ASP 303 303 303 ASP ASP A . n A 1 304 ARG 304 304 304 ARG ARG A . n A 1 305 GLU 305 305 305 GLU GLU A . n A 1 306 PRO 306 306 306 PRO PRO A . n A 1 307 GLY 307 307 307 GLY GLY A . n A 1 308 CYS 308 308 308 CYS CYS A . n A 1 309 ALA 309 309 309 ALA ALA A . n A 1 310 LEU 310 310 310 LEU LEU A . n A 1 311 LEU 311 311 311 LEU LEU A . n A 1 312 GLN 312 312 312 GLN GLN A . n A 1 313 ALA 313 313 313 ALA ALA A . n A 1 314 LEU 314 314 314 LEU LEU A . n A 1 315 GLU 315 315 315 GLU GLU A . n A 1 316 ASP 316 316 316 ASP ASP A . n A 1 317 GLY 317 317 317 GLY GLY A . n A 1 318 ARG 318 318 318 ARG ARG A . n A 1 319 ILE 319 319 319 ILE ILE A . n A 1 320 MET 320 320 320 MET MET A . n A 1 321 PRO 321 321 321 PRO PRO A . n A 1 322 GLN 322 322 322 GLN GLN A . n A 1 323 ARG 323 323 323 ARG ARG A . n A 1 324 MET 324 324 324 MET MET A . n A 1 325 ALA 325 325 325 ALA ALA A . n A 1 326 SER 326 326 326 SER SER A . n A 1 327 TYR 327 327 327 TYR TYR A . n A 1 328 ARG 328 328 328 ARG ARG A . n A 1 329 HIS 329 329 329 HIS HIS A . n A 1 330 ILE 330 330 330 ILE ILE A . n A 1 331 LEU 331 331 331 LEU LEU A . n A 1 332 ALA 332 332 332 ALA ALA A . n A 1 333 SER 333 333 333 SER SER A . n A 1 334 MET 334 334 334 MET MET A . n A 1 335 PRO 335 335 335 PRO PRO A . n A 1 336 GLU 336 336 ? ? ? A . n A 1 337 THR 337 337 ? ? ? A . n A 1 338 ASP 338 338 ? ? ? A . n A 1 339 TYR 339 339 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 401 350 ZN ZN A . C 3 GDP 1 402 600 GDP GDP A . D 4 HOH 1 501 48 HOH HOH A . D 4 HOH 2 502 54 HOH HOH A . D 4 HOH 3 503 52 HOH HOH A . D 4 HOH 4 504 28 HOH HOH A . D 4 HOH 5 505 8 HOH HOH A . D 4 HOH 6 506 55 HOH HOH A . D 4 HOH 7 507 25 HOH HOH A . D 4 HOH 8 508 49 HOH HOH A . D 4 HOH 9 509 51 HOH HOH A . D 4 HOH 10 510 44 HOH HOH A . D 4 HOH 11 511 47 HOH HOH A . D 4 HOH 12 512 21 HOH HOH A . D 4 HOH 13 513 23 HOH HOH A . D 4 HOH 14 514 57 HOH HOH A . D 4 HOH 15 515 30 HOH HOH A . D 4 HOH 16 516 53 HOH HOH A . D 4 HOH 17 517 37 HOH HOH A . D 4 HOH 18 518 38 HOH HOH A . D 4 HOH 19 519 39 HOH HOH A . D 4 HOH 20 520 16 HOH HOH A . D 4 HOH 21 521 41 HOH HOH A . D 4 HOH 22 522 26 HOH HOH A . D 4 HOH 23 523 35 HOH HOH A . D 4 HOH 24 524 29 HOH HOH A . D 4 HOH 25 525 34 HOH HOH A . D 4 HOH 26 526 22 HOH HOH A . D 4 HOH 27 527 56 HOH HOH A . D 4 HOH 28 528 14 HOH HOH A . D 4 HOH 29 529 43 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 63 ? CG ? A ASP 63 CG 2 1 Y 1 A ASP 63 ? OD1 ? A ASP 63 OD1 3 1 Y 1 A ASP 63 ? OD2 ? A ASP 63 OD2 4 1 Y 1 A ARG 298 ? CG ? A ARG 298 CG 5 1 Y 1 A ARG 298 ? CD ? A ARG 298 CD 6 1 Y 1 A ARG 298 ? NE ? A ARG 298 NE 7 1 Y 1 A ARG 298 ? CZ ? A ARG 298 CZ 8 1 Y 1 A ARG 298 ? NH1 ? A ARG 298 NH1 9 1 Y 1 A ARG 298 ? NH2 ? A ARG 298 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6H4D _cell.details ? _cell.formula_units_Z ? _cell.length_a 146.405 _cell.length_a_esd ? _cell.length_b 146.405 _cell.length_b_esd ? _cell.length_c 146.405 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6H4D _symmetry.cell_setting ? _symmetry.Int_Tables_number 213 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6H4D _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.52 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 65.