data_6H4D
# 
_entry.id   6H4D 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6H4D         pdb_00006h4d 10.2210/pdb6h4d/pdb 
WWPDB D_1200011002 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-06-26 
2 'Structure model' 1 1 2020-01-15 
3 'Structure model' 1 2 2024-01-17 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Database references'    
4 3 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                      
2 2 'Structure model' citation_author               
3 3 'Structure model' chem_comp_atom                
4 3 'Structure model' chem_comp_bond                
5 3 'Structure model' database_2                    
6 3 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                   
2  2 'Structure model' '_citation.journal_abbrev'            
3  2 'Structure model' '_citation.journal_id_CSD'            
4  2 'Structure model' '_citation.journal_id_ISSN'           
5  2 'Structure model' '_citation.journal_volume'            
6  2 'Structure model' '_citation.page_first'                
7  2 'Structure model' '_citation.page_last'                 
8  2 'Structure model' '_citation.pdbx_database_id_DOI'      
9  2 'Structure model' '_citation.pdbx_database_id_PubMed'   
10 2 'Structure model' '_citation.title'                     
11 2 'Structure model' '_citation.year'                      
12 3 'Structure model' '_database_2.pdbx_DOI'                
13 3 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6H4D 
_pdbx_database_status.recvd_initial_deposition_date   2018-07-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Rocchio, S.'                1 ? 
'Santorelli, D.'             2 ? 
'Travaglini-Allocatelli, C.' 3 ? 
'Federici, L.'               4 ? 
'Di Matteo, A.'              5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Febs J.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1742-464X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            286 
_citation.language                  ? 
_citation.page_first                4245 
_citation.page_last                 4260 
_citation.title                     
'Structural and functional investigation of the Small Ribosomal Subunit Biogenesis GTPase A (RsgA) from Pseudomonas aeruginosa.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1111/febs.14959 
_citation.pdbx_database_id_PubMed   31199072 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rocchio, S.'                1 ? 
primary 'Santorelli, D.'             2 ? 
primary 'Rinaldo, S.'                3 ? 
primary 'Franceschini, M.'           4 ? 
primary 'Malatesta, F.'              5 ? 
primary 'Imperi, F.'                 6 ? 
primary 'Federici, L.'               7 ? 
primary 'Travaglini-Allocatelli, C.' 8 ? 
primary 'Di Matteo, A.'              9 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Small ribosomal subunit biogenesis GTPase RsgA' 37129.172 1  3.6.1.- ? ? ? 
2 non-polymer nat 'ZINC ION'                                       65.409    1  ?       ? ? ? 
3 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"                       443.201   1  ?       ? ? ? 
4 water       nat water                                            18.015    29 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAKRHLTRRQSWRIEKIQEERAARAARRESRAVEELEGGDLGPEQTGQVIAHFGVQVEVESADGQVSRCHLRANLPALVT
GDQVVWRAGNQGIGVIVAQLPRRSELCRPDMRGLLKPVAANVDRIVIVFAPRPEPHANLIDRYLIAAEHAGIQPLLLLNK
ADLVDESNAEGIDALLNVYRTLGYPLIEVSAFNGLAMDELRGALDGHVSVFVGQSGVGKSSLVNALLPGVDTRVGDLSTV
TGKGTHTTTTARLFHFPGGGDLIDSPGIREFGLGHVSRDDVEAGFIEFRDLLGHCRFRDCKHDREPGCALLQALEDGRIM
PQRMASYRHILASMPETDY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAKRHLTRRQSWRIEKIQEERAARAARRESRAVEELEGGDLGPEQTGQVIAHFGVQVEVESADGQVSRCHLRANLPALVT
GDQVVWRAGNQGIGVIVAQLPRRSELCRPDMRGLLKPVAANVDRIVIVFAPRPEPHANLIDRYLIAAEHAGIQPLLLLNK
ADLVDESNAEGIDALLNVYRTLGYPLIEVSAFNGLAMDELRGALDGHVSVFVGQSGVGKSSLVNALLPGVDTRVGDLSTV
TGKGTHTTTTARLFHFPGGGDLIDSPGIREFGLGHVSRDDVEAGFIEFRDLLGHCRFRDCKHDREPGCALLQALEDGRIM
PQRMASYRHILASMPETDY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                 ZN  
3 "GUANOSINE-5'-DIPHOSPHATE" GDP 
4 water                      HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   LYS n 
1 4   ARG n 
1 5   HIS n 
1 6   LEU n 
1 7   THR n 
1 8   ARG n 
1 9   ARG n 
1 10  GLN n 
1 11  SER n 
1 12  TRP n 
1 13  ARG n 
1 14  ILE n 
1 15  GLU n 
1 16  LYS n 
1 17  ILE n 
1 18  GLN n 
1 19  GLU n 
1 20  GLU n 
1 21  ARG n 
1 22  ALA n 
1 23  ALA n 
1 24  ARG n 
1 25  ALA n 
1 26  ALA n 
1 27  ARG n 
1 28  ARG n 
1 29  GLU n 
1 30  SER n 
1 31  ARG n 
1 32  ALA n 
1 33  VAL n 
1 34  GLU n 
1 35  GLU n 
1 36  LEU n 
1 37  GLU n 
1 38  GLY n 
1 39  GLY n 
1 40  ASP n 
1 41  LEU n 
1 42  GLY n 
1 43  PRO n 
1 44  GLU n 
1 45  GLN n 
1 46  THR n 
1 47  GLY n 
1 48  GLN n 
1 49  VAL n 
1 50  ILE n 
1 51  ALA n 
1 52  HIS n 
1 53  PHE n 
1 54  GLY n 
1 55  VAL n 
1 56  GLN n 
1 57  VAL n 
1 58  GLU n 
1 59  VAL n 
1 60  GLU n 
1 61  SER n 
1 62  ALA n 
1 63  ASP n 
1 64  GLY n 
1 65  GLN n 
1 66  VAL n 
1 67  SER n 
1 68  ARG n 
1 69  CYS n 
1 70  HIS n 
1 71  LEU n 
1 72  ARG n 
1 73  ALA n 
1 74  ASN n 
1 75  LEU n 
1 76  PRO n 
1 77  ALA n 
1 78  LEU n 
1 79  VAL n 
1 80  THR n 
1 81  GLY n 
1 82  ASP n 
1 83  GLN n 
1 84  VAL n 
1 85  VAL n 
1 86  TRP n 
1 87  ARG n 
1 88  ALA n 
1 89  GLY n 
1 90  ASN n 
1 91  GLN n 
1 92  GLY n 
1 93  ILE n 
1 94  GLY n 
1 95  VAL n 
1 96  ILE n 
1 97  VAL n 
1 98  ALA n 
1 99  GLN n 
1 100 LEU n 
1 101 PRO n 
1 102 ARG n 
1 103 ARG n 
1 104 SER n 
1 105 GLU n 
1 106 LEU n 
1 107 CYS n 
1 108 ARG n 
1 109 PRO n 
1 110 ASP n 
1 111 MET n 
1 112 ARG n 
1 113 GLY n 
1 114 LEU n 
1 115 LEU n 
1 116 LYS n 
1 117 PRO n 
1 118 VAL n 
1 119 ALA n 
1 120 ALA n 
1 121 ASN n 
1 122 VAL n 
1 123 ASP n 
1 124 ARG n 
1 125 ILE n 
1 126 VAL n 
1 127 ILE n 
1 128 VAL n 
1 129 PHE n 
1 130 ALA n 
1 131 PRO n 
1 132 ARG n 
1 133 PRO n 
1 134 GLU n 
1 135 PRO n 
1 136 HIS n 
1 137 ALA n 
1 138 ASN n 
1 139 LEU n 
1 140 ILE n 
1 141 ASP n 
1 142 ARG n 
1 143 TYR n 
1 144 LEU n 
1 145 ILE n 
1 146 ALA n 
1 147 ALA n 
1 148 GLU n 
1 149 HIS n 
1 150 ALA n 
1 151 GLY n 
1 152 ILE n 
1 153 GLN n 
1 154 PRO n 
1 155 LEU n 
1 156 LEU n 
1 157 LEU n 
1 158 LEU n 
1 159 ASN n 
1 160 LYS n 
1 161 ALA n 
1 162 ASP n 
1 163 LEU n 
1 164 VAL n 
1 165 ASP n 
1 166 GLU n 
1 167 SER n 
1 168 ASN n 
1 169 ALA n 
1 170 GLU n 
1 171 GLY n 
1 172 ILE n 
1 173 ASP n 
1 174 ALA n 
1 175 LEU n 
1 176 LEU n 
1 177 ASN n 
1 178 VAL n 
1 179 TYR n 
1 180 ARG n 
1 181 THR n 
1 182 LEU n 
1 183 GLY n 
1 184 TYR n 
1 185 PRO n 
1 186 LEU n 
1 187 ILE n 
1 188 GLU n 
1 189 VAL n 
1 190 SER n 
1 191 ALA n 
1 192 PHE n 
1 193 ASN n 
1 194 GLY n 
1 195 LEU n 
1 196 ALA n 
1 197 MET n 
1 198 ASP n 
1 199 GLU n 
1 200 LEU n 
1 201 ARG n 
1 202 GLY n 
1 203 ALA n 
1 204 LEU n 
1 205 ASP n 
1 206 GLY n 
1 207 HIS n 
1 208 VAL n 
1 209 SER n 
1 210 VAL n 
1 211 PHE n 
1 212 VAL n 
1 213 GLY n 
1 214 GLN n 
1 215 SER n 
1 216 GLY n 
1 217 VAL n 
1 218 GLY n 
1 219 LYS n 
1 220 SER n 
1 221 SER n 
1 222 LEU n 
1 223 VAL n 
1 224 ASN n 
1 225 ALA n 
1 226 LEU n 
1 227 LEU n 
1 228 PRO n 
1 229 GLY n 
1 230 VAL n 
1 231 ASP n 
1 232 THR n 
1 233 ARG n 
1 234 VAL n 
1 235 GLY n 
1 236 ASP n 
1 237 LEU n 
1 238 SER n 
1 239 THR n 
1 240 VAL n 
1 241 THR n 
1 242 GLY n 
1 243 LYS n 
1 244 GLY n 
1 245 THR n 
1 246 HIS n 
1 247 THR n 
1 248 THR n 
1 249 THR n 
1 250 THR n 
1 251 ALA n 
1 252 ARG n 
1 253 LEU n 
1 254 PHE n 
1 255 HIS n 
1 256 PHE n 
1 257 PRO n 
1 258 GLY n 
1 259 GLY n 
1 260 GLY n 
1 261 ASP n 
1 262 LEU n 
1 263 ILE n 
1 264 ASP n 
1 265 SER n 
1 266 PRO n 
1 267 GLY n 
1 268 ILE n 
1 269 ARG n 
1 270 GLU n 
1 271 PHE n 
1 272 GLY n 
1 273 LEU n 
1 274 GLY n 
1 275 HIS n 
1 276 VAL n 
1 277 SER n 
1 278 ARG n 
1 279 ASP n 
1 280 ASP n 
1 281 VAL n 
1 282 GLU n 
1 283 ALA n 
1 284 GLY n 
1 285 PHE n 
1 286 ILE n 
1 287 GLU n 
1 288 PHE n 
1 289 ARG n 
1 290 ASP n 
