data_6H5S # _entry.id 6H5S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.328 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6H5S WWPDB D_1200011113 EMDB EMD-0142 # _pdbx_database_related.db_name EMDB _pdbx_database_related.details ;Cryo-EM map of in vitro assembled Measles virus N into nucleocapsid-like particles (NCLPs) bound to viral genomic 5-prime RNA hexamers. ; _pdbx_database_related.db_id EMD-0142 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6H5S _pdbx_database_status.recvd_initial_deposition_date 2018-07-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Desfosses, A.' 1 0000-0002-6525-5042 'Milles, S.' 2 ? 'Ringkjobing Jensen, M.' 3 ? 'Guseva, S.' 4 ? 'Colletier, J.P.' 5 ? 'Maurin, D.' 6 ? 'Schoehn, G.' 7 ? 'Gutsche, I.' 8 ? 'Ruigrok, R.' 9 ? 'Blackledge, M.' 10 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 116 _citation.language ? _citation.page_first 4256 _citation.page_last 4264 _citation.title ;Assembly and cryo-EM structures of RNA-specific measles virus nucleocapsids provide mechanistic insight into paramyxoviral replication. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1816417116 _citation.pdbx_database_id_PubMed 30787192 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Desfosses, A.' 1 ? primary 'Milles, S.' 2 ? primary 'Jensen, M.R.' 3 ? primary 'Guseva, S.' 4 ? primary 'Colletier, J.P.' 5 ? primary 'Maurin, D.' 6 ? primary 'Schoehn, G.' 7 ? primary 'Gutsche, I.' 8 ? primary 'Ruigrok, R.W.H.' 9 ? primary 'Blackledge, M.' 10 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6H5S _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 1 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6H5S _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Nucleocapsid 46425.863 1 ? ? ? ? 2 polymer man ;RNA (5'-R(*AP*CP*CP*AP*GP*A)-3') ; 1898.229 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Nucleocapsid protein' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSRLLDRLVRLIGNPDVSGPKLTGALIGILSLF VESPGQLIQRITDDPDVSIRLLEVVQSDQSQSGLTFASRGTNMEDEADQYFSHDDPISSDQSRFGWFENKEISDIEVQDP EGFNMILGTILAQIWVLLAKAVTAPDTAADSELRRWIKYTQQRRVVGEFRLERKWLDVVRNRIAEDLSLRRFMVALILDI KRTPGNKPRIAEMICDIDTYIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTLESLMNLYQQMGETAPYMVILENSI QNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSTLASELGITAEDARLVSEIAMH TTEDKVEHHHHHHHH ; ;MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSRLLDRLVRLIGNPDVSGPKLTGALIGILSLF VESPGQLIQRITDDPDVSIRLLEVVQSDQSQSGLTFASRGTNMEDEADQYFSHDDPISSDQSRFGWFENKEISDIEVQDP EGFNMILGTILAQIWVLLAKAVTAPDTAADSELRRWIKYTQQRRVVGEFRLERKWLDVVRNRIAEDLSLRRFMVALILDI KRTPGNKPRIAEMICDIDTYIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTLESLMNLYQQMGETAPYMVILENSI QNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSTLASELGITAEDARLVSEIAMH TTEDKVEHHHHHHHH ; C ? 2 polyribonucleotide no no ACCAGA ACCAGA E ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 THR n 1 4 LEU n 1 5 LEU n 1 6 ARG n 1 7 SER n 1 8 LEU n 1 9 ALA n 1 10 LEU n 1 11 PHE n 1 12 LYS n 1 13 ARG n 1 14 ASN n 1 15 LYS n 1 16 ASP n 1 17 LYS n 1 18 PRO n 1 19 PRO n 1 20 ILE n 1 21 THR n 1 22 SER n 1 23 GLY n 1 24 SER n 1 25 GLY n 1 26 GLY n 1 27 ALA n 1 28 ILE n 1 29 ARG n 1 30 GLY n 1 31 ILE n 1 32 LYS n 1 33 HIS n 1 34 ILE n 1 35 ILE n 1 36 ILE n 1 37 VAL n 1 38 PRO n 1 39 ILE n 1 40 PRO n 1 41 GLY