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% Polyacrylic acid 5100 sodium salt, 0.1 M Hepes pH 7.5, 5% PEG 200, 0.02 M Magnesium chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-10-11 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ELETTRA BEAMLINE 5.2R' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.2R _diffrn_source.pdbx_synchrotron_site ELETTRA # _reflns.B_iso_Wilson_estimate 86.140 _reflns.entry_id 6H4D _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.900 _reflns.d_resolution_low 48.800 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12464 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 17.200 _reflns.pdbx_Rmerge_I_obs 0.110 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 1 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.114 _reflns.pdbx_Rpim_I_all 0.027 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 214545 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.900 3.080 ? ? 35649 ? ? ? 1955 100.000 ? ? ? ? 1.395 ? ? ? ? ? ? ? ? 18.200 ? ? ? 2.500 1.435 0.334 ? 1 1 0.750 ? 8.700 48.800 ? ? 8595 ? ? ? 553 99.600 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 15.500 ? ? ? 60.000 0.047 0.012 ? 2 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 186.780 _refine.B_iso_mean 88.6613 _refine.B_iso_min 39.540 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6H4D _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.9000 _refine.ls_d_res_low 46.2970 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12411 _refine.ls_number_reflns_R_free 646 _refine.ls_number_reflns_R_work 11765 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8500 _refine.ls_percent_reflns_R_free 5.2100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2500 _refine.ls_R_factor_R_free 0.2865 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2480 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2rcn _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.2400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.9000 _refine_hist.d_res_low 46.2970 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 2137 _refine_hist.pdbx_number_residues_total 274 _refine_hist.pdbx_B_iso_mean_ligand 75.31 _refine_hist.pdbx_B_iso_mean_solvent 78.83 _refine_hist.pdbx_number_atoms_protein 2076 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 2145 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.974 ? 2913 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.039 ? 326 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 385 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.501 ? 791 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.9004 3.1243 2418 . 126 2292 100.0000 . . . 0.3882 0.0000 0.3112 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.1243 3.4386 2420 . 136 2284 100.0000 . . . 0.3668 0.0000 0.2814 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.4386 3.9359 2441 . 124 2317 100.0000 . . . 0.3421 0.0000 0.2605 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.9359 4.9580 2487 . 130 2357 100.0000 . . . 0.2817 0.0000 0.2240 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 4.9580 46.3032 2645 . 130 2515 100.0000 . . . 0.2379 0.0000 0.2416 . . . . . . 5 . . . # _struct.entry_id 6H4D _struct.title 'Crystal structure of RsgA from Pseudomonas aeruginosa' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6H4D _struct_keywords.text 'CpGTPase, Ribosome maturation factor, YjeQ, RNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RSGA_PSEAE _struct_ref.pdbx_db_accession Q9HUL3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAKRHLTRRQSWRIEKIQEERAARAARRESRAVEELEGGDLGPEQTGQVIAHFGVQVEVESADGQVSRCHLRANLPALVT GDQVVWRAGNQGIGVIVAQLPRRSELCRPDMRGLLKPVAANVDRIVIVFAPRPEPHANLIDRYLIAAEHAGIQPLLLLNK ADLVDESNAEGIDALLNVYRTLGYPLIEVSAFNGLAMDELRGALDGHVSVFVGQSGVGKSSLVNALLPGVDTRVGDLSTV TGKGTHTTTTARLFHFPGGGDLIDSPGIREFGLGHVSRDDVEAGFIEFRDLLGHCRFRDCKHDREPGCALLQALEDGRIM PQRMASYRHILASMPETDY ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6H4D _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 339 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HUL3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 339 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 339 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 590 ? 