1 291 LEU n 
1 292 LEU n 
1 293 GLY n 
1 294 HIS n 
1 295 CYS n 
1 296 ARG n 
1 297 PHE n 
1 298 ARG n 
1 299 ASP n 
1 300 CYS n 
1 301 LYS n 
1 302 HIS n 
1 303 ASP n 
1 304 ARG n 
1 305 GLU n 
1 306 PRO n 
1 307 GLY n 
1 308 CYS n 
1 309 ALA n 
1 310 LEU n 
1 311 LEU n 
1 312 GLN n 
1 313 ALA n 
1 314 LEU n 
1 315 GLU n 
1 316 ASP n 
1 317 GLY n 
1 318 ARG n 
1 319 ILE n 
1 320 MET n 
1 321 PRO n 
1 322 GLN n 
1 323 ARG n 
1 324 MET n 
1 325 ALA n 
1 326 SER n 
1 327 TYR n 
1 328 ARG n 
1 329 HIS n 
1 330 ILE n 
1 331 LEU n 
1 332 ALA n 
1 333 SER n 
1 334 MET n 
1 335 PRO n 
1 336 GLU n 
1 337 THR n 
1 338 ASP n 
1 339 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   339 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'rsgA, PA4952' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pseudomonas aeruginosa PAO1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     208964 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                 ? 'Zn 2'              65.409  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   LYS 3   3   ?   ?   ?   A . n 
A 1 4   ARG 4   4   ?   ?   ?   A . n 
A 1 5   HIS 5   5   ?   ?   ?   A . n 
A 1 6   LEU 6   6   ?   ?   ?   A . n 
A 1 7   THR 7   7   ?   ?   ?   A . n 
A 1 8   ARG 8   8   ?   ?   ?   A . n 
A 1 9   ARG 9   9   ?   ?   ?   A . n 
A 1 10  GLN 10  10  ?   ?   ?   A . n 
A 1 11  SER 11  11  ?   ?   ?   A . n 
A 1 12  TRP 12  12  ?   ?   ?   A . n 
A 1 13  ARG 13  13  ?   ?   ?   A . n 
A 1 14  ILE 14  14  ?   ?   ?   A . n 
A 1 15  GLU 15  15  ?   ?   ?   A . n 
A 1 16  LYS 16  16  ?   ?   ?   A . n 
A 1 17  ILE 17  17  ?   ?   ?   A . n 
A 1 18  GLN 18  18  ?   ?   ?   A . n 
A 1 19  GLU 19  19  ?   ?   ?   A . n 
A 1 20  GLU 20  20  ?   ?   ?   A . n 
A 1 21  ARG 21  21  ?   ?   ?   A . n 
A 1 22  ALA 22  22  ?   ?   ?   A . n 
A 1 23  ALA 23  23  ?   ?   ?   A . n 
A 1 24  ARG 24  24  ?   ?   ?   A . n 
A 1 25  ALA 25  25  ?   ?   ?   A . n 
A 1 26  ALA 26  26  ?   ?   ?   A . n 
A 1 27  ARG 27  27  ?   ?   ?   A . n 
A 1 28  ARG 28  28  ?   ?   ?   A . n 
A 1 29  GLU 29  29  ?   ?   ?   A . n 
A 1 30  SER 30  30  ?   ?   ?   A . n 
A 1 31  ARG 31  31  ?   ?   ?   A . n 
A 1 32  ALA 32  32  ?   ?   ?   A . n 
A 1 33  VAL 33  33  ?   ?   ?   A . n 
A 1 34  GLU 34  34  ?   ?   ?   A . n 
A 1 35  GLU 35  35  ?   ?   ?   A . n 
A 1 36  LEU 36  36  ?   ?   ?   A . n 
A 1 37  GLU 37  37  ?   ?   ?   A . n 
A 1 38  GLY 38  38  ?   ?   ?   A . n 
A 1 39  GLY 39  39  ?   ?   ?   A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  GLN 45  45  45  GLN GLN A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  HIS 52  52  52  HIS HIS A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  GLN 56  56  56  GLN GLN A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  ASP 63  63  63  ASP ALA A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  ARG 68  68  68  ARG ARG A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  HIS 70  70  70  HIS HIS A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  THR 80  80  80  THR THR A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  GLN 83  83  83  GLN GLN A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  ASN 90  90  ?   ?   ?   A . n 
A 1 91  GLN 91  91  ?   ?   ?   A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 SER 104 104 104 SER SER A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 PRO 109 109 109 PRO PRO A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 MET 111 111 111 MET MET A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 LYS 116 116 116 LYS LYS A . n 
A 1 117 PRO 117 117 117 PRO PRO A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 ASN 121 121 121 ASN ASN A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 ARG 124 124 124 ARG ARG A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 ARG 132 132 132 ARG ARG A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 PRO 135 135 135 PRO PRO A . n 
A 1 136 HIS 136 136 136 HIS HIS A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 ASN 138 138 138 ASN ASN A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 ILE 145 145 145 ILE ILE A . n 
A 1 146 ALA 146 146 146 ALA ALA A . n 
A 1 147 ALA 147 147 147 ALA ALA A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 HIS 149 149 149 HIS HIS A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 GLN 153 153 153 GLN GLN A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 LEU 155 155 155 LEU LEU A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 ASP 162 162 162 ASP ASP A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 SER 167 167 167 SER SER A . n 
A 1 168 ASN 168 168 168 ASN ASN A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 ASN 177 177 177 ASN ASN A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 TYR 179 179 179 TYR TYR A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 THR 181 181 181 THR THR A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 GLY 183 183 183 GLY GLY A . n 
A 1 184 TYR 184 184 184 TYR TYR A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 PHE 192 192 192 PHE PHE A . n 
A 1 193 ASN 193 193 193 ASN ASN A . n 
A 1 194 GLY 194 194 194 GLY GLY A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 MET 197 197 197 MET MET A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 ARG 201 201 201 ARG ARG A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 LEU 204 204 204 LEU LEU A . n 
A 1 205 ASP 205 205 205 ASP ASP A . n 
A 1 206 GLY 206 206 206 GLY GLY A . n 
A 1 207 HIS 207 207 207 HIS HIS A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 SER 209 209 209 SER SER A . n 
A 1 210 VAL 210 210 210 VAL VAL A . n 
A 1 211 PHE 211 211 211 PHE PHE A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 GLN 214 214 214 GLN GLN A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 VAL 217 217 217 VAL VAL A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 SER 221 221 221 SER SER A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 ASN 224 224 224 ASN ASN A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 PRO 228 228 228 PRO PRO A . n 
A 1 229 GLY 229 229 229 GLY GLY A . n 
A 1 230 VAL 230 230 ?   ?   ?   A . n 
A 1 231 ASP 231 231 ?   ?   ?   A . n 
A 1 232 THR 232 232 ?   ?   ?   A . n 
A 1 233 ARG 233 233 ?   ?   ?   A . n 
A 1 234 VAL 234 234 ?   ?   ?   A . n 
A 1 235 GLY 235 235 ?   ?   ?   A . n 
A 1 236 ASP 236 236 ?   ?   ?   A . n 
A 1 237 LEU 237 237 ?   ?   ?   A . n 
A 1 238 SER 238 238 ?   ?   ?   A . n 
A 1 239 THR 239 239 ?   ?   ?   A . n 
A 1 240 VAL 240 240 ?   ?   ?   A . n 
A 1 241 THR 241 241 ?   ?   ?   A . n 
A 1 242 GLY 242 242 ?   ?   ?   A . n 
A 1 243 LYS 243 243 ?   ?   ?   A . n 
A 1 244 GLY 244 244 ?   ?   ?   A . n 
A 1 245 THR 245 245 ?   ?   ?   A . n 
A 1 246 HIS 246 246 ?   ?   ?   A . n 
A 1 247 THR 247 247 ?   ?   ?   A . n 
A 1 248 THR 248 248 ?   ?   ?   A . n 
A 1 249 THR 249 249 ?   ?   ?   A . n 
A 1 250 THR 250 250 250 THR THR A . n 
A 1 251 ALA 251 251 251 ALA ALA A . n 
A 1 252 ARG 252 252 252 ARG ARG A . n 
A 1 253 LEU 253 253 253 LEU LEU A . n 
A 1 254 PHE 254 254 254 PHE PHE A . n 
A 1 255 HIS 255 255 255 HIS HIS A . n 
A 1 256 PHE 256 256 256 PHE PHE A . n 
A 1 257 PRO 257 257 257 PRO PRO A . n 
A 1 258 GLY 258 258 258 GLY GLY A . n 
A 1 259 GLY 259 259 259 GLY GLY A . n 
A 1 260 GLY 260 260 260 GLY GLY A . n 
A 1 261 ASP 261 261 261 ASP ASP A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 ASP 264 264 264 ASP ASP A . n 
A 1 265 SER 265 265 265 SER SER A . n 
A 1 266 PRO 266 266 266 PRO PRO A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 ILE 268 268 268 ILE ILE A . n 
A 1 269 ARG 269 269 269 ARG ARG A . n 
A 1 270 GLU 270 270 270 GLU GLU A . n 
A 1 271 PHE 271 271 271 PHE PHE A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 HIS 275 275 275 HIS HIS A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 SER 277 277 277 SER SER A . n 
A 1 278 ARG 278 278 278 ARG ARG A . n 