n 1 42 ASP n 1 43 SER n 1 44 SER n 1 45 ILE n 1 46 THR n 1 47 THR n 1 48 ARG n 1 49 SER n 1 50 ARG n 1 51 LEU n 1 52 LEU n 1 53 ASP n 1 54 ARG n 1 55 LEU n 1 56 VAL n 1 57 ARG n 1 58 LEU n 1 59 ILE n 1 60 GLY n 1 61 ASN n 1 62 PRO n 1 63 ASP n 1 64 VAL n 1 65 SER n 1 66 GLY n 1 67 PRO n 1 68 LYS n 1 69 LEU n 1 70 THR n 1 71 GLY n 1 72 ALA n 1 73 LEU n 1 74 ILE n 1 75 GLY n 1 76 ILE n 1 77 LEU n 1 78 SER n 1 79 LEU n 1 80 PHE n 1 81 VAL n 1 82 GLU n 1 83 SER n 1 84 PRO n 1 85 GLY n 1 86 GLN n 1 87 LEU n 1 88 ILE n 1 89 GLN n 1 90 ARG n 1 91 ILE n 1 92 THR n 1 93 ASP n 1 94 ASP n 1 95 PRO n 1 96 ASP n 1 97 VAL n 1 98 SER n 1 99 ILE n 1 100 ARG n 1 101 LEU n 1 102 LEU n 1 103 GLU n 1 104 VAL n 1 105 VAL n 1 106 GLN n 1 107 SER n 1 108 ASP n 1 109 GLN n 1 110 SER n 1 111 GLN n 1 112 SER n 1 113 GLY n 1 114 LEU n 1 115 THR n 1 116 PHE n 1 117 ALA n 1 118 SER n 1 119 ARG n 1 120 GLY n 1 121 THR n 1 122 ASN n 1 123 MET n 1 124 GLU n 1 125 ASP n 1 126 GLU n 1 127 ALA n 1 128 ASP n 1 129 GLN n 1 130 TYR n 1 131 PHE n 1 132 SER n 1 133 HIS n 1 134 ASP n 1 135 ASP n 1 136 PRO n 1 137 ILE n 1 138 SER n 1 139 SER n 1 140 ASP n 1 141 GLN n 1 142 SER n 1 143 ARG n 1 144 PHE n 1 145 GLY n 1 146 TRP n 1 147 PHE n 1 148 GLU n 1 149 ASN n 1 150 LYS n 1 151 GLU n 1 152 ILE n 1 153 SER n 1 154 ASP n 1 155 ILE n 1 156 GLU n 1 157 VAL n 1 158 GLN n 1 159 ASP n 1 160 PRO n 1 161 GLU n 1 162 GLY n 1 163 PHE n 1 164 ASN n 1 165 MET n 1 166 ILE n 1 167 LEU n 1 168 GLY n 1 169 THR n 1 170 ILE n 1 171 LEU n 1 172 ALA n 1 173 GLN n 1 174 ILE n 1 175 TRP n 1 176 VAL n 1 177 LEU n 1 178 LEU n 1 179 ALA n 1 180 LYS n 1 181 ALA n 1 182 VAL n 1 183 THR n 1 184 ALA n 1 185 PRO n 1 186 ASP n 1 187 THR n 1 188 ALA n 1 189 ALA n 1 190 ASP n 1 191 SER n 1 192 GLU n 1 193 LEU n 1 194 ARG n 1 195 ARG n 1 196 TRP n 1 197 ILE n 1 198 LYS n 1 199 TYR n 1 200 THR n 1 201 GLN n 1 202 GLN n 1 203 ARG n 1 204 ARG n 1 205 VAL n 1 206 VAL n 1 207 GLY n 1 208 GLU n 1 209 PHE n 1 210 ARG n 1 211 LEU n 1 212 GLU n 1 213 ARG n 1 214 LYS n 1 215 TRP n 1 216 LEU n 1 217 ASP n 1 218 VAL n 1 219 VAL n 1 220 ARG n 1 221 ASN n 1 222 ARG n 1 223 ILE n 1 224 ALA n 1 225 GLU n 1 226 ASP n 1 227 LEU n 1 228 SER n 1 229 LEU n 1 230 ARG n 1 231 ARG n 1 232 PHE n 1 233 MET n 1 234 VAL n 1 235 ALA n 1 236 LEU n 1 237 ILE n 1 238 LEU n 1 239 ASP n 1 240 ILE n 1 241 LYS n 1 242 ARG n 1 243 THR n 1 244 PRO n 1 245 GLY n 1 246 ASN n 1 247 LYS n 1 248 PRO n 1 249 ARG n 1 250 ILE n 1 251 ALA n 1 252 GLU n 1 253 MET n 1 254 ILE n 1 255 CYS n 1 256 ASP n 1 257 ILE n 1 258 ASP n 1 259 THR n 1 260 TYR n 1 261 ILE n 1 262 VAL n 1 263 GLU n 1 264 ALA n 1 265 GLY n 1 266 LEU n 1 267 ALA n 1 268 SER n 1 269 PHE n 1 270 ILE n 1 271 LEU n 1 272 THR n 1 273 ILE n 1 274 LYS n 1 275 PHE n 1 276 GLY n 1 277 ILE n 1 278 GLU n 1 279 THR n 1 280 MET n 1 281 TYR n 1 282 PRO n 1 283 ALA n 1 284 LEU n 1 285 GLY n 1 286 LEU n 1 287 HIS n 1 288 GLU n 1 289 PHE n 1 290 ALA n 1 291 GLY n 1 292 GLU n 1 293 LEU n 1 294 SER n 1 295 THR n 1 296 LEU n 1 297 GLU n 1 298 SER n 1 299 LEU n 1 300 MET n 1 301 ASN n 1 302 LEU n 1 303 TYR n 1 304 GLN n 1 305 GLN n 1 306 MET n 1 307 GLY n 1 308 GLU n 1 309 THR n 1 310 ALA n 1 311 PRO n 1 312 TYR n 1 313 MET n 1 314 VAL n 1 315 ILE n 1 316 LEU n 1 317 GLU n 1 318 ASN n 1 319 SER n 1 320 ILE n 1 321 GLN n 1 322 