1 MORE -4 ? 1 'SSA (A^2)' 13950 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 136 ? ALA A 150 ? HIS A 136 ALA A 150 1 ? 15 HELX_P HELX_P2 AA2 LYS A 160 ? VAL A 164 ? LYS A 160 VAL A 164 5 ? 5 HELX_P HELX_P3 AA3 ASP A 165 ? THR A 181 ? ASP A 165 THR A 181 1 ? 17 HELX_P HELX_P4 AA4 ALA A 196 ? ASP A 205 ? ALA A 196 ASP A 205 1 ? 10 HELX_P HELX_P5 AA5 GLY A 218 ? LEU A 227 ? GLY A 218 LEU A 227 1 ? 10 HELX_P HELX_P6 AA6 SER A 265 ? GLU A 270 ? SER A 265 GLU A 270 1 ? 6 HELX_P HELX_P7 AA7 SER A 277 ? GLY A 284 ? SER A 277 GLY A 284 1 ? 8 HELX_P HELX_P8 AA8 PHE A 285 ? LEU A 292 ? PHE A 285 LEU A 292 1 ? 8 HELX_P HELX_P9 AA9 CYS A 308 ? GLY A 317 ? CYS A 308 GLY A 317 1 ? 10 HELX_P HELX_P10 AB1 MET A 320 ? ALA A 332 ? MET A 320 ALA A 332 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 295 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 295 A ZN 401 1_555 ? ? ? ? ? ? ? 2.421 ? ? metalc2 metalc ? ? A CYS 300 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 300 A ZN 401 1_555 ? ? ? ? ? ? ? 2.411 ? ? metalc3 metalc ? ? A HIS 302 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 302 A ZN 401 1_555 ? ? ? ? ? ? ? 2.121 ? ? metalc4 metalc ? ? A CYS 308 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 308 A ZN 401 1_555 ? ? ? ? ? ? ? 2.467 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 295 ? A CYS 295 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 300 ? A CYS 300 ? 1_555 108.0 ? 2 SG ? A CYS 295 ? A CYS 295 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 302 ? A HIS 302 ? 1_555 116.0 ? 3 SG ? A CYS 300 ? A CYS 300 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 302 ? A HIS 302 ? 1_555 102.2 ? 4 SG ? A CYS 295 ? A CYS 295 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 308 ? A CYS 308 ? 1_555 112.2 ? 5 SG ? A CYS 300 ? A CYS 300 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 308 ? A CYS 308 ? 1_555 106.2 ? 6 ND1 ? A HIS 302 ? A HIS 302 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 308 ? A CYS 308 ? 1_555 111.2 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 132 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 132 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 133 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 133 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.16 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? AA3 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA3 3 4 ? parallel AA3 4 5 ? parallel AA3 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 44 ? PHE A 53 ? GLU A 44 PHE A 53 AA1 2 GLN A 56 ? SER A 61 ? GLN A 56 SER A 61 AA1 3 VAL A 66 ? LEU A 71 ? VAL A 66 LEU A 71 AA1 4 ILE A 93 ? GLN A 99 ? ILE A 93 GLN A 99 AA1 5 GLN A 83 ? ARG A 87 ? GLN A 83 ARG A 87 AA1 6 GLU A 44 ? PHE A 53 ? GLU A 44 PHE A 53 AA2 1 GLU A 105 ? PRO A 109 ? GLU A 105 PRO A 109 AA2 2 LEU A 115 ? ALA A 120 ? LEU A 115 ALA A 120 AA3 1 LEU A 186 ? GLU A 188 ? LEU A 186 GLU A 188 AA3 2 GLN A 153 ? LEU A 158 ? GLN A 153 LEU A 158 AA3 3 ARG A 124 ? PHE A 129 ? ARG A 124 PHE A 129 AA3 4 VAL A 208 ? VAL A 212 ? VAL A 208 VAL A 212 AA3 5 ASP A 261 ? ASP A 264 ? ASP A 261 ASP A 264 AA3 6 ARG A 252 ? HIS A 255 ? ARG A 252 HIS A 255 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 50 ? N ILE A 50 O GLU A 58 ? O GLU A 58 AA1 2 3 N VAL A 59 ? N VAL A 59 O SER A 67 ? O SER A 67 AA1 3 4 N ARG A 68 ? N ARG A 68 O GLY A 94 ? O GLY A 94 AA1 4 5 O ALA A 98 ? O ALA A 98 N VAL A 85 ? N VAL A 85 AA1 5 6 O VAL A 84 ? O VAL A 84 N GLY A 47 ? N GLY A 47 AA2 1 2 N LEU A 106 ? N LEU A 106 O VAL A 118 ? O VAL A 118 AA3 1 2 O ILE A 187 ? O ILE A 187 N LEU A 158 ? N LEU A 158 AA3 2 3 O LEU A 157 ? O LEU A 157 N ILE A 127 ? N ILE A 127 AA3 3 4 N VAL A 126 ? N VAL A 126 O VAL A 210 ? O VAL A 210 AA3 4 5 N SER A 209 ? N SER A 209 O ASP A 261 ? O ASP A 261 AA3 5 6 O LEU A 262 ? O LEU A 262 N PHE A 254 ? N PHE A 254 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 401 ? 