A 1 279 ASP 279 279 279 ASP ASP A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 GLU 282 282 282 GLU GLU A . n 
A 1 283 ALA 283 283 283 ALA ALA A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 PHE 285 285 285 PHE PHE A . n 
A 1 286 ILE 286 286 286 ILE ILE A . n 
A 1 287 GLU 287 287 287 GLU GLU A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 ASP 290 290 290 ASP ASP A . n 
A 1 291 LEU 291 291 291 LEU LEU A . n 
A 1 292 LEU 292 292 292 LEU LEU A . n 
A 1 293 GLY 293 293 293 GLY GLY A . n 
A 1 294 HIS 294 294 294 HIS HIS A . n 
A 1 295 CYS 295 295 295 CYS CYS A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 ARG 298 298 298 ARG ALA A . n 
A 1 299 ASP 299 299 299 ASP ASP A . n 
A 1 300 CYS 300 300 300 CYS CYS A . n 
A 1 301 LYS 301 301 301 LYS LYS A . n 
A 1 302 HIS 302 302 302 HIS HIS A . n 
A 1 303 ASP 303 303 303 ASP ASP A . n 
A 1 304 ARG 304 304 304 ARG ARG A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 PRO 306 306 306 PRO PRO A . n 
A 1 307 GLY 307 307 307 GLY GLY A . n 
A 1 308 CYS 308 308 308 CYS CYS A . n 
A 1 309 ALA 309 309 309 ALA ALA A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 GLN 312 312 312 GLN GLN A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 LEU 314 314 314 LEU LEU A . n 
A 1 315 GLU 315 315 315 GLU GLU A . n 
A 1 316 ASP 316 316 316 ASP ASP A . n 
A 1 317 GLY 317 317 317 GLY GLY A . n 
A 1 318 ARG 318 318 318 ARG ARG A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 MET 320 320 320 MET MET A . n 
A 1 321 PRO 321 321 321 PRO PRO A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ARG 323 323 323 ARG ARG A . n 
A 1 324 MET 324 324 324 MET MET A . n 
A 1 325 ALA 325 325 325 ALA ALA A . n 
A 1 326 SER 326 326 326 SER SER A . n 
A 1 327 TYR 327 327 327 TYR TYR A . n 
A 1 328 ARG 328 328 328 ARG ARG A . n 
A 1 329 HIS 329 329 329 HIS HIS A . n 
A 1 330 ILE 330 330 330 ILE ILE A . n 
A 1 331 LEU 331 331 331 LEU LEU A . n 
A 1 332 ALA 332 332 332 ALA ALA A . n 
A 1 333 SER 333 333 333 SER SER A . n 
A 1 334 MET 334 334 334 MET MET A . n 
A 1 335 PRO 335 335 335 PRO PRO A . n 
A 1 336 GLU 336 336 ?   ?   ?   A . n 
A 1 337 THR 337 337 ?   ?   ?   A . n 
A 1 338 ASP 338 338 ?   ?   ?   A . n 
A 1 339 TYR 339 339 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1  401 350 ZN  ZN  A . 
C 3 GDP 1  402 600 GDP GDP A . 
D 4 HOH 1  501 48  HOH HOH A . 
D 4 HOH 2  502 54  HOH HOH A . 
D 4 HOH 3  503 52  HOH HOH A . 
D 4 HOH 4  504 28  HOH HOH A . 
D 4 HOH 5  505 8   HOH HOH A . 
D 4 HOH 6  506 55  HOH HOH A . 
D 4 HOH 7  507 25  HOH HOH A . 
D 4 HOH 8  508 49  HOH HOH A . 
D 4 HOH 9  509 51  HOH HOH A . 
D 4 HOH 10 510 44  HOH HOH A . 
D 4 HOH 11 511 47  HOH HOH A . 
D 4 HOH 12 512 21  HOH HOH A . 
D 4 HOH 13 513 23  HOH HOH A . 
D 4 HOH 14 514 57  HOH HOH A . 
D 4 HOH 15 515 30  HOH HOH A . 
D 4 HOH 16 516 53  HOH HOH A . 
D 4 HOH 17 517 37  HOH HOH A . 
D 4 HOH 18 518 38  HOH HOH A . 
D 4 HOH 19 519 39  HOH HOH A . 
D 4 HOH 20 520 16  HOH HOH A . 
D 4 HOH 21 521 41  HOH HOH A . 
D 4 HOH 22 522 26  HOH HOH A . 
D 4 HOH 23 523 35  HOH HOH A . 
D 4 HOH 24 524 29  HOH HOH A . 
D 4 HOH 25 525 34  HOH HOH A . 
D 4 HOH 26 526 22  HOH HOH A . 
D 4 HOH 27 527 56  HOH HOH A . 
D 4 HOH 28 528 14  HOH HOH A . 
D 4 HOH 29 529 43  HOH HOH A . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ASP 63  ? CG  ? A ASP 63  CG  
2 1 Y 1 A ASP 63  ? OD1 ? A ASP 63  OD1 
3 1 Y 1 A ASP 63  ? OD2 ? A ASP 63  OD2 
4 1 Y 1 A ARG 298 ? CG  ? A ARG 298 CG  
5 1 Y 1 A ARG 298 ? CD  ? A ARG 298 CD  
6 1 Y 1 A ARG 298 ? NE  ? A ARG 298 NE  
7 1 Y 1 A ARG 298 ? CZ  ? A ARG 298 CZ  
8 1 Y 1 A ARG 298 ? NH1 ? A ARG 298 NH1 
9 1 Y 1 A ARG 298 ? NH2 ? A ARG 298 NH2 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? 1.9_1692 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6H4D 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     146.405 
_cell.length_a_esd                 ? 
_cell.length_b                     146.405 
_cell.length_b_esd                 ? 
_cell.length_c                     146.405 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        24 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6H4D 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                213 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 41 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6H4D 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.52 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         65.07 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'30% Polyacrylic acid 5100 sodium salt, 0.1 M Hepes pH 7.5, 5% PEG 200, 0.02 M Magnesium chloride' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-10-11 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ELETTRA BEAMLINE 5.2R' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   5.2R 
_diffrn_source.pdbx_synchrotron_site       ELETTRA 
# 
_reflns.B_iso_Wilson_estimate            86.140 
_reflns.entry_id                         6H4D 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.900 
_reflns.d_resolution_low                 48.800 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       12464 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  17.200 
_reflns.pdbx_Rmerge_I_obs                0.110 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            20.400 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             1 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.114 
_reflns.pdbx_Rpim_I_all                  0.027 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         214545 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.900 3.080  ? ? 35649 ? ? ? 1955 100.000 ? ? ? ? 1.395 ? ? ? ? ? ? ? ? 18.200 ? ? ? 2.500  1.435 0.334 ? 1 1 0.750 ? 
8.700 48.800 ? ? 8595  ? ? ? 553  99.600  ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 15.500 ? ? ? 60.000 0.047 0.012 ? 2 1 0.999 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                186.780 
_refine.B_iso_mean                               88.6613 
_refine.B_iso_min                                39.540 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6H4D 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.9000 
_refine.ls_d_res_low                             46.2970 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     12411 
_refine.ls_number_reflns_R_free                  646 
_refine.ls_number_reflns_R_work                  11765 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.8500 
_refine.ls_percent_reflns_R_free                 5.2100 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2500 
_refine.ls_R_factor_R_free                       0.2865 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2480 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2rcn 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.2400 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4600 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.9000 
_refine_hist.d_res_low                        46.2970 
_refine_hist.pdbx_number_atoms_ligand         29 
_refine_hist.number_atoms_solvent             32 
_refine_hist.number_atoms_total               2137 
_refine_hist.pdbx_number_residues_total       274 
_refine_hist.pdbx_B_iso_mean_ligand           75.31 
_refine_hist.pdbx_B_iso_mean_solvent          78.83 
_refine_hist.pdbx_number_atoms_protein        2076 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  ? 2145 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.974  ? 2913 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.039  ? 326  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 385  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 15.501 ? 791  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.9004 3.1243  2418 . 126 2292 100.0000 . . . 0.3882 0.0000 0.3112 . . . . . . 5 . . . 
'X-RAY DIFFRACTION' 3.1243 3.4386  2420 . 136 2284 100.0000 . . . 0.3668 0.0000 0.2814 . . . . . . 5 . . . 