ASN n 1 323 LYS n 1 324 PHE n 1 325 SER n 1 326 ALA n 1 327 GLY n 1 328 SER n 1 329 TYR n 1 330 PRO n 1 331 LEU n 1 332 LEU n 1 333 TRP n 1 334 SER n 1 335 TYR n 1 336 ALA n 1 337 MET n 1 338 GLY n 1 339 VAL n 1 340 GLY n 1 341 VAL n 1 342 GLU n 1 343 LEU n 1 344 GLU n 1 345 ASN n 1 346 SER n 1 347 MET n 1 348 GLY n 1 349 GLY n 1 350 LEU n 1 351 ASN n 1 352 PHE n 1 353 GLY n 1 354 ARG n 1 355 SER n 1 356 TYR n 1 357 PHE n 1 358 ASP n 1 359 PRO n 1 360 ALA n 1 361 TYR n 1 362 PHE n 1 363 ARG n 1 364 LEU n 1 365 GLY n 1 366 GLN n 1 367 GLU n 1 368 MET n 1 369 VAL n 1 370 ARG n 1 371 ARG n 1 372 SER n 1 373 ALA n 1 374 GLY n 1 375 LYS n 1 376 VAL n 1 377 SER n 1 378 SER n 1 379 THR n 1 380 LEU n 1 381 ALA n 1 382 SER n 1 383 GLU n 1 384 LEU n 1 385 GLY n 1 386 ILE n 1 387 THR n 1 388 ALA n 1 389 GLU n 1 390 ASP n 1 391 ALA n 1 392 ARG n 1 393 LEU n 1 394 VAL n 1 395 SER n 1 396 GLU n 1 397 ILE n 1 398 ALA n 1 399 MET n 1 400 HIS n 1 401 THR n 1 402 THR n 1 403 GLU n 1 404 ASP n 1 405 LYS n 1 406 VAL n 1 407 GLU n 1 408 HIS n 1 409 HIS n 1 410 HIS n 1 411 HIS n 1 412 HIS n 1 413 HIS n 1 414 HIS n 1 415 HIS n 2 1 A n 2 2 C n 2 3 C n 2 4 A n 2 5 G n 2 6 A n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 415 ? ? ? ? ? ? ? ? ? 'Measles morbillivirus' 11234 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 6 ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP B8PZP0_9MONO B8PZP0 ? 1 ;MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSRLLDRLVRLIGNPDVSGPKLTGALIGILSLF VESPGQLIQRITDDPDVSIRLLEVVQSDQSQSGLTFASRGTNMEDEADQYFSHDDPISSDQSRFGWFENKEISDIEVQDP EGFNMILGTILAQIWVLLAKAVTAPDTAADSELRRWIKYTQQRRVVGEFRLERKWLDVVRNRIAEDLSLRRFMVALILDI KRTPGNKPRIAEMICDIDTYIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTLESLMNLYQQMGETAPYMVILENSI QNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSTLASELGITAEDARLVSEIAMH TTEDK ; 1 2 PDB 6H5S 6H5S ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6H5S C 1 ? 405 ? B8PZP0 1 ? 405 ? 1 405 2 2 6H5S E 1 ? 6 ? 6H5S 1 ? 6 ? 1 6 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6H5S VAL C 406 ? UNP B8PZP0 ? ? 'expression tag' 406 1 1 6H5S GLU C 407 ? UNP B8PZP0 ? ? 'expression tag' 407 2 1 6H5S HIS C 408 ? UNP B8PZP0 ? ? 'expression tag' 408 3 1 6H5S HIS C 409 ? UNP B8PZP0 ? ? 'expression tag' 409 4 1 6H5S HIS C 410 ? UNP B8PZP0 ? ? 'expression tag' 410 5 1 6H5S HIS C 411 ? UNP B8PZP0 ? ? 'expression tag' 411 6 1 6H5S HIS C 412 ? UNP B8PZP0 ? ? 'expression tag' 412 7 1 6H5S HIS C 413 ? UNP B8PZP0 ? ? 'expression tag' 413 8 1 6H5S HIS C 414 ? UNP B8PZP0 ? ? 'expression tag' 414 9 1 6H5S HIS C 415 ? UNP B8PZP0 ? ? 'expression tag' 415 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C 'RNA linking' y "CYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O8 P' 323.197 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6H5S _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6H5S _refine.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.30 _refine.ls_d_res_low ? _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work ? _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _struct.entry_id 6H5S _struct.title ;Cryo-EM map of in vitro assembled Measles virus N into nucleocapsid-like particles (NCLPs) bound to viral genomic 5-prime RNA hexamers. ; _struct.pdbx_descriptor 'Nucleocapsid/RNA Complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6H5S _struct_keywords.text 'Measles, Nucleocapsid, RNA, helical, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 2 ? ARG A 13 ? ALA C 2 ARG C 13 1 ? 