4 'binding site for residue ZN A 401' AC2 Software A GDP 402 ? 16 'binding site for residue GDP A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 295 ? CYS A 295 . ? 1_555 ? 2 AC1 4 CYS A 300 ? CYS A 300 . ? 1_555 ? 3 AC1 4 HIS A 302 ? HIS A 302 . ? 1_555 ? 4 AC1 4 CYS A 308 ? CYS A 308 . ? 1_555 ? 5 AC2 16 ASN A 159 ? ASN A 159 . ? 1_555 ? 6 AC2 16 LYS A 160 ? LYS A 160 . ? 1_555 ? 7 AC2 16 ASP A 162 ? ASP A 162 . ? 1_555 ? 8 AC2 16 LEU A 163 ? LEU A 163 . ? 1_555 ? 9 AC2 16 SER A 190 ? SER A 190 . ? 1_555 ? 10 AC2 16 ALA A 191 ? ALA A 191 . ? 1_555 ? 11 AC2 16 PHE A 192 ? PHE A 192 . ? 1_555 ? 12 AC2 16 SER A 215 ? SER A 215 . ? 1_555 ? 13 AC2 16 GLY A 216 ? GLY A 216 . ? 1_555 ? 14 AC2 16 VAL A 217 ? VAL A 217 . ? 1_555 ? 15 AC2 16 GLY A 218 ? GLY A 218 . ? 1_555 ? 16 AC2 16 LYS A 219 ? LYS A 219 . ? 1_555 ? 17 AC2 16 SER A 220 ? SER A 220 . ? 1_555 ? 18 AC2 16 SER A 221 ? SER A 221 . ? 1_555 ? 19 AC2 16 HIS A 255 ? HIS A 255 . ? 9_555 ? 20 AC2 16 PRO A 257 ? PRO A 257 . ? 9_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 53 ? ? -93.29 49.43 2 1 PRO A 76 ? ? -56.34 172.86 3 1 SER A 265 ? ? -172.13 147.27 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -14.3231 _pdbx_refine_tls.origin_y -15.5124 _pdbx_refine_tls.origin_z 15.8311 _pdbx_refine_tls.T[1][1] 0.5346 _pdbx_refine_tls.T[2][2] 0.3845 _pdbx_refine_tls.T[3][3] 0.5306 _pdbx_refine_tls.T[1][2] -0.0646 _pdbx_refine_tls.T[1][3] -0.0381 _pdbx_refine_tls.T[2][3] -0.0308 _pdbx_refine_tls.L[1][1] 1.5484 _pdbx_refine_tls.L[2][2] 2.3530 _pdbx_refine_tls.L[3][3] 2.3690 _pdbx_refine_tls.L[1][2] -0.6272 _pdbx_refine_tls.L[1][3] -0.7351 _pdbx_refine_tls.L[2][3] 0.2385 _pdbx_refine_tls.S[1][1] 0.1349 _pdbx_refine_tls.S[2][2] -0.2055 _pdbx_refine_tls.S[3][3] 0.0724 _pdbx_refine_tls.S[1][2] -0.0787 _pdbx_refine_tls.S[1][3] -0.2026 _pdbx_refine_tls.S[2][3] 0.4681 _pdbx_refine_tls.S[2][1] -0.0583 _pdbx_refine_tls.S[3][1] 0.0400 _pdbx_refine_tls.S[3][2] 0.0182 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 40 A 600 all ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 Z 8 Z 57 all ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A ARG 4 ? A ARG 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A THR 7 ? A THR 7 8 1 Y 1 A ARG 8 ? A ARG 8 9 1 Y 1 A ARG 9 ? A ARG 9 10 1 Y 1 A GLN 10 ? A GLN 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A TRP 12 ? A TRP 12 13 1 Y 1 A ARG 13 ? A ARG 13 14 1 Y 1 A ILE 14 ? A ILE 14 15 1 Y 1 A GLU 15 ? A GLU 15 16 1 Y 1 A LYS 16 ? A LYS 16 17 1 Y 1 A ILE 17 ? A ILE 17 18 1 Y 1 A GLN 18 ? A GLN 18 19 1 Y 1 A GLU 19 ? A GLU 19 20 1 Y 1 A GLU 20 ? A GLU 20 21 1 Y 1 A ARG 21 ? A ARG 21 22 1 Y 1 A ALA 22 ? A ALA 22 23 1 Y 1 A ALA 23 ? A ALA 23 24 1 Y 1 A ARG 24 ? A ARG 24 25 1 Y 1 A ALA 25 ? A ALA 25 26 1 Y 1 A ALA 26 ? A ALA 26 27 1 Y 1 A ARG 27 ? A ARG 27 28 1 Y 1 A ARG 28 ? A ARG 28 29 1 Y 1 A GLU 29 ? A GLU 29 30 1 Y 1 A SER 30 ? A SER 30 31 1 Y 1 A ARG 31 ? A ARG 31 32 1 Y 1 A ALA 32 ? A ALA 32 33 1 Y 1 A VAL 33 ? A VAL 33 34 1 Y 1 A GLU 34 ? A GLU 34 35 1 Y 1 A GLU 35 ? A GLU 35 36 1 Y 1 A LEU 36 ? A LEU 36 37 1 Y 1 A GLU 37 ? A GLU 37 38 1 Y 1 A GLY 38 ? A GLY 38 39 1 Y 1 A GLY 39 ? A GLY 39 40 1 Y 1 A ASN 90 ? A ASN 90 41 1 Y 1 A