'X-RAY DIFFRACTION' 3.4386 3.9359  2441 . 124 2317 100.0000 . . . 0.3421 0.0000 0.2605 . . . . . . 5 . . . 
'X-RAY DIFFRACTION' 3.9359 4.9580  2487 . 130 2357 100.0000 . . . 0.2817 0.0000 0.2240 . . . . . . 5 . . . 
'X-RAY DIFFRACTION' 4.9580 46.3032 2645 . 130 2515 100.0000 . . . 0.2379 0.0000 0.2416 . . . . . . 5 . . . 
# 
_struct.entry_id                     6H4D 
_struct.title                        'Crystal structure of RsgA from Pseudomonas aeruginosa' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6H4D 
_struct_keywords.text            'CpGTPase, Ribosome maturation factor, YjeQ, RNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RSGA_PSEAE 
_struct_ref.pdbx_db_accession          Q9HUL3 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAKRHLTRRQSWRIEKIQEERAARAARRESRAVEELEGGDLGPEQTGQVIAHFGVQVEVESADGQVSRCHLRANLPALVT
GDQVVWRAGNQGIGVIVAQLPRRSELCRPDMRGLLKPVAANVDRIVIVFAPRPEPHANLIDRYLIAAEHAGIQPLLLLNK
ADLVDESNAEGIDALLNVYRTLGYPLIEVSAFNGLAMDELRGALDGHVSVFVGQSGVGKSSLVNALLPGVDTRVGDLSTV
TGKGTHTTTTARLFHFPGGGDLIDSPGIREFGLGHVSRDDVEAGFIEFRDLLGHCRFRDCKHDREPGCALLQALEDGRIM
PQRMASYRHILASMPETDY
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6H4D 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 339 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9HUL3 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  339 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       339 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 590   ? 
1 MORE         -4    ? 
1 'SSA (A^2)'  13950 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 HIS A 136 ? ALA A 150 ? HIS A 136 ALA A 150 1 ? 15 
HELX_P HELX_P2  AA2 LYS A 160 ? VAL A 164 ? LYS A 160 VAL A 164 5 ? 5  
HELX_P HELX_P3  AA3 ASP A 165 ? THR A 181 ? ASP A 165 THR A 181 1 ? 17 
HELX_P HELX_P4  AA4 ALA A 196 ? ASP A 205 ? ALA A 196 ASP A 205 1 ? 10 
HELX_P HELX_P5  AA5 GLY A 218 ? LEU A 227 ? GLY A 218 LEU A 227 1 ? 10 
HELX_P HELX_P6  AA6 SER A 265 ? GLU A 270 ? SER A 265 GLU A 270 1 ? 6  
HELX_P HELX_P7  AA7 SER A 277 ? GLY A 284 ? SER A 277 GLY A 284 1 ? 8  
HELX_P HELX_P8  AA8 PHE A 285 ? LEU A 292 ? PHE A 285 LEU A 292 1 ? 8  
HELX_P HELX_P9  AA9 CYS A 308 ? GLY A 317 ? CYS A 308 GLY A 317 1 ? 10 
HELX_P HELX_P10 AB1 MET A 320 ? ALA A 332 ? MET A 320 ALA A 332 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 295 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 295 A ZN 401 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc2 metalc ? ? A CYS 300 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 300 A ZN 401 1_555 ? ? ? ? ? ? ? 2.411 ? ? 
metalc3 metalc ? ? A HIS 302 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 302 A ZN 401 1_555 ? ? ? ? ? ? ? 2.121 ? ? 
metalc4 metalc ? ? A CYS 308 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 308 A ZN 401 1_555 ? ? ? ? ? ? ? 2.467 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG  ? A CYS 295 ? A CYS 295 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 300 ? A CYS 300 ? 1_555 108.0 ? 
2 SG  ? A CYS 295 ? A CYS 295 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 302 ? A HIS 302 ? 1_555 116.0 ? 
3 SG  ? A CYS 300 ? A CYS 300 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 302 ? A HIS 302 ? 1_555 102.2 ? 
4 SG  ? A CYS 295 ? A CYS 295 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 308 ? A CYS 308 ? 1_555 112.2 ? 
5 SG  ? A CYS 300 ? A CYS 300 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 308 ? A CYS 308 ? 1_555 106.2 ? 
6 ND1 ? A HIS 302 ? A HIS 302 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 308 ? A CYS 308 ? 1_555 111.2 ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ARG 
_struct_mon_prot_cis.label_seq_id           132 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ARG 
_struct_mon_prot_cis.auth_seq_id            132 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    133 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     133 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.16 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 2 ? 
AA3 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA3 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLU A 44  ? PHE A 53  ? GLU A 44  PHE A 53  
AA1 2 GLN A 56  ? SER A 61  ? GLN A 56  SER A 61  
AA1 3 VAL A 66  ? LEU A 71  ? VAL A 66  LEU A 71  
AA1 4 ILE A 93  ? GLN A 99  ? ILE A 93  GLN A 99  
AA1 5 GLN A 83  ? ARG A 87  ? GLN A 83  ARG A 87  
AA1 6 GLU A 44  ? PHE A 53  ? GLU A 44  PHE A 53  
AA2 1 GLU A 105 ? PRO A 109 ? GLU A 105 PRO A 109 
AA2 2 LEU A 115 ? ALA A 120 ? LEU A 115 ALA A 120 
AA3 1 LEU A 186 ? GLU A 188 ? LEU A 186 GLU A 188 
AA3 2 GLN A 153 ? LEU A 158 ? GLN A 153 LEU A 158 
AA3 3 ARG A 124 ? PHE A 129 ? ARG A 124 PHE A 129 
AA3 4 VAL A 208 ? VAL A 212 ? VAL A 208 VAL A 212 
AA3 5 ASP A 261 ? ASP A 264 ? ASP A 261 ASP A 264 
AA3 6 ARG A 252 ? HIS A 255 ? ARG A 252 HIS A 255 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 50  ? N ILE A 50  O GLU A 58  ? O GLU A 58  
AA1 2 3 N VAL A 59  ? N VAL A 59  O SER A 67  ? O SER A 67  
AA1 3 4 N ARG A 68  ? N ARG A 68  O GLY A 94  ? O GLY A 94  
AA1 4 5 O ALA A 98  ? O ALA A 98  N VAL A 85  ? N VAL A 85  
AA1 5 6 O VAL A 84  ? O VAL A 84  N GLY A 47  ? N GLY A 47  
AA2 1 2 N LEU A 106 ? N LEU A 106 O VAL A 118 ? O VAL A 118 
AA3 1 2 O ILE A 187 ? O ILE A 187 N LEU A 158 ? N LEU A 158 
AA3 2 3 O LEU A 157 ? O LEU A 157 N ILE A 127 ? N ILE A 127 
AA3 3 4 N VAL A 126 ? N VAL A 126 O VAL A 210 ? O VAL A 210 
AA3 4 5 N SER A 209 ? N SER A 209 O ASP A 261 ? O ASP A 261 
AA3 5 6 O LEU A 262 ? O LEU A 262 N PHE A 254 ? N PHE A 254 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  401 ? 4  'binding site for residue ZN A 401'  
AC2 Software A GDP 402 ? 16 'binding site for residue GDP A 402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS A 295 ? CYS A 295 . ? 1_555 ? 