12 HELX_P HELX_P2 AA2 SER A 44 ? GLY A 60 ? SER C 44 GLY C 60 1 ? 17 HELX_P HELX_P3 AA3 SER A 65 ? LEU A 77 ? SER C 65 LEU C 77 1 ? 13 HELX_P HELX_P4 AA4 PRO A 84 ? THR A 92 ? PRO C 84 THR C 92 1 ? 9 HELX_P HELX_P5 AA5 ALA A 127 ? SER A 132 ? ALA C 127 SER C 132 1 ? 6 HELX_P HELX_P6 AA6 ASP A 159 ? ALA A 172 ? ASP C 159 ALA C 172 1 ? 14 HELX_P HELX_P7 AA7 LEU A 177 ? ALA A 181 ? LEU C 177 ALA C 181 5 ? 5 HELX_P HELX_P8 AA8 PRO A 185 ? THR A 187 ? PRO C 185 THR C 187 5 ? 3 HELX_P HELX_P9 AA9 ALA A 188 ? GLN A 202 ? ALA C 188 GLN C 202 1 ? 15 HELX_P HELX_P10 AB1 GLU A 212 ? ASP A 226 ? GLU C 212 ASP C 226 1 ? 15 HELX_P HELX_P11 AB2 LEU A 227 ? ARG A 242 ? LEU C 227 ARG C 242 1 ? 16 HELX_P HELX_P12 AB3 PRO A 248 ? ASP A 258 ? PRO C 248 ASP C 258 1 ? 11 HELX_P HELX_P13 AB4 THR A 259 ? ILE A 261 ? THR C 259 ILE C 261 5 ? 3 HELX_P HELX_P14 AB5 LEU A 266 ? GLY A 276 ? LEU C 266 GLY C 276 1 ? 11 HELX_P HELX_P15 AB6 LEU A 286 ? GLY A 291 ? LEU C 286 GLY C 291 1 ? 6 HELX_P HELX_P16 AB7 LEU A 293 ? GLN A 305 ? LEU C 293 GLN C 305 1 ? 13 HELX_P HELX_P17 AB8 MET A 306 ? MET A 313 ? MET C 306 MET C 313 5 ? 8 HELX_P HELX_P18 AB9 ASN A 318 ? LYS A 323 ? ASN C 318 LYS C 323 5 ? 6 HELX_P HELX_P19 AC1 SER A 325 ? SER A 328 ? SER C 325 SER C 328 5 ? 4 HELX_P HELX_P20 AC2 TYR A 329 ? GLU A 344 ? TYR C 329 GLU C 344 1 ? 16 HELX_P HELX_P21 AC3 ASN A 345 ? LEU A 350 ? ASN C 345 LEU C 350 5 ? 6 HELX_P HELX_P22 AC4 ASP A 358 ? SER A 372 ? ASP C 358 SER C 372 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 34 ? PRO A 40 ? ILE C 34 PRO C 40 AA1 2 SER A 98 ? GLN A 106 ? SER C 98 GLN C 106 AA1 3 LEU A 114 ? PHE A 116 ? LEU C 114 PHE C 116 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 35 ? N ILE C 35 O ARG A 100 ? O ARG C 100 AA1 2 3 N VAL A 105 ? N VAL C 105 O THR A 115 ? O THR C 115 # _atom_sites.entry_id 6H5S _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? C . n A 1 2 ALA 2 2 2 ALA ALA C . n A 1 3 THR 3 3 3 THR THR C . n A 1 4 LEU 4 4 4 LEU LEU C . n A 1 5 LEU 5 5 5 LEU LEU C . n A 1 6 ARG 6 6 6 ARG ARG C . n A 1 7 SER 7 7 7 SER SER C . n A 1 8 LEU 8 8 8 LEU LEU C . n A 1 9 ALA 9 9 9 ALA ALA C . n A 1 10 LEU 10 10 10 LEU LEU C . n A 1 11 PHE 11 11 11 PHE PHE C . n A 1 12 LYS 12 12 12 LYS LYS C . n A 1 13 ARG 13 13 13 ARG ARG C . n A 1 14 ASN 14 14 14 ASN ASN C . n A 1 15 LYS 15 15 15 LYS LYS C . n A 1 16 ASP 16 16 16 ASP ASP C . n A 1 17 LYS 17 17 17 LYS LYS C . n A 1 18 PRO 18 18 18 PRO PRO C . n A 1 19 PRO 19 19 19 PRO PRO C . n A 1 20 ILE 20 20 20 ILE ILE C . n A 1 21 THR 21 21 21 THR THR C . n A 1 22 SER 22 22 22 SER SER C . n A 1 23 GLY 23 23 23 GLY GLY C . n A 1 24 SER 24 24 24 SER SER C . n A 1 25 GLY 25 25 25 GLY GLY C . n A 1 26 GLY 26 26 26 GLY GLY C . n A 1 27 ALA 27 27 27 ALA ALA C . n A 1 28 ILE 28 28 28 ILE ILE C . n A 1 29 ARG 29 29 29 ARG ARG C . n A 1 30 GLY 30 30 30 GLY GLY C . n A 1 31 ILE 31 31 31 ILE ILE C . n A 1 32 LYS 32 32 32 LYS LYS C . n A 1 33 HIS 33 33 33 HIS HIS C . n A 1 34 ILE 34 34 34 ILE ILE C . n A 1 35 ILE 35 35 35 ILE ILE C . n A 1 36 ILE 36 36 36 ILE ILE C . n A 1 37 VAL 37 37 37 VAL VAL C . n A 1 38 PRO 38 38 38 PRO PRO C . n A 1 