GLN 91 ? A GLN 91 42 1 Y 1 A VAL 230 ? A VAL 230 43 1 Y 1 A ASP 231 ? A ASP 231 44 1 Y 1 A THR 232 ? A THR 232 45 1 Y 1 A ARG 233 ? A ARG 233 46 1 Y 1 A VAL 234 ? A VAL 234 47 1 Y 1 A GLY 235 ? A GLY 235 48 1 Y 1 A ASP 236 ? A ASP 236 49 1 Y 1 A LEU 237 ? A LEU 237 50 1 Y 1 A SER 238 ? A SER 238 51 1 Y 1 A THR 239 ? A THR 239 52 1 Y 1 A VAL 240 ? A VAL 240 53 1 Y 1 A THR 241 ? A THR 241 54 1 Y 1 A GLY 242 ? A GLY 242 55 1 Y 1 A LYS 243 ? A LYS 243 56 1 Y 1 A GLY 244 ? A GLY 244 57 1 Y 1 A THR 245 ? A THR 245 58 1 Y 1 A HIS 246 ? A HIS 246 59 1 Y 1 A THR 247 ? A THR 247 60 1 Y 1 A THR 248 ? A THR 248 61 1 Y 1 A THR 249 ? A THR 249 62 1 Y 1 A GLU 336 ? A GLU 336 63 1 Y 1 A THR 337 ? A THR 337 64 1 Y 1 A ASP 338 ? A ASP 338 65 1 Y 1 A TYR 339 ? A TYR 339 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GDP PB P N N 88 GDP O1B O N N 89 GDP O2B O N N 90 GDP O3B O N N 91 GDP O3A O N N 92 GDP PA P N N 93 GDP O1A O N N 94 GDP O2A O N N 95 GDP "O5'" O N N 96 GDP "C5'" C N N 97 GDP "C4'" C N R 98 GDP "O4'" O N N 99 GDP "C3'" C N S 100 GDP "O3'" O N N 101 GDP "C2'" C N R 102 GDP "O2'" O N N 103 GDP "C1'" C N R 104 GDP N9 N Y N 105 GDP C8 C Y N 106 GDP N7 N Y N 107 GDP C5 C Y N 108 GDP C6 C N N 109 GDP O6 O N N 110 GDP N1 N N N 111 GDP C2 C N N 112 GDP N2 N N N 113 GDP N3 N N N 114 GDP C4 C Y N 115 GDP HOB2 H N N 116 GDP HOB3 H N N 117 GDP HOA2 H N N 118 GDP "H5'" H N N 119 GDP "H5''" H N N 120 GDP "H4'" H N N 121 GDP "H3'" H N N 122 GDP "HO3'" H N N 123 GDP "H2'" H N N 124 GDP "HO2'" H N N 125 GDP "H1'" H N N 126 GDP H8 H N N 127 GDP HN1 H N N 128 GDP HN21 H N N 129 GDP HN22 H N N 130 GLN N N N N 131 GLN CA C N S 132 GLN C C N N 133 GLN O O N N 134 GLN CB C N N 135 GLN CG C N N 136 GLN CD C N N 137 GLN OE1 O N N 138 GLN NE2 N N N 139 GLN OXT O N N 140 GLN H H N N 141 GLN H2 H N N 142 GLN HA H N N 143 GLN HB2 H N N 144 GLN HB3 H N N 145 GLN HG2 H N N 146 GLN HG3 H N N 147 GLN HE21 H N N 148 GLN HE22 H N N 149 GLN HXT H N N 150 GLU N N N N 151 GLU CA C N S 152 GLU C C N N 153 GLU O O N N 154 GLU CB C N N 155 GLU CG C N N 156 GLU CD C N N 157 GLU OE1 O N N 158 GLU OE2 O N N 159 GLU OXT O N N 160 GLU H H N N 161 GLU H2 H N N 162 GLU HA H N N 163 GLU HB2 H N N 164 GLU HB3 H N N 165 GLU HG2 H N N 166 GLU HG3 H N N 167 GLU HE2 H N N 168 GLU HXT H N N 169 GLY N N N N 170 GLY CA C N N 171 GLY C C N N 172 GLY O O N N 173 GLY OXT O N N 174 GLY H H N N 175 GLY H2 H N N 176 GLY HA2 H N N 177 GLY HA3 H N N 178 GLY HXT H N N 179 HIS N N N N 180 HIS CA C N S 181 HIS C C N N 182 HIS O O N N 183 HIS CB C N N 184 HIS CG C Y N 185 HIS ND1 N Y N 186 HIS CD2 C Y N 187 HIS CE1 C Y N 188 HIS NE2 N Y N 189 HIS OXT O N N 190 HIS H H N N 191 HIS H2 H N N 192 HIS HA H N N 193 HIS HB2 H N N 194 HIS HB3 H N N 195 HIS HD1 H N N 196 HIS HD2 H N N 197 HIS HE1 H N N 198 HIS HE2 H N N 199 HIS HXT H N N 200 HOH O O N N 201 HOH H1 H N N 202 HOH H2 H N N 203 ILE N N N N 204 ILE CA C N S 205 ILE C C N N 206 ILE O O N N 207 ILE CB C N S 208 ILE CG1 C N N 209 ILE CG2 C N N 210 ILE CD1 C N N 211 ILE OXT O N N 212 ILE H H N N 213 ILE H2 H N N 214 ILE HA H N N 215 ILE HB H N N 216 ILE HG12 H N N 217 ILE HG13 H N N 218 ILE HG21 H N N 219 ILE HG22 H N N 220 ILE HG23 H N N 221 ILE HD11 H N N 222 ILE HD12 H N N 223 ILE HD13 H N N 224 ILE HXT H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 MET N N N N 273 MET CA C N S 274 MET C C N N 275 MET O O N N 276 MET CB C N N 277 MET CG C N N 278 MET SD S N N 279 MET CE C N N 280 MET OXT O N N 281 MET H H N N 282 MET H2 H N N 283 MET HA H N N 284 MET HB2 H N N 285 MET HB3 H N N 286 MET HG2 H N N 287 MET HG3 H N N 288 MET HE1 H N N 289 MET HE2 H N N 290 MET HE3 H N N 291 MET HXT H