2  AC1 4  CYS A 300 ? CYS A 300 . ? 1_555 ? 
3  AC1 4  HIS A 302 ? HIS A 302 . ? 1_555 ? 
4  AC1 4  CYS A 308 ? CYS A 308 . ? 1_555 ? 
5  AC2 16 ASN A 159 ? ASN A 159 . ? 1_555 ? 
6  AC2 16 LYS A 160 ? LYS A 160 . ? 1_555 ? 
7  AC2 16 ASP A 162 ? ASP A 162 . ? 1_555 ? 
8  AC2 16 LEU A 163 ? LEU A 163 . ? 1_555 ? 
9  AC2 16 SER A 190 ? SER A 190 . ? 1_555 ? 
10 AC2 16 ALA A 191 ? ALA A 191 . ? 1_555 ? 
11 AC2 16 PHE A 192 ? PHE A 192 . ? 1_555 ? 
12 AC2 16 SER A 215 ? SER A 215 . ? 1_555 ? 
13 AC2 16 GLY A 216 ? GLY A 216 . ? 1_555 ? 
14 AC2 16 VAL A 217 ? VAL A 217 . ? 1_555 ? 
15 AC2 16 GLY A 218 ? GLY A 218 . ? 1_555 ? 
16 AC2 16 LYS A 219 ? LYS A 219 . ? 1_555 ? 
17 AC2 16 SER A 220 ? SER A 220 . ? 1_555 ? 
18 AC2 16 SER A 221 ? SER A 221 . ? 1_555 ? 
19 AC2 16 HIS A 255 ? HIS A 255 . ? 9_555 ? 
20 AC2 16 PRO A 257 ? PRO A 257 . ? 9_555 ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 53  ? ? -93.29  49.43  
2 1 PRO A 76  ? ? -56.34  172.86 
3 1 SER A 265 ? ? -172.13 147.27 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -14.3231 
_pdbx_refine_tls.origin_y         -15.5124 
_pdbx_refine_tls.origin_z         15.8311 
_pdbx_refine_tls.T[1][1]          0.5346 
_pdbx_refine_tls.T[2][2]          0.3845 
_pdbx_refine_tls.T[3][3]          0.5306 
_pdbx_refine_tls.T[1][2]          -0.0646 
_pdbx_refine_tls.T[1][3]          -0.0381 
_pdbx_refine_tls.T[2][3]          -0.0308 
_pdbx_refine_tls.L[1][1]          1.5484 
_pdbx_refine_tls.L[2][2]          2.3530 
_pdbx_refine_tls.L[3][3]          2.3690 
_pdbx_refine_tls.L[1][2]          -0.6272 
_pdbx_refine_tls.L[1][3]          -0.7351 
_pdbx_refine_tls.L[2][3]          0.2385 
_pdbx_refine_tls.S[1][1]          0.1349 
_pdbx_refine_tls.S[2][2]          -0.2055 
_pdbx_refine_tls.S[3][3]          0.0724 
_pdbx_refine_tls.S[1][2]          -0.0787 
_pdbx_refine_tls.S[1][3]          -0.2026 
_pdbx_refine_tls.S[2][3]          0.4681 
_pdbx_refine_tls.S[2][1]          -0.0583 
_pdbx_refine_tls.S[3][1]          0.0400 
_pdbx_refine_tls.S[3][2]          0.0182 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 40 A 600 all ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 Z 8  Z 57  all ? ? ? ? ? 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A LYS 3   ? A LYS 3   
4  1 Y 1 A ARG 4   ? A ARG 4   
5  1 Y 1 A HIS 5   ? A HIS 5   
6  1 Y 1 A LEU 6   ? A LEU 6   
7  1 Y 1 A THR 7   ? A THR 7   
8  1 Y 1 A ARG 8   ? A ARG 8   
9  1 Y 1 A ARG 9   ? A ARG 9   
10 1 Y 1 A GLN 10  ? A GLN 10  
11 1 Y 1 A SER 11  ? A SER 11  
12 1 Y 1 A TRP 12  ? A TRP 12  
13 1 Y 1 A ARG 13  ? A ARG 13  
14 1 Y 1 A ILE 14  ? A ILE 14  
15 1 Y 1 A GLU 15  ? A GLU 15  
16 1 Y 1 A LYS 16  ? A LYS 16  
17 1 Y 1 A ILE 17  ? A ILE 17  
18 1 Y 1 A GLN 18  ? A GLN 18  
19 1 Y 1 A GLU 19  ? A GLU 19  
20 1 Y 1 A GLU 20  ? A GLU 20  
21 1 Y 1 A ARG 21  ? A ARG 21  
22 1 Y 1 A ALA 22  ? A ALA 22  
23 1 Y 1 A ALA 23  ? A ALA 23  
24 1 Y 1 A ARG 24  ? A ARG 24  
25 1 Y 1 A ALA 25  ? A ALA 25  
26 1 Y 1 A ALA 26  ? A ALA 26  
27 1 Y 1 A ARG 27  ? A ARG 27  
28 1 Y 1 A ARG 28  ? A ARG 28  
29 1 Y 1 A GLU 29  ? A GLU 29  
30 1 Y 1 A SER 30  ? A SER 30  
31 1 Y 1 A ARG 31  ? A ARG 31  
32 1 Y 1 A ALA 32  ? A ALA 32  
33 1 Y 1 A VAL 33  ? A VAL 33  
34 1 Y 1 A GLU 34  ? A GLU 34  
35 1 Y 1 A GLU 35  ? A GLU 35  
36 1 Y 1 A LEU 36  ? A LEU 36  
37 1 Y 1 A GLU 37  ? A GLU 37  
38 1 Y 1 A GLY 38  ? A GLY 38  
39 1 Y 1 A GLY 39  ? A GLY 39  
40 1 Y 1 A ASN 90  ? A ASN 90  
41 1 Y 1 A GLN 91  ? A GLN 91  
42 1 Y 1 A VAL 230 ? A VAL 230 
43 1 Y 1 A ASP 231 ? A ASP 231 
44 1 Y 1 A THR 232 ? A THR 232 
45 1 Y 1 A ARG 233 ? A ARG 233 
46 1 Y 1 A VAL 234 ? A VAL 234 
47 1 Y 1 A GLY 235 ? A GLY 235 
48 1 Y 1 A ASP 236 ? A ASP 236 
49 1 Y 1 A LEU 237 ? A LEU 237 
50 1 Y 1 A SER 238 ? A SER 238 
51 1 Y 1 A THR 239 ? A THR 239 
52 1 Y 1 A VAL 240 ? A VAL 240 
53 1 Y 1 A THR 241 ? A THR 241 
54 1 Y 1 A GLY 242 ? A GLY 242 
55 1 Y 1 A LYS 243 ? A LYS 243 
56 1 Y 1 A GLY 244 ? A GLY 244 
57 1 Y 1 A THR 245 ? A THR 245 
58 1 Y 1 A HIS 246 ? A HIS 246 
59 1 Y 1 A THR 247 ? A THR 247 
60 1 Y 1 A THR 248 ? A THR 248 
61 1 Y 1 A THR 249 ? A THR 249 
62 1 Y 1 A GLU 336 ? A GLU 336 
63 1 Y 1 A THR 337 ? A THR 337 
64 1 Y 1 A ASP 338 ? A ASP 338 
65 1 Y 1 A TYR 339 ? A TYR 339 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N      N  N N 1   
ALA CA     C  N S 2   
ALA C      C  N N 3   
ALA O      O  N N 4   
ALA CB     C  N N 5   
ALA OXT    O  N N 6   
ALA H      H  N N 7   
ALA H2     H  N N 8   
ALA HA     H  N N 9   
ALA HB1    H  N N 10  
ALA HB2    H  N N 11  
ALA HB3    H  N N 12  
ALA HXT    H  N N 13  
ARG N      N  N N 14  
ARG CA     C  N S 15  
ARG C      C  N N 16  
ARG O      O  N N 17  
ARG CB     C  N N 18  
ARG CG     C  N N 19  
ARG CD     C  N N 20  
ARG NE     N  N N 21  
ARG CZ     C  N N 22  
ARG NH1    N  N N 23  
ARG NH2    N  N N 24  
ARG OXT    O  N N 25  
ARG H      H  N N 26  
ARG H2     H  N N 27  
ARG HA     H  N N 28  
ARG HB2    H  N N 29  
ARG HB3    H  N N 30  
ARG HG2    H  N N 31  
ARG HG3    H  N N 32  
ARG HD2    H  N N 33  
ARG HD3    H  N N 34  
ARG HE     H  N N 35  
ARG HH11   H  N N 36  
ARG HH12   H  N N 37  
ARG HH21   H  N N 38  
ARG HH22   H  N N 39  
ARG HXT    H  N N 40  
ASN N      N  N N 41  
ASN CA     C  N S 42  
ASN C      C  N N 43  
ASN O      O  N N 44  
ASN CB     C  N N 45  
ASN CG     C  N N 46  
ASN OD1    O  N N 47  
ASN ND2    N  N N 48  
ASN OXT    O  N N 49  
ASN H      H  N N 50  
ASN H2     H  N N 51  
ASN HA     H  N N 52  
ASN HB2    H  N N 53  
ASN HB3    H  N N 54  
ASN HD21   H  N N 55  
ASN HD22   H  N N 56  
ASN HXT    H  N N 57  
ASP N      N  N N 58  
ASP CA     C  N S 59  
ASP C      C  N N 60  
ASP O      O  N N 61  
ASP CB     C  N N 62  
ASP CG     C  N N 63  
ASP OD1    O  N N 64  
ASP OD2    O  N N 65  
ASP OXT    O  N N 66  
ASP H      H  N N 67  
ASP H2     H  N N 68  
ASP HA     H  N N 69  
ASP HB2    H  N N 70  
ASP HB3    H  N N 71  
ASP HD2    H  N N 72  
ASP HXT    H  N N 73  
CYS N      N  N N 74  
CYS CA     C  N R 75  
CYS C      C  N N 76  
CYS O      O  N N 77  
CYS CB     C  N N 78  
CYS SG     S  N N 79  
CYS OXT    O  N N 80  
CYS H      H  N N 81  
CYS H2     H  N N 82  
CYS HA     H  N N 83  
CYS HB2    H  N N 84  
CYS HB3    H  N N 85  
CYS HG     H  N N 86  
CYS HXT    H  N N 87  
GDP PB     P  N N 88  
GDP O1B    O  N N 89  
GDP O2B    O  N N 90  
GDP O3B    O  N N 91  
GDP O3A    O  N N 92  
GDP PA     P  N N 93  
GDP O1A    O  N N 94  
GDP O2A    O  N N 95  
GDP "O5'"  O  N N 96  
GDP "C5'"  C  N N 97  
GDP "C4'"  C  N R 98  
GDP "O4'"  O  N N 99  
GDP "C3'"  C  N S 100 
GDP "O3'"  O  N N 101 
GDP "C2'"  C  N R 102 
GDP "O2'"  O  N N 103 
GDP "C1'"  C  N R 104 
GDP N9     N  Y N 105 
GDP C8     C  Y N 106 
GDP N7     N  Y N 107 
GDP C5     C  Y N 108 
GDP C6     C  N N 109 
GDP O6     O  N N 110 
GDP N1     N  N N 111 
GDP C2     C  N N 112 
GDP N2     N  N N 113 
GDP N3     N  N N 114 