39 ILE 39 39 39 ILE ILE C . n A 1 40 PRO 40 40 40 PRO PRO C . n A 1 41 GLY 41 41 41 GLY GLY C . n A 1 42 ASP 42 42 42 ASP ASP C . n A 1 43 SER 43 43 43 SER SER C . n A 1 44 SER 44 44 44 SER SER C . n A 1 45 ILE 45 45 45 ILE ILE C . n A 1 46 THR 46 46 46 THR THR C . n A 1 47 THR 47 47 47 THR THR C . n A 1 48 ARG 48 48 48 ARG ARG C . n A 1 49 SER 49 49 49 SER SER C . n A 1 50 ARG 50 50 50 ARG ARG C . n A 1 51 LEU 51 51 51 LEU LEU C . n A 1 52 LEU 52 52 52 LEU LEU C . n A 1 53 ASP 53 53 53 ASP ASP C . n A 1 54 ARG 54 54 54 ARG ARG C . n A 1 55 LEU 55 55 55 LEU LEU C . n A 1 56 VAL 56 56 56 VAL VAL C . n A 1 57 ARG 57 57 57 ARG ARG C . n A 1 58 LEU 58 58 58 LEU LEU C . n A 1 59 ILE 59 59 59 ILE ILE C . n A 1 60 GLY 60 60 60 GLY GLY C . n A 1 61 ASN 61 61 61 ASN ASN C . n A 1 62 PRO 62 62 62 PRO PRO C . n A 1 63 ASP 63 63 63 ASP ASP C . n A 1 64 VAL 64 64 64 VAL VAL C . n A 1 65 SER 65 65 65 SER SER C . n A 1 66 GLY 66 66 66 GLY GLY C . n A 1 67 PRO 67 67 67 PRO PRO C . n A 1 68 LYS 68 68 68 LYS LYS C . n A 1 69 LEU 69 69 69 LEU LEU C . n A 1 70 THR 70 70 70 THR THR C . n A 1 71 GLY 71 71 71 GLY GLY C . n A 1 72 ALA 72 72 72 ALA ALA C . n A 1 73 LEU 73 73 73 LEU LEU C . n A 1 74 ILE 74 74 74 ILE ILE C . n A 1 75 GLY 75 75 75 GLY GLY C . n A 1 76 ILE 76 76 76 ILE ILE C . n A 1 77 LEU 77 77 77 LEU LEU C . n A 1 78 SER 78 78 78 SER SER C . n A 1 79 LEU 79 79 79 LEU LEU C . n A 1 80 PHE 80 80 80 PHE PHE C . n A 1 81 VAL 81 81 81 VAL VAL C . n A 1 82 GLU 82 82 82 GLU GLU C . n A 1 83 SER 83 83 83 SER SER C . n A 1 84 PRO 84 84 84 PRO PRO C . n A 1 85 GLY 85 85 85 GLY GLY C . n A 1 86 GLN 86 86 86 GLN GLN C . n A 1 87 LEU 87 87 87 LEU LEU C . n A 1 88 ILE 88 88 88 ILE ILE C . n A 1 89 GLN 89 89 89 GLN GLN C . n A 1 90 ARG 90 90 90 ARG ARG C . n A 1 91 ILE 91 91 91 ILE ILE C . n A 1 92 THR 92 92 92 THR THR C . n A 1 93 ASP 93 93 93 ASP ASP C . n A 1 94 ASP 94 94 94 ASP ASP C . n A 1 95 PRO 95 95 95 PRO PRO C . n A 1 96 ASP 96 96 96 ASP ASP C . n A 1 97 VAL 97 97 97 VAL VAL C . n A 1 98 SER 98 98 98 SER SER C . n A 1 99 ILE 99 99 99 ILE ILE C . n A 1 100 ARG 100 100 100 ARG ARG C . n A 1 101 LEU 101 101 101 LEU LEU C . n A 1 102 LEU 102 102 102 LEU LEU C . n A 1 103 GLU 103 103 103 GLU GLU C . n A 1 104 VAL 104 104 104 VAL VAL C . n A 1 105 VAL 105 105 105 VAL VAL C . n A 1 106 GLN 106 106 106 GLN GLN C . n A 1 107 SER 107 107 107 SER SER C . n A 1 108 ASP 108 108 108 ASP ASP C . n A 1 109 GLN 109 109 109 GLN GLN C . n A 1 110 SER 110 110 110 SER SER C . n A 1 111 GLN 111 111 111 GLN GLN C . n A 1 112 SER 112 112 112 SER SER C . n A 1 113 GLY 113 113 113 GLY GLY C . n A 1 114 LEU 114 114 114 LEU LEU C . n A 1 115 THR 115 115 115 THR THR C . n A 1 116 PHE 116 116 116 PHE PHE C . n A 1 117 ALA 117 117 117 ALA ALA C . n A 1 118 SER 118 118 ? ? ? C . n A 1 119 ARG 119 119 ? ? ? C . n A 1 120 GLY 120 120 ? ? ? C . n A 1 121 THR 121 121 ? ? ? C . n A 1 122 ASN 122 122 ? ? ? C . n A 1 123 MET 123 123 123 MET MET C . n A 1 124 GLU 124 124 124 GLU GLU C . n A 1 125 ASP 125 125 125 ASP ASP C . n A 1 126 GLU 126 126 126 GLU GLU C . n A 1 127 ALA 127 127 127 ALA ALA C . n A 1 128 ASP 128 128 128 ASP ASP C . n A 1 129 GLN 129 129 129 GLN GLN C . n A 1 130 TYR 130 130 130 TYR TYR C . n A 1 131 PHE 131 131 131 PHE PHE C . n A 1 132 SER 132 132 132 SER SER C . n A 1 133 HIS 133 133 ? ? ? C . n A 1 134 ASP 134 134 ? ? ? C . n A 1 135 ASP 135 135 ? ? ? C . n A 1 136 PRO 136 136 ? ? ? C . n A 1 137 ILE 137 137 ? ? ? C . n A 1 138 SER 138 138 ? ? ? C . n A 1 139 SER 139 139 ? ? ? C . n A 1 140 ASP 140 140 ? ? ? C . n A 1 141 GLN 141 141 141 GLN GLN C . n A 1 142 SER 142 142 142 SER SER C . n A 1 143 ARG 143 143 143 ARG ARG C . n A 1 144 PHE 144 144 144 PHE PHE C . n A 1 145 GLY 145 145 145 GLY GLY C . n A 1 146 TRP 146 146 146 TRP TRP C . n A 1 147 PHE 147 147 147 PHE PHE C . n A 1 148 GLU 148 148 148 GLU GLU C . n A 1 149 ASN 149 149 149 ASN ASN C . n A 1 150 LYS 150 150 150 LYS LYS C . n A 1 151 GLU 151 151 151 GLU GLU C . n A 1 152 ILE 152 152 152 ILE ILE C . n A 1 153 SER 153 153 153 SER SER C . n A 1 154 ASP 154 154 154 ASP ASP C . n A 1 155 ILE 155 155 155 ILE ILE C . n A 1 156 GLU 156 156 156 GLU GLU C . n A 1 157 VAL 157 157 157 VAL VAL C . n A 1 158 GLN 158 158 158 GLN GLN C . n A 1 159 ASP 159 159 159 ASP ASP C . n A 1 160 PRO 160 160 160 PRO PRO C . n A 1 161 GLU 161 161 161 GLU GLU C . n A 1 162 GLY 162 162 162 GLY GLY C . n A 1 163 PHE 163 163 163 PHE PHE C . n A 1 164 ASN 164 164 164 ASN ASN C . n A 1 165 MET 165 165 165 MET MET C . n A 1 166 ILE 166 166 166 ILE ILE C . n A 1 167 LEU 167 167 167 LEU LEU C . n A 1 168 GLY 168 168 168 GLY GLY C . n A 1 169 THR 169 169 169 THR THR C . n A 1 170 ILE 170 170 170 ILE ILE C . n A 1 171 LEU 171 171 171 LEU LEU C . n A 1 172 ALA 172 172 172 ALA ALA C . n A 1 173 GLN 173 173 173 GLN GLN C . n A 1 174 ILE 174 174 174 ILE ILE C . n A 1 175 TRP 175 175 175 TRP TRP C . n A 1 176 VAL 176 176 176 VAL VAL C . n A 1 177 LEU 177 177 177 LEU LEU C . n A 1 178 LEU 178 178 178 LEU LEU C . n A 1 179 ALA 179 179 179 ALA ALA C . n A 1 180 LYS 180 180 180 LYS LYS C . n A 1 181 ALA 181 181 181 ALA ALA C . n A 1 182 VAL 182 182 182 VAL VAL C . n A 1 183 THR 183 183 183 THR THR C . n A 1 184 ALA 184 184 184 ALA ALA C . n A 1 185 PRO 185 185 185 PRO PRO C . n A 1 186 ASP 186 186 186 ASP ASP C . n A 1 187 THR 187 187 187 THR THR C . n A 1 188 ALA 188 188 188 ALA ALA C . n A 1 189 ALA 189 189 189 ALA ALA C . n A 1 190 ASP 190 190 190 ASP ASP C . n A 1 191 SER 191 191 191 SER SER C . n A 1 192 GLU 192 192 192 GLU GLU C . n A 1 193 LEU 193 193 193 LEU LEU C . n A 1 194 ARG 194 194 194 ARG ARG C . n A 1 195 ARG 195 195 195 ARG ARG C . n A 1 196 TRP 196 196 196 TRP TRP C . n A 1 197 ILE 197 197 197 ILE ILE C . n A 1 198 LYS 198 198 198 LYS LYS C . n A 1 199 TYR 199 199 199 TYR TYR C . n A 1 200 THR 200 200 200 THR THR C . n A 1 201 GLN 201 201 201 GLN GLN C . n A 1 202 GLN 202 202 202 GLN GLN C . n A 1 203 ARG 203 203 203 ARG ARG C . n A 1 204 ARG 204 204 204 ARG ARG C . n A 1 205 VAL 205 205 205 VAL VAL C . n A 1 206 VAL 206 206 206 VAL VAL C . n A 1 207 GLY 207 207 207 GLY GLY C . n A 1 208 GLU 208 208 208 GLU GLU C . n A 1 209 PHE 209 209 209 PHE PHE C . n A 1 210 ARG 210 210 210 ARG ARG C . n A 1 211 LEU 211 211 211 LEU LEU C . n A 1 212 GLU 212 212 212 GLU GLU C . n A 1 213 ARG 213 213 213 ARG ARG C . n A 1 214 LYS 214 214 214 LYS LYS C . n A 1 215 TRP 215 215 215 TRP TRP C . n A 1 216 LEU 216 216 216 LEU LEU C . n A 1 217 ASP 217 217 217 ASP ASP C . n A 1 218 VAL 218 218 218 VAL VAL C . n A 1 219 VAL 219 219 219 VAL VAL C . n A 1 220 ARG 220 220 220 ARG ARG C . n A 1 221 ASN 221 221 221 ASN ASN C . n A 1 222 ARG 222 222 222 ARG ARG C . n A 1 223 ILE 223 223 223 ILE ILE C . n A 1 224 ALA 224 224 224 ALA ALA C . n A 1 225 GLU 225 225 225 GLU GLU C . n A 1 226 ASP 226 226 226 ASP ASP C . n A 1 227 LEU 227 227 227 LEU LEU C . n A 1 228 SER 228 228 228 SER SER C . n A 1 229 LEU 229 229 229 LEU LEU C . n A 1 230 ARG 230 230 230 ARG ARG C . n A 1 231 ARG 231 231 231 ARG ARG C . n A 1 232 PHE 232 232 232 PHE PHE C . n A 1 233 MET 233 233 233 MET MET C . n A 1 234 VAL 234 234 234 VAL VAL C . n A 1 235 ALA 235 235 235 ALA ALA C . n A 1 236 LEU 236 236 236 LEU LEU C . n A 1 237 ILE 237 237 237 ILE ILE C . n A 1 238 LEU 238 238 238 LEU LEU C . n A 1 239 ASP 239 239 239 ASP ASP C . n A 1 240 ILE 240 240 240 ILE ILE C . n A 1 241 LYS 241 241 241 LYS LYS C . n A 1 242 ARG 242 242 242 ARG ARG C . n A 1 243 THR 243 243 243 THR THR C . n A 1 244 PRO 244 244 244 PRO PRO C . n A 1 245 GLY 245 245 245 GLY GLY C . n A 1 246 ASN 246 246 246 ASN ASN C . n A 1 247 LYS 247 247 247 LYS LYS C . n A 1 248 PRO 248 248 248 PRO PRO C . n A 1 249 ARG 249 249 249 ARG ARG C . n A 1 250 ILE 250 250 250 ILE ILE C . n A 1 251 ALA 251 251 251 ALA ALA C . n A 1 252 GLU 252 252 252 GLU GLU C . n A 1 253 MET 253 253 253 MET MET C . n A 1 254 ILE 254 254 254 ILE ILE C . n A 1 255 CYS 255 255 255 CYS CYS C . n A 1 256 ASP 256 256 256 ASP ASP C . n A 1 257 ILE 257 257 257 ILE ILE C . n A 1 258 ASP 258 258 258 ASP ASP C . n A 1 259 THR 259 259 259 THR THR C . n A 1 260 TYR 260 260 260 TYR TYR C . n A 1 261 ILE 261 261 261 ILE ILE C . n A 1 262 VAL 262 262 262 VAL VAL C . n A 1 263 GLU 263 263 263 GLU GLU C . n A 1 264 ALA 264 264 264 ALA ALA C . n A 1 265 GLY 265 265 265 GLY GLY C . n A 1 266 LEU 266 266 266 LEU LEU C . n A 1 267 ALA 267 267 267 ALA ALA C . n A 1 268 SER 268 268 268 SER SER C . n A 1 269 PHE 269 269 269 PHE PHE C . n A 1 270 ILE 270 270 270 ILE ILE C . n A 1 271 LEU 271 271 271 LEU LEU C . n A 1 272 THR 272 272 272 THR THR C . n A 1 273 ILE 273 273 273 ILE ILE C . n A 1 274 LYS 274 274 274 LYS LYS C . n A 1 275 PHE 275 275 275 PHE PHE C . n A 1 276 GLY 276 276 276 GLY GLY C . n A 1 277 ILE 277 277 277 ILE ILE C . n A 1 278 GLU 278 278 278 GLU GLU C . n A 1 279 THR 279 279 279 THR THR C . n A 1 280 MET 280 280 280 MET MET C . n A 1 281 TYR 281 281 281 TYR TYR C . n A 1 282 PRO 282 282 282 PRO PRO C . n A 1 283 ALA 283 283 283 ALA ALA C . n A 1 284 LEU 284 284 284 LEU LEU C . n A 1 285 GLY 285 285 285 GLY GLY C . n A 1 286 LEU 286 286 286 LEU LEU C . n A 1 287 HIS 287 287 287 HIS HIS C . n A 1 288 GLU 288 288 288 GLU GLU C . n A 1 289 PHE 289 289 289 PHE PHE C . n A 1 290 ALA 290 290 290 ALA ALA C . n A 1 291 GLY 291 291 291 GLY GLY C . n A 1 292 GLU 292 292 292 GLU GLU C . n A 1 293 LEU 293 293 293 LEU LEU C . n A 1 294 SER 294 294 294 SER SER C . n A 1 295 THR 295 295 295 THR THR C . n A 1 296 LEU 296 296 296 LEU LEU C . n A 1 297 GLU 297 297 297 GLU GLU C . n A 1 298 SER 298 298 298 SER SER C . n A 1 299 LEU 299 299 299 LEU LEU C . n A 1 300 MET 300 300 300 MET MET C . n A 1 301 ASN 301 301 301 ASN ASN C . n A 1 302 LEU 302 302 302 LEU LEU C . n A 1 303 TYR 303 303 303 TYR TYR C . n A 1 304 GLN 304 304 304 GLN GLN C . n A 1 305 GLN 305 305 305 GLN GLN C . n A 1 306 MET 306 306 306 MET MET C . n A 1 307 GLY 307 307 307 GLY GLY C . n A 1 308 GLU 308 308 308 GLU GLU C . n A 