N N 292 PHE N N N N 293 PHE CA C N S 294 PHE C C N N 295 PHE O O N N 296 PHE CB C N N 297 PHE CG C Y N 298 PHE CD1 C Y N 299 PHE CD2 C Y N 300 PHE CE1 C Y N 301 PHE CE2 C Y N 302 PHE CZ C Y N 303 PHE OXT O N N 304 PHE H H N N 305 PHE H2 H N N 306 PHE HA H N N 307 PHE HB2 H N N 308 PHE HB3 H N N 309 PHE HD1 H N N 310 PHE HD2 H N N 311 PHE HE1 H N N 312 PHE HE2 H N N 313 PHE HZ H N N 314 PHE HXT H N N 315 PRO N N N N 316 PRO CA C N S 317 PRO C C N N 318 PRO O O N N 319 PRO CB C N N 320 PRO CG C N N 321 PRO CD C N N 322 PRO OXT O N N 323 PRO H H N N 324 PRO HA H N N 325 PRO HB2 H N N 326 PRO HB3 H N N 327 PRO HG2 H N N 328 PRO HG3 H N N 329 PRO HD2 H N N 330 PRO HD3 H N N 331 PRO HXT H N N 332 SER N N N N 333 SER CA C N S 334 SER C C N N 335 SER O O N N 336 SER CB C N N 337 SER OG O N N 338 SER OXT O N N 339 SER H H N N 340 SER H2 H N N 341 SER HA H N N 342 SER HB2 H N N 343 SER HB3 H N N 344 SER HG H N N 345 SER HXT H N N 346 THR N N N N 347 THR CA C N S 348 THR C C N N 349 THR O O N N 350 THR CB C N R 351 THR OG1 O N N 352 THR CG2 C N N 353 THR OXT O N N 354 THR H H N N 355 THR H2 H N N 356 THR HA H N N 357 THR HB H N N 358 THR HG1 H N N 359 THR HG21 H N N 360 THR HG22 H N N 361 THR HG23 H N N 362 THR HXT H N N 363 TRP N N N N 364 TRP CA C N S 365 TRP C C N N 366 TRP O O N N 367 TRP CB C N N 368 TRP CG C Y N 369 TRP CD1 C Y N 370 TRP CD2 C Y N 371 TRP NE1 N Y N 372 TRP CE2 C Y N 373 TRP CE3 C Y N 374 TRP CZ2 C Y N 375 TRP CZ3 C Y N 376 TRP CH2 C Y N 377 TRP OXT O N N 378 TRP H H N N 379 TRP H2 H N N 380 TRP HA H N N 381 TRP HB2 H N N 382 TRP HB3 H N N 383 TRP HD1 H N N 384 TRP HE1 H N N 385 TRP HE3 H N N 386 TRP HZ2 H N N 387 TRP HZ3 H N N 388 TRP HH2 H N N 389 TRP HXT H N N 390 TYR N N N N 391 TYR CA C N S 392 TYR C C N N 393 TYR O O N N 394 TYR CB C N N 395 TYR CG C Y N 396 TYR CD1 C Y N 397 TYR CD2 C Y N 398 TYR CE1 C Y N 399 TYR CE2 C Y N 400 TYR CZ C Y N 401 TYR OH O N N 402 TYR OXT O N N 403 TYR H H N N 404 TYR H2 H N N 405 TYR HA H N N 406 TYR HB2 H N N 407 TYR HB3 H N N 408 TYR HD1 H N N 409 TYR HD2 H N N 410 TYR HE1 H N N 411 TYR HE2 H N N 412 TYR HH H N N 413 TYR HXT H N N 414 VAL N N N N 415 VAL CA C N S 416 VAL C C N N 417 VAL O O N N 418 VAL CB C N N 419 VAL CG1 C N N 420 VAL CG2 C N N 421 VAL OXT O N N 422 VAL H H N N 423 VAL H2 H N N 424 VAL HA H N N 425 VAL HB H N N 426 VAL HG11 H N N 427 VAL HG12 H N N 428 VAL HG13 H N N 429 VAL HG21 H N N 430 VAL HG22 H N N 431 VAL HG23 H N N 432 VAL HXT H N N 433 ZN ZN ZN N N 434 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GDP PB O1B doub N N 83 GDP PB O2B sing N N 84 GDP PB O3B sing N N 85 GDP PB O3A sing N N 86 GDP O2B HOB2 sing N N 87 GDP O3B HOB3 sing N N 88 GDP O3A PA sing N N 89 GDP PA O1A doub N N 90 GDP PA O2A sing N N 91 GDP PA "O5'" sing N N 92 GDP O2A HOA2 sing N N 93 GDP "O5'" "C5'" sing N N 94 GDP "C5'" "C4'" sing N N 95 GDP "C5'" "H5'" sing N N 96 GDP "C5'" "H5''" sing N N 97 GDP "C4'" "O4'" sing N N 98 GDP "C4'" "C3'" sing N N 99 GDP "C4'" "H4'" sing N N 100 GDP "O4'" "C1'" sing N N 101 GDP "C3'" "O3'" sing N N 102 GDP "C3'" "C2'" sing N N 103 GDP "C3'" "H3'" sing N N 104 GDP "O3'" "HO3'" sing N N 105 GDP "C2'" "O2'" sing N N 106 GDP "C2'" "C1'" sing N N 107 GDP "C2'" "H2'" sing N N 108 GDP "O2'" "HO2'" sing N N 109 GDP "C1'" N9 sing N N 110 GDP "C1'" "H1'" sing N N 111 GDP N9 C8 sing Y N 112 GDP N9 C4 sing Y N 113 GDP C8 N7 doub Y N 114 GDP C8 H8 sing N N 115 GDP N7 C5 sing Y N 116 GDP C5 C6 sing N N 117 GDP C5 C4 doub Y N 118 GDP C6 O6 doub N N 119 GDP C6 N1 sing N N 120 GDP N1 C2 sing N N 121 GDP N1 HN1 sing N N 122 GDP C2 N2 sing N N 123 GDP C2 N3 doub N N 124 GDP N2 HN21 sing N N 125 GDP N2 