GDP C4     C  Y N 115 
GDP HOB2   H  N N 116 
GDP HOB3   H  N N 117 
GDP HOA2   H  N N 118 
GDP "H5'"  H  N N 119 
GDP "H5''" H  N N 120 
GDP "H4'"  H  N N 121 
GDP "H3'"  H  N N 122 
GDP "HO3'" H  N N 123 
GDP "H2'"  H  N N 124 
GDP "HO2'" H  N N 125 
GDP "H1'"  H  N N 126 
GDP H8     H  N N 127 
GDP HN1    H  N N 128 
GDP HN21   H  N N 129 
GDP HN22   H  N N 130 
GLN N      N  N N 131 
GLN CA     C  N S 132 
GLN C      C  N N 133 
GLN O      O  N N 134 
GLN CB     C  N N 135 
GLN CG     C  N N 136 
GLN CD     C  N N 137 
GLN OE1    O  N N 138 
GLN NE2    N  N N 139 
GLN OXT    O  N N 140 
GLN H      H  N N 141 
GLN H2     H  N N 142 
GLN HA     H  N N 143 
GLN HB2    H  N N 144 
GLN HB3    H  N N 145 
GLN HG2    H  N N 146 
GLN HG3    H  N N 147 
GLN HE21   H  N N 148 
GLN HE22   H  N N 149 
GLN HXT    H  N N 150 
GLU N      N  N N 151 
GLU CA     C  N S 152 
GLU C      C  N N 153 
GLU O      O  N N 154 
GLU CB     C  N N 155 
GLU CG     C  N N 156 
GLU CD     C  N N 157 
GLU OE1    O  N N 158 
GLU OE2    O  N N 159 
GLU OXT    O  N N 160 
GLU H      H  N N 161 
GLU H2     H  N N 162 
GLU HA     H  N N 163 
GLU HB2    H  N N 164 
GLU HB3    H  N N 165 
GLU HG2    H  N N 166 
GLU HG3    H  N N 167 
GLU HE2    H  N N 168 
GLU HXT    H  N N 169 
GLY N      N  N N 170 
GLY CA     C  N N 171 
GLY C      C  N N 172 
GLY O      O  N N 173 
GLY OXT    O  N N 174 
GLY H      H  N N 175 
GLY H2     H  N N 176 
GLY HA2    H  N N 177 
GLY HA3    H  N N 178 
GLY HXT    H  N N 179 
HIS N      N  N N 180 
HIS CA     C  N S 181 
HIS C      C  N N 182 
HIS O      O  N N 183 
HIS CB     C  N N 184 
HIS CG     C  Y N 185 
HIS ND1    N  Y N 186 
HIS CD2    C  Y N 187 
HIS CE1    C  Y N 188 
HIS NE2    N  Y N 189 
HIS OXT    O  N N 190 
HIS H      H  N N 191 
HIS H2     H  N N 192 
HIS HA     H  N N 193 
HIS HB2    H  N N 194 
HIS HB3    H  N N 195 
HIS HD1    H  N N 196 
HIS HD2    H  N N 197 
HIS HE1    H  N N 198 
HIS HE2    H  N N 199 
HIS HXT    H  N N 200 
HOH O      O  N N 201 
HOH H1     H  N N 202 
HOH H2     H  N N 203 
ILE N      N  N N 204 
ILE CA     C  N S 205 
ILE C      C  N N 206 
ILE O      O  N N 207 
ILE CB     C  N S 208 
ILE CG1    C  N N 209 
ILE CG2    C  N N 210 
ILE CD1    C  N N 211 
ILE OXT    O  N N 212 
ILE H      H  N N 213 
ILE H2     H  N N 214 
ILE HA     H  N N 215 
ILE HB     H  N N 216 
ILE HG12   H  N N 217 
ILE HG13   H  N N 218 
ILE HG21   H  N N 219 
ILE HG22   H  N N 220 
ILE HG23   H  N N 221 
ILE HD11   H  N N 222 
ILE HD12   H  N N 223 
ILE HD13   H  N N 224 
ILE HXT    H  N N 225 
LEU N      N  N N 226 
LEU CA     C  N S 227 
LEU C      C  N N 228 
LEU O      O  N N 229 
LEU CB     C  N N 230 
LEU CG     C  N N 231 
LEU CD1    C  N N 232 
LEU CD2    C  N N 233 
LEU OXT    O  N N 234 
LEU H      H  N N 235 
LEU H2     H  N N 236 
LEU HA     H  N N 237 
LEU HB2    H  N N 238 
LEU HB3    H  N N 239 
LEU HG     H  N N 240 
LEU HD11   H  N N 241 
LEU HD12   H  N N 242 
LEU HD13   H  N N 243 
LEU HD21   H  N N 244 
LEU HD22   H  N N 245 
LEU HD23   H  N N 246 
LEU HXT    H  N N 247 
LYS N      N  N N 248 
LYS CA     C  N S 249 
LYS C      C  N N 250 
LYS O      O  N N 251 
LYS CB     C  N N 252 
LYS CG     C  N N 253 
LYS CD     C  N N 254 
LYS CE     C  N N 255 
LYS NZ     N  N N 256 
LYS OXT    O  N N 257 
LYS H      H  N N 258 
LYS H2     H  N N 259 
LYS HA     H  N N 260 
LYS HB2    H  N N 261 
LYS HB3    H  N N 262 
LYS HG2    H  N N 263 
LYS HG3    H  N N 264 
LYS HD2    H  N N 265 
LYS HD3    H  N N 266 
LYS HE2    H  N N 267 
LYS HE3    H  N N 268 
LYS HZ1    H  N N 269 
LYS HZ2    H  N N 270 
LYS HZ3    H  N N 271 
LYS HXT    H  N N 272 
MET N      N  N N 273 
MET CA     C  N S 274 
MET C      C  N N 275 
MET O      O  N N 276 
MET CB     C  N N 277 
MET CG     C  N N 278 
MET SD     S  N N 279 
MET CE     C  N N 280 
MET OXT    O  N N 281 
MET H      H  N N 282 
MET H2     H  N N 283 
MET HA     H  N N 284 
MET HB2    H  N N 285 
MET HB3    H  N N 286 
MET HG2    H  N N 287 
MET HG3    H  N N 288 
MET HE1    H  N N 289 
MET HE2    H  N N 290 
MET HE3    H  N N 291 
MET HXT    H  N N 292 
PHE N      N  N N 293 
PHE CA     C  N S 294 
PHE C      C  N N 295 
PHE O      O  N N 296 
PHE CB     C  N N 297 
PHE CG     C  Y N 298 
PHE CD1    C  Y N 299 
PHE CD2    C  Y N 300 
PHE CE1    C  Y N 301 
PHE CE2    C  Y N 302 
PHE CZ     C  Y N 303 
PHE OXT    O  N N 304 
PHE H      H  N N 305 
PHE H2     H  N N 306 
PHE HA     H  N N 307 
PHE HB2    H  N N 308 
PHE HB3    H  N N 309 
PHE HD1    H  N N 310 
PHE HD2    H  N N 311 
PHE HE1    H  N N 312 
PHE HE2    H  N N 313 
PHE HZ     H  N N 314 
PHE HXT    H  N N 315 
PRO N      N  N N 316 
PRO CA     C  N S 317 
PRO C      C  N N 318 
PRO O      O  N N 319 
PRO CB     C  N N 320 
PRO CG     C  N N 321 
PRO CD     C  N N 322 
PRO OXT    O  N N 323 
PRO H      H  N N 324 
PRO HA     H  N N 325 
PRO HB2    H  N N 326 
PRO HB3    H  N N 327 
PRO HG2    H  N N 328 
PRO HG3    H  N N 329 
PRO HD2    H  N N 330 
PRO HD3    H  N N 331 
PRO HXT    H  N N 332 
SER N      N  N N 333 
SER CA     C  N S 334 
SER C      C  N N 335 
SER O      O  N N 336 
SER CB     C  N N 337 
SER OG     O  N N 338 
SER OXT    O  N N 339 
SER H      H  N N 340 
SER H2     H  N N 341 
SER HA     H  N N 342 
SER HB2    H  N N 343 
SER HB3    H  N N 344 
SER HG     H  N N 345 
SER HXT    H  N N 346 
THR N      N  N N 347 
THR CA     C  N S 348 
THR C      C  N N 349 
THR O      O  N N 350 
THR CB     C  N R 351 
THR OG1    O  N N 352 
THR CG2    C  N N 353 
THR OXT    O  N N 354 
THR H      H  N N 355 
THR H2     H  N N 356 
THR HA     H  N N 357 
THR HB     H  N N 358 
THR HG1    H  N N 359 
THR HG21   H  N N 360 
THR HG22   H  N N 361 
THR HG23   H  N N 362 
THR HXT    H  N N 363 
TRP N      N  N N 364 
TRP CA     C  N S 365 
TRP C      C  N N 366 
TRP O      O  N N 367 
TRP CB     C  N N 368 
TRP CG     C  Y N 369 
TRP CD1    C  Y N 370 
TRP CD2    C  Y N 371 
TRP NE1    N  Y N 372 
TRP CE2    C  Y N 373 
TRP CE3    C  Y N 374 
TRP CZ2    C  Y N 375 
TRP CZ3    C  Y N 376 
TRP CH2    C  Y N 377 
TRP OXT    O  N N 378 
TRP H      H  N N 379 
TRP H2     H  N N 380 
TRP HA     H  N N 381 
TRP HB2    H  N N 382 
TRP HB3    H  N N 383 
TRP HD1    H  N N 384 
TRP HE1    H  N N 385 
TRP HE3    H  N N 386 
TRP HZ2    H  N N 387 
TRP HZ3    H  N N 388 
TRP HH2    H  N N 389 
TRP HXT    H  N N 390 
TYR N      N  N N 391 
TYR CA     C  N S 392 
TYR C      C  N N 393 
TYR O      O  N N 394 
TYR CB     C  N N 395 
TYR CG     C  Y N 396 
TYR CD1    C  Y N 397 
TYR CD2    C  Y N 398 
TYR CE1    C  Y N 399 
TYR CE2    C  Y N 400 
TYR CZ     C  Y N 401 
TYR OH     O  N N 402 
TYR OXT    O  N N 403 
TYR H      H  N N 404 
TYR H2     H  N N 405 
TYR HA     H  N N 406 
TYR HB2    H  N N 407 
TYR HB3    H  N N 408 
TYR HD1    H  N N 409 
TYR HD2    H  N N 410 
TYR HE1    H  N N 411 
TYR HE2    H  N N 412 
TYR HH     H  N N 413 
TYR HXT    H  N N 414 
VAL N      N  N N 415 
VAL CA     C  N S 416 
VAL C      C  N N 417 
VAL O      O  N N 418 
VAL CB     C  N N 419 
VAL CG1    C  N N 420 
VAL CG2    C  N N 421 
VAL OXT    O  N N 422 
VAL H      H  N N 423 
VAL H2     H  N N 424 
VAL HA     H  N N 425 
VAL HB     H  N N 426 
VAL HG11   H  N N 427 
VAL HG12   H  N N 428 
VAL HG13   H  N N 429 
VAL HG21   H  N N 430 
VAL HG22   H  N N 431 
VAL HG23   H  N N 432 
VAL HXT    H  N N 433 
ZN  ZN     ZN N N 434 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N     CA     sing N N 1   
ALA N     H      sing N N 2   
ALA N     H2     sing N N 3   
ALA CA    C      sing N N 4   
ALA CA    CB     sing N N 5   
ALA CA    HA     sing N N 6   
ALA C     O      doub N N 7   
ALA C     OXT    sing N N 8   
ALA CB    HB1    sing N N 9   
ALA CB    HB2    sing N N 10  
ALA CB    HB3    sing N N 11  
ALA OXT   HXT    sing N N 12  
ARG N     CA     sing N N 13  
ARG N     H      sing N N 14  
ARG N     H2     sing N N 15  
ARG CA    C      sing N N 16  
ARG CA    CB     sing N N 17  
ARG CA    HA     sing N N 18  
ARG C     O      doub N N 19  
ARG C     OXT    sing N N 20  
ARG CB    CG     sing N N 21  
ARG CB    HB2    sing N N 22  
ARG CB    HB3    sing N N 23  
ARG CG    CD     sing N N 24  
ARG CG    HG2    sing N N 25  
ARG CG    HG3    sing N N 26  
ARG CD    NE     sing N N 27  
ARG CD    HD2    sing N N 28  
ARG CD    HD3    sing N N 29  
ARG NE    CZ     sing N N 30  
ARG NE    HE     sing N N 31  
ARG CZ    NH1    sing N N 32  
ARG CZ    NH2    doub N N 33  
ARG NH1   HH11   sing N N 34  
ARG NH1   HH12   sing N N 35  
ARG NH2   HH21   sing N N 36  
ARG NH2   HH22   sing N N 37  
ARG OXT   HXT    sing N N 38  
ASN N     CA     sing N N 39  
ASN N     H      sing N N 40  
ASN N     H2     sing N N 41  
ASN CA    C      sing N N 42  
ASN CA    CB     sing N N 43  
ASN CA    HA     sing N N 44  
ASN C     O      doub N N 45  
ASN C     OXT    sing N N 46  
ASN CB    CG     sing N N 47  
ASN CB    HB2    sing N N 48  
ASN CB    HB3    sing N N 49  
ASN CG    OD1    doub N N 50  
ASN CG    ND2    sing N N 51  
ASN ND2   HD21   sing N N 52  
ASN ND2   HD22   sing N N 53  
ASN OXT   HXT    sing N N 54  
ASP N     CA     sing N N 55  
ASP N     H      sing N N 56  
ASP N     H2     sing N N 57  
ASP CA    C      sing N N 58  
ASP CA    CB     sing N N 59  
ASP CA    HA     sing N N 60  
ASP C     O      doub N N 61  
ASP C     OXT    sing N N 62  
ASP CB    CG     sing N N 63  
ASP CB    HB2    sing N N 64  
ASP CB    HB3    sing N N 65  
ASP CG    OD1    doub N N 66  
ASP CG    OD2    sing N N 67  
ASP OD2   HD2    sing N N 68  
ASP OXT   HXT    sing N N 69  
CYS N     CA     sing N N 70  
CYS N     H      sing N N 71  
CYS N     H2     sing N N 72  
CYS CA    C      sing N N 73  
CYS CA    CB     sing N N 74  
CYS CA    HA     sing N N 75  
CYS C     O      doub N N 76  
CYS C     OXT    sing N N 77  
CYS CB    SG     sing N N 78  
CYS CB    HB2    sing N N 79  
CYS CB    HB3    sing N N 80  
CYS SG    HG     sing N N 81  
CYS OXT   HXT    sing N N 82  
GDP PB    O1B    doub N N 83  
GDP PB    O2B    sing N N 84  
GDP PB    O3B    sing N N 85  
GDP PB    O3A    sing N N 86  
GDP O2B   HOB2   sing N N 87  
GDP O3B   HOB3   sing N N 88  
GDP O3A   PA     sing N N 89  
GDP PA    O1A    doub N N 90  
GDP PA    O2A    sing N N 91  
GDP PA    "O5'"  sing N N 92  
GDP O2A   HOA2   sing N N 93  
GDP "O5'" "C5'"  sing N N 94  
GDP "C5'" "C4'"  sing N N 95  
GDP "C5'" "H5'"  sing N N 96  
GDP "C5'" "H5''" sing N N 97  
GDP "C4'" "O4'"  sing N N 98  
GDP "C4'" "C3'"  sing N N 99  
GDP "C4'" "H4'"  sing N N 100 
GDP "O4'" "C1'"  sing N N 101 
GDP "C3'" "O3'"  sing N N 102 
GDP "C3'" "C2'"  sing N N 103 
GDP "C3'" "H3'"  sing N N 104 
GDP "O3'" "HO3'" sing N N 105 
GDP "C2'" "O2'"  sing N N 106 
GDP "C2'" "C1'"  sing N N 107 
GDP "C2'" "H2'"  sing N N 108 
GDP "O2'" "HO2'" sing N N 109 
GDP "C1'" N9     sing N N 110 
GDP "C1'" "H1'"  sing N N 111 
GDP N9    C8     sing Y N 112 
GDP N9    C4     sing Y N 113 
GDP C8    N7     doub Y N 114 
GDP C8    H8     sing N N 115 
GDP N7    C5     sing Y N 116 
GDP C5    C6     sing N N 117 
GDP C5    C4     doub Y N 118 
GDP C6    O6     doub N N 119 
GDP C6    N1     sing N N 120 
GDP N1    C2     sing N N 121 
GDP N1    HN1    sing N N 122 
GDP C2    N2     sing N N 123 
GDP C2    N3     doub N N 124 
GDP N2    HN21   sing N N 125 
GDP N2    HN22   sing N N 126 
GDP N3    C4     sing N N 127 
GLN N     CA     sing N N 128 
GLN N     H      sing N N 129 
GLN N     H2     sing N N 130 
GLN CA    C      sing N N 131 
GLN CA    CB     sing N N 132 
GLN CA    HA     sing N N 133 
GLN C     O      doub N N 134 
GLN C     OXT    sing N N 135 
GLN CB    CG     sing N N 136 
GLN CB    HB2    sing N N 137 
GLN CB    HB3    sing N N 138 
GLN CG    CD     sing N N 139 
GLN CG    HG2    sing N N 140 
GLN CG    HG3    sing N N 141 
GLN CD    OE1    doub N N 142 
GLN CD    NE2    sing N N 143 
GLN NE2   HE21   sing N N 144 
GLN NE2   HE22   sing N N 145 
GLN OXT   HXT    sing N N 146 
GLU N     CA     sing N N 147 
GLU N     H      sing N N 148 
GLU N     H2     sing N N 149 
GLU CA    C      sing N N 150 
GLU CA    CB     sing N N 151 
GLU CA    HA     sing N N 152 
GLU C     O      doub N N 153 
GLU C     OXT    sing N N 154 
GLU CB    CG     sing N N 155 
GLU CB    HB2    sing N N 156 
GLU CB    HB3    sing N N 157 
GLU CG    CD     sing N N 158 
GLU CG    HG2    sing N N 159 
GLU CG    HG3    sing N N 160 
GLU CD    OE1    doub N N 161 
GLU CD    OE2    sing N N 162 
GLU OE2   HE2    sing N N 163 
GLU OXT   HXT    sing N N 164 
GLY N     CA     sing N N 165 
GLY N     H      sing N N 166 
GLY N     H2     sing N N 167 
GLY CA    C      sing N N 168 
GLY CA    HA2    sing N N 169 
GLY CA    HA3    sing N N 170 
GLY C     O      doub N N 171 
GLY C     OXT    sing N N 172 
GLY OXT   HXT    sing N N 173 
HIS N     CA     sing N N 174 
HIS N     H      sing N N 175 
HIS N     H2     sing N N 176 
HIS CA    C      sing N N 177 
HIS CA    CB     sing N N 178 
HIS CA    HA     sing N N 179 
HIS C     O      doub N N 180 
HIS C     OXT    sing N N 181 
HIS CB    CG     sing N N 182 
HIS CB    HB2    sing N N 183 
HIS CB    HB3    sing N N 184 
HIS CG    ND1    sing Y N 185 
HIS CG    CD2    doub Y N 186 
HIS ND1   CE1    doub Y N 187 
HIS ND1   HD1    sing N N 188 
HIS CD2   NE2    sing Y N 189 
HIS CD2   HD2    sing N N 190 
HIS CE1   NE2    sing Y N 191 
HIS CE1   HE1    sing N N 192 
HIS NE2   HE2    sing N N 193 
HIS OXT   HXT    sing N N 194 
HOH O     H1     sing N N 195 
HOH O     H2     sing N N 196 
ILE N     CA     sing N N 197 
ILE N     H      sing N N 198 
ILE N     H2     sing N N 199 
ILE CA    C      sing N N 200 
ILE CA    CB     sing N N 201 
ILE CA    HA     sing N N 202 
ILE C     O      doub N N 203 
ILE C     OXT    sing N N 204 
ILE CB    CG1    sing N N 205 
ILE CB    CG2    sing N N 206 
ILE CB    HB     sing N N 207 
ILE CG1   CD1    sing N N 208 