HN22 sing N N 126 GDP N3 C4 sing N N 127 GLN N CA sing N N 128 GLN N H sing N N 129 GLN N H2 sing N N 130 GLN CA C sing N N 131 GLN CA CB sing N N 132 GLN CA HA sing N N 133 GLN C O doub N N 134 GLN C OXT sing N N 135 GLN CB CG sing N N 136 GLN CB HB2 sing N N 137 GLN CB HB3 sing N N 138 GLN CG CD sing N N 139 GLN CG HG2 sing N N 140 GLN CG HG3 sing N N 141 GLN CD OE1 doub N N 142 GLN CD NE2 sing N N 143 GLN NE2 HE21 sing N N 144 GLN NE2 HE22 sing N N 145 GLN OXT HXT sing N N 146 GLU N CA sing N N 147 GLU N H sing N N 148 GLU N H2 sing N N 149 GLU CA C sing N N 150 GLU CA CB sing N N 151 GLU CA HA sing N N 152 GLU C O doub N N 153 GLU C OXT sing N N 154 GLU CB CG sing N N 155 GLU CB HB2 sing N N 156 GLU CB HB3 sing N N 157 GLU CG CD sing N N 158 GLU CG HG2 sing N N 159 GLU CG HG3 sing N N 160 GLU CD OE1 doub N N 161 GLU CD OE2 sing N N 162 GLU OE2 HE2 sing N N 163 GLU OXT HXT sing N N 164 GLY N CA sing N N 165 GLY N H sing N N 166 GLY N H2 sing N N 167 GLY CA C sing N N 168 GLY CA HA2 sing N N 169 GLY CA HA3 sing N N 170 GLY C O doub N N 171 GLY C OXT sing N N 172 GLY OXT HXT sing N N 173 HIS N CA sing N N 174 HIS N H sing N N 175 HIS N H2 sing N N 176 HIS CA C sing N N 177 HIS CA CB sing N N 178 HIS CA HA sing N N 179 HIS C O doub N N 180 HIS C OXT sing N N 181 HIS CB CG sing N N 182 HIS CB HB2 sing N N 183 HIS CB HB3 sing N N 184 HIS CG ND1 sing Y N 185 HIS CG CD2 doub Y N 186 HIS ND1 CE1 doub Y N 187 HIS ND1 HD1 sing N N 188 HIS CD2 NE2 sing Y N 189 HIS CD2 HD2 sing N N 190 HIS CE1 NE2 sing Y N 191 HIS CE1 HE1 sing N N 192 HIS NE2 HE2 sing N N 193 HIS OXT HXT sing N N 194 HOH O H1 sing N N 195 HOH O H2 sing N N 196 ILE N CA sing N N 197 ILE N H sing N N 198 ILE N H2 sing N N 199 ILE CA C sing N N 200 ILE CA CB sing N N 201 ILE CA HA sing N N 202 ILE C O doub N N 203 ILE C OXT sing N N 204 ILE CB CG1 sing N N 205 ILE CB CG2 sing N N 206 ILE CB HB sing N N 207 ILE CG1 CD1 sing N N 208 ILE CG1 HG12 sing N N 209 ILE CG1 HG13 sing N N 210 ILE CG2 HG21 sing N N 211 ILE CG2 HG22 sing N N 212 ILE CG2 HG23 sing N N 213 ILE CD1 HD11 sing N N 214 ILE CD1 HD12 sing N N 215 ILE CD1 HD13 sing N N 216 ILE OXT HXT sing N N 217 LEU N CA sing N N 218 LEU N H sing N N 219 LEU N H2 sing N N 220 LEU CA C sing N N 221 LEU CA CB sing N N 222 LEU CA HA sing N N 223 LEU C O doub N N 224 LEU C OXT sing N N 225 LEU CB CG sing N N 226 LEU CB HB2 sing N N 227 LEU CB HB3 sing N N 228 LEU CG CD1 sing N N 229 LEU CG CD2 sing N N 230 LEU CG HG sing N N 231 LEU CD1 HD11 sing N N 232 LEU CD1 HD12 sing N N 233 LEU CD1 HD13 sing N N 234 LEU CD2 HD21 sing N N 235 LEU CD2 HD22 sing N N 236 LEU CD2 HD23 sing N N 237 LEU OXT HXT sing N N 238 LYS N CA sing N N 239 LYS N H sing N N 240 LYS N H2 sing N N 241 LYS CA C sing N N 242 LYS CA CB sing N N 243 LYS CA HA sing N N 244 LYS C O doub N N 245 LYS C OXT sing N N 246 LYS CB CG sing N N 247 LYS CB HB2 sing N N 248 LYS CB HB3 sing N N 249 LYS CG CD sing N N 250 LYS CG HG2 sing N N 251 LYS CG HG3 sing N N 252 LYS CD CE sing N N 253 LYS CD HD2 sing N N 254 LYS CD HD3 sing N N 255 LYS CE NZ sing N N 256 LYS CE HE2 sing N N 257 LYS CE HE3 sing N N 258 LYS NZ HZ1 sing N N 259 LYS NZ HZ2 sing N N 260 LYS NZ HZ3 sing N N 261 LYS OXT HXT sing N N 262 MET N CA sing N N 263 MET N H sing N N 264 MET N H2 sing N N 265 MET CA C sing N N 266 MET CA CB sing N N 267 MET CA HA sing N N 268 MET C O doub N N 269 MET C OXT sing N N 270 MET CB CG sing N N 271 MET CB HB2 sing N N 272 MET CB HB3 sing N N 273 MET CG SD sing N N 274 MET CG HG2 sing N N 275 MET CG HG3 sing N N 276 MET SD CE sing N N 277 MET CE HE1 sing N N 278 MET CE HE2 sing N N 279 MET CE HE3 sing N N 280 MET OXT HXT sing N N 281 PHE N CA sing N N 282 PHE N H sing N N 283 PHE N H2 sing N N 284 PHE CA C sing N N 285 PHE CA CB sing N N 286 PHE CA HA sing N N 287 PHE C O doub N N 288 PHE C OXT sing N N 289 PHE CB CG sing N N 290 PHE CB HB2 sing N N 291 PHE CB HB3 sing N N 292 PHE CG CD1 doub Y N 293 PHE CG CD2 sing Y N 294 PHE CD1 CE1 sing Y N 295 PHE CD1 HD1 sing N N 296 PHE CD2 CE2 doub Y N 297 PHE CD2 HD2 sing N N 298 PHE CE1 CZ doub Y N 299 PHE CE1 HE1 sing N N 300 PHE CE2 CZ sing Y N 301 PHE CE2 HE2 sing N N 302 PHE CZ HZ sing N N 303 PHE OXT HXT sing N N 304 PRO N CA sing N N 305 PRO N CD sing N N 306 PRO N H sing N N 307 PRO CA C sing N N 308 PRO CA CB sing N N 309 PRO CA HA sing N N 310 PRO C O doub N N 311 PRO C OXT sing N N 312 PRO CB CG sing N N 313 PRO CB HB2 sing N N 314 PRO CB HB3 sing N N 315 PRO CG CD sing N N 316 PRO CG HG2 sing N N 317 PRO CG HG3 sing N N 318 PRO CD HD2 sing N N 319 PRO CD HD3 sing N N 320 PRO OXT HXT sing N N 321 SER N CA sing N N 322 SER N H sing N N 323 SER N H2 sing N N 324 SER CA C sing N N 325 SER CA CB sing N N 326 SER CA HA sing N N 327 SER C O doub N N 328 SER C OXT sing N N 329 SER CB OG sing N N 330 SER CB HB2 sing N N 331 SER CB HB3 sing N N 332 SER OG HG sing N N 333 SER OXT HXT sing N N 334 THR N CA sing N N 335 THR N H sing N N 336 THR N H2 sing N N 337 THR CA C sing N N 338 THR CA CB sing N N 339 THR CA HA sing N N 340 THR C O doub N N 341 THR C OXT sing N N 342 THR CB OG1 sing N N 343 THR CB CG2 sing N N 344 THR CB HB sing N N 345 THR OG1 HG1 sing N N 346 THR CG2 HG21 sing N N 347 THR CG2 HG22 sing N N 348 THR CG2 HG23 sing N N 349 THR OXT HXT sing N N 350 TRP N CA sing N N 351 TRP N H sing N N 352 TRP N H2 sing N N 353 TRP CA C sing N N 354 TRP CA CB sing N N 355 TRP CA HA sing N N 356 TRP C O doub N N 357 TRP C OXT sing N N 358 TRP CB CG sing N N 359 TRP CB HB2 sing N N 360 TRP CB HB3 sing N N 361 TRP CG CD1 doub Y N 362 TRP CG CD2 sing Y N 363 TRP CD1 NE1 sing Y N 364 TRP CD1 HD1 sing N N 365 TRP CD2 CE2 doub Y N 366 TRP CD2 CE3 sing Y N 367 TRP NE1 CE2 sing Y N 368 TRP NE1 HE1 sing N N 369 TRP CE2 CZ2 sing Y N 370 TRP CE3 CZ3 doub Y N 371 TRP CE3 HE3 sing N N 372 TRP CZ2 CH2 doub Y N 373 TRP CZ2 HZ2 sing N N 374 TRP CZ3 CH2 sing Y N 375 TRP CZ3 HZ3 sing N N 376 TRP CH2 HH2 sing N N 377 TRP OXT HXT sing N N 378 TYR N CA sing N N 379 TYR N H sing N N 380 TYR N H2 sing N N 381 TYR CA C sing N N 382 TYR CA CB sing N N 383 TYR CA HA sing N N 384 TYR C O doub N N 385 TYR C OXT sing N N 386 TYR CB CG sing N N 387 TYR CB HB2 sing N N 388 TYR CB HB3 sing N N 389 TYR CG CD1 doub Y N 390 TYR CG CD2 sing Y N 391 TYR CD1 CE1 sing Y N 392 TYR CD1 HD1 sing N N 393 TYR CD2 CE2 doub Y N 394 TYR CD2 HD2 sing N N 395 TYR CE1 CZ doub Y N 396 TYR CE1 HE1 sing N N 397 TYR CE2 CZ sing Y N 398 TYR CE2 HE2 sing N N 399 TYR CZ OH sing N N 400 TYR OH HH sing N N 401 TYR OXT HXT sing N N 402 VAL N CA sing N N 403 VAL N H sing N N 404 VAL N H2 sing N N 405 VAL CA C sing N N 406 VAL CA CB sing N N 407 VAL CA HA sing N N 408 VAL C O doub N N 409 VAL C OXT sing N N 410 VAL CB CG1 sing N N 411 VAL CB CG2 sing N N 412 VAL CB HB sing N N 413 VAL CG1 HG11 sing N N 414 VAL CG1 HG12 sing N N 415 VAL CG1 HG13 sing N N 416 VAL CG2 HG21 sing N N 417 VAL CG2 HG22 sing N N 418 VAL CG2 HG23 sing N N 419 VAL OXT HXT sing N N 420 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2RCN _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6H4D _atom_sites.fract_transf_matrix[1][1] 0.006830 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006830 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006830 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O P S ZN # loop_