ILE CG1   HG12   sing N N 209 
ILE CG1   HG13   sing N N 210 
ILE CG2   HG21   sing N N 211 
ILE CG2   HG22   sing N N 212 
ILE CG2   HG23   sing N N 213 
ILE CD1   HD11   sing N N 214 
ILE CD1   HD12   sing N N 215 
ILE CD1   HD13   sing N N 216 
ILE OXT   HXT    sing N N 217 
LEU N     CA     sing N N 218 
LEU N     H      sing N N 219 
LEU N     H2     sing N N 220 
LEU CA    C      sing N N 221 
LEU CA    CB     sing N N 222 
LEU CA    HA     sing N N 223 
LEU C     O      doub N N 224 
LEU C     OXT    sing N N 225 
LEU CB    CG     sing N N 226 
LEU CB    HB2    sing N N 227 
LEU CB    HB3    sing N N 228 
LEU CG    CD1    sing N N 229 
LEU CG    CD2    sing N N 230 
LEU CG    HG     sing N N 231 
LEU CD1   HD11   sing N N 232 
LEU CD1   HD12   sing N N 233 
LEU CD1   HD13   sing N N 234 
LEU CD2   HD21   sing N N 235 
LEU CD2   HD22   sing N N 236 
LEU CD2   HD23   sing N N 237 
LEU OXT   HXT    sing N N 238 
LYS N     CA     sing N N 239 
LYS N     H      sing N N 240 
LYS N     H2     sing N N 241 
LYS CA    C      sing N N 242 
LYS CA    CB     sing N N 243 
LYS CA    HA     sing N N 244 
LYS C     O      doub N N 245 
LYS C     OXT    sing N N 246 
LYS CB    CG     sing N N 247 
LYS CB    HB2    sing N N 248 
LYS CB    HB3    sing N N 249 
LYS CG    CD     sing N N 250 
LYS CG    HG2    sing N N 251 
LYS CG    HG3    sing N N 252 
LYS CD    CE     sing N N 253 
LYS CD    HD2    sing N N 254 
LYS CD    HD3    sing N N 255 
LYS CE    NZ     sing N N 256 
LYS CE    HE2    sing N N 257 
LYS CE    HE3    sing N N 258 
LYS NZ    HZ1    sing N N 259 
LYS NZ    HZ2    sing N N 260 
LYS NZ    HZ3    sing N N 261 
LYS OXT   HXT    sing N N 262 
MET N     CA     sing N N 263 
MET N     H      sing N N 264 
MET N     H2     sing N N 265 
MET CA    C      sing N N 266 
MET CA    CB     sing N N 267 
MET CA    HA     sing N N 268 
MET C     O      doub N N 269 
MET C     OXT    sing N N 270 
MET CB    CG     sing N N 271 
MET CB    HB2    sing N N 272 
MET CB    HB3    sing N N 273 
MET CG    SD     sing N N 274 
MET CG    HG2    sing N N 275 
MET CG    HG3    sing N N 276 
MET SD    CE     sing N N 277 
MET CE    HE1    sing N N 278 
MET CE    HE2    sing N N 279 
MET CE    HE3    sing N N 280 
MET OXT   HXT    sing N N 281 
PHE N     CA     sing N N 282 
PHE N     H      sing N N 283 
PHE N     H2     sing N N 284 
PHE CA    C      sing N N 285 
PHE CA    CB     sing N N 286 
PHE CA    HA     sing N N 287 
PHE C     O      doub N N 288 
PHE C     OXT    sing N N 289 
PHE CB    CG     sing N N 290 
PHE CB    HB2    sing N N 291 
PHE CB    HB3    sing N N 292 
PHE CG    CD1    doub Y N 293 
PHE CG    CD2    sing Y N 294 
PHE CD1   CE1    sing Y N 295 
PHE CD1   HD1    sing N N 296 
PHE CD2   CE2    doub Y N 297 
PHE CD2   HD2    sing N N 298 
PHE CE1   CZ     doub Y N 299 
PHE CE1   HE1    sing N N 300 
PHE CE2   CZ     sing Y N 301 
PHE CE2   HE2    sing N N 302 
PHE CZ    HZ     sing N N 303 
PHE OXT   HXT    sing N N 304 
PRO N     CA     sing N N 305 
PRO N     CD     sing N N 306 
PRO N     H      sing N N 307 
PRO CA    C      sing N N 308 
PRO CA    CB     sing N N 309 
PRO CA    HA     sing N N 310 
PRO C     O      doub N N 311 
PRO C     OXT    sing N N 312 
PRO CB    CG     sing N N 313 
PRO CB    HB2    sing N N 314 
PRO CB    HB3    sing N N 315 
PRO CG    CD     sing N N 316 
PRO CG    HG2    sing N N 317 
PRO CG    HG3    sing N N 318 
PRO CD    HD2    sing N N 319 
PRO CD    HD3    sing N N 320 
PRO OXT   HXT    sing N N 321 
SER N     CA     sing N N 322 
SER N     H      sing N N 323 
SER N     H2     sing N N 324 
SER CA    C      sing N N 325 
SER CA    CB     sing N N 326 
SER CA    HA     sing N N 327 
SER C     O      doub N N 328 
SER C     OXT    sing N N 329 
SER CB    OG     sing N N 330 
SER CB    HB2    sing N N 331 
SER CB    HB3    sing N N 332 
SER OG    HG     sing N N 333 
SER OXT   HXT    sing N N 334 
THR N     CA     sing N N 335 
THR N     H      sing N N 336 
THR N     H2     sing N N 337 
THR CA    C      sing N N 338 
THR CA    CB     sing N N 339 
THR CA    HA     sing N N 340 
THR C     O      doub N N 341 
THR C     OXT    sing N N 342 
THR CB    OG1    sing N N 343 
THR CB    CG2    sing N N 344 
THR CB    HB     sing N N 345 
THR OG1   HG1    sing N N 346 
THR CG2   HG21   sing N N 347 
THR CG2   HG22   sing N N 348 
THR CG2   HG23   sing N N 349 
THR OXT   HXT    sing N N 350 
TRP N     CA     sing N N 351 
TRP N     H      sing N N 352 
TRP N     H2     sing N N 353 
TRP CA    C      sing N N 354 
TRP CA    CB     sing N N 355 
TRP CA    HA     sing N N 356 
TRP C     O      doub N N 357 
TRP C     OXT    sing N N 358 
TRP CB    CG     sing N N 359 
TRP CB    HB2    sing N N 360 
TRP CB    HB3    sing N N 361 
TRP CG    CD1    doub Y N 362 
TRP CG    CD2    sing Y N 363 
TRP CD1   NE1    sing Y N 364 
TRP CD1   HD1    sing N N 365 
TRP CD2   CE2    doub Y N 366 
TRP CD2   CE3    sing Y N 367 
TRP NE1   CE2    sing Y N 368 
TRP NE1   HE1    sing N N 369 
TRP CE2   CZ2    sing Y N 370 
TRP CE3   CZ3    doub Y N 371 
TRP CE3   HE3    sing N N 372 
TRP CZ2   CH2    doub Y N 373 
TRP CZ2   HZ2    sing N N 374 
TRP CZ3   CH2    sing Y N 375 
TRP CZ3   HZ3    sing N N 376 
TRP CH2   HH2    sing N N 377 
TRP OXT   HXT    sing N N 378 
TYR N     CA     sing N N 379 
TYR N     H      sing N N 380 
TYR N     H2     sing N N 381 
TYR CA    C      sing N N 382 
TYR CA    CB     sing N N 383 
TYR CA    HA     sing N N 384 
TYR C     O      doub N N 385 
TYR C     OXT    sing N N 386 
TYR CB    CG     sing N N 387 
TYR CB    HB2    sing N N 388 
TYR CB    HB3    sing N N 389 
TYR CG    CD1    doub Y N 390 
TYR CG    CD2    sing Y N 391 
TYR CD1   CE1    sing Y N 392 
TYR CD1   HD1    sing N N 393 
TYR CD2   CE2    doub Y N 394 
TYR CD2   HD2    sing N N 395 
TYR CE1   CZ     doub Y N 396 
TYR CE1   HE1    sing N N 397 
TYR CE2   CZ     sing Y N 398 
TYR CE2   HE2    sing N N 399 
TYR CZ    OH     sing N N 400 
TYR OH    HH     sing N N 401 
TYR OXT   HXT    sing N N 402 
VAL N     CA     sing N N 403 
VAL N     H      sing N N 404 
VAL N     H2     sing N N 405 
VAL CA    C      sing N N 406 
VAL CA    CB     sing N N 407 
VAL CA    HA     sing N N 408 
VAL C     O      doub N N 409 
VAL C     OXT    sing N N 410 
VAL CB    CG1    sing N N 411 
VAL CB    CG2    sing N N 412 
VAL CB    HB     sing N N 413 
VAL CG1   HG11   sing N N 414 
VAL CG1   HG12   sing N N 415 
VAL CG1   HG13   sing N N 416 
VAL CG2   HG21   sing N N 417 
VAL CG2   HG22   sing N N 418 
VAL CG2   HG23   sing N N 419 
VAL OXT   HXT    sing N N 420 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   2RCN 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    6H4D 
_atom_sites.fract_transf_matrix[1][1]   0.006830 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006830 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006830 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_