1 309 THR 309 309 309 THR THR C . n A 1 310 ALA 310 310 310 ALA ALA C . n A 1 311 PRO 311 311 311 PRO PRO C . n A 1 312 TYR 312 312 312 TYR TYR C . n A 1 313 MET 313 313 313 MET MET C . n A 1 314 VAL 314 314 314 VAL VAL C . n A 1 315 ILE 315 315 315 ILE ILE C . n A 1 316 LEU 316 316 316 LEU LEU C . n A 1 317 GLU 317 317 317 GLU GLU C . n A 1 318 ASN 318 318 318 ASN ASN C . n A 1 319 SER 319 319 319 SER SER C . n A 1 320 ILE 320 320 320 ILE ILE C . n A 1 321 GLN 321 321 321 GLN GLN C . n A 1 322 ASN 322 322 322 ASN ASN C . n A 1 323 LYS 323 323 323 LYS LYS C . n A 1 324 PHE 324 324 324 PHE PHE C . n A 1 325 SER 325 325 325 SER SER C . n A 1 326 ALA 326 326 326 ALA ALA C . n A 1 327 GLY 327 327 327 GLY GLY C . n A 1 328 SER 328 328 328 SER SER C . n A 1 329 TYR 329 329 329 TYR TYR C . n A 1 330 PRO 330 330 330 PRO PRO C . n A 1 331 LEU 331 331 331 LEU LEU C . n A 1 332 LEU 332 332 332 LEU LEU C . n A 1 333 TRP 333 333 333 TRP TRP C . n A 1 334 SER 334 334 334 SER SER C . n A 1 335 TYR 335 335 335 TYR TYR C . n A 1 336 ALA 336 336 336 ALA ALA C . n A 1 337 MET 337 337 337 MET MET C . n A 1 338 GLY 338 338 338 GLY GLY C . n A 1 339 VAL 339 339 339 VAL VAL C . n A 1 340 GLY 340 340 340 GLY GLY C . n A 1 341 VAL 341 341 341 VAL VAL C . n A 1 342 GLU 342 342 342 GLU GLU C . n A 1 343 LEU 343 343 343 LEU LEU C . n A 1 344 GLU 344 344 344 GLU GLU C . n A 1 345 ASN 345 345 345 ASN ASN C . n A 1 346 SER 346 346 346 SER SER C . n A 1 347 MET 347 347 347 MET MET C . n A 1 348 GLY 348 348 348 GLY GLY C . n A 1 349 GLY 349 349 349 GLY GLY C . n A 1 350 LEU 350 350 350 LEU LEU C . n A 1 351 ASN 351 351 351 ASN ASN C . n A 1 352 PHE 352 352 352 PHE PHE C . n A 1 353 GLY 353 353 353 GLY GLY C . n A 1 354 ARG 354 354 354 ARG ARG C . n A 1 355 SER 355 355 355 SER SER C . n A 1 356 TYR 356 356 356 TYR TYR C . n A 1 357 PHE 357 357 357 PHE PHE C . n A 1 358 ASP 358 358 358 ASP ASP C . n A 1 359 PRO 359 359 359 PRO PRO C . n A 1 360 ALA 360 360 360 ALA ALA C . n A 1 361 TYR 361 361 361 TYR TYR C . n A 1 362 PHE 362 362 362 PHE PHE C . n A 1 363 ARG 363 363 363 ARG ARG C . n A 1 364 LEU 364 364 364 LEU LEU C . n A 1 365 GLY 365 365 365 GLY GLY C . n A 1 366 GLN 366 366 366 GLN GLN C . n A 1 367 GLU 367 367 367 GLU GLU C . n A 1 368 MET 368 368 368 MET MET C . n A 1 369 VAL 369 369 369 VAL VAL C . n A 1 370 ARG 370 370 370 ARG ARG C . n A 1 371 ARG 371 371 371 ARG ARG C . n A 1 372 SER 372 372 372 SER SER C . n A 1 373 ALA 373 373 373 ALA ALA C . n A 1 374 GLY 374 374 374 GLY GLY C . n A 1 375 LYS 375 375 375 LYS LYS C . n A 1 376 VAL 376 376 376 VAL VAL C . n A 1 377 SER 377 377 377 SER SER C . n A 1 378 SER 378 378 ? ? ? C . n A 1 379 THR 379 379 ? ? ? C . n A 1 380 LEU 380 380 ? ? ? C . n A 1 381 ALA 381 381 ? ? ? C . n A 1 382 SER 382 382 ? ? ? C . n A 1 383 GLU 383 383 ? ? ? C . n A 1 384 LEU 384 384 ? ? ? C . n A 1 385 GLY 385 385 ? ? ? C . n A 1 386 ILE 386 386 ? ? ? C . n A 1 387 THR 387 387 ? ? ? C . n A 1 388 ALA 388 388 ? ? ? C . n A 1 389 GLU 389 389 ? ? ? C . n A 1 390 ASP 390 390 ? ? ? C . n A 1 391 ALA 391 391 ? ? ? C . n A 1 392 ARG 392 392 ? ? ? C . n A 1 393 LEU 393 393 ? ? ? C . n A 1 394 VAL 394 394 ? ? ? C . n A 1 395 SER 395 395 ? ? ? C . n A 1 396 GLU 396 396 ? ? ? C . n A 1 397 ILE 397 397 ? ? ? C . n A 1 398 ALA 398 398 ? ? ? C . n A 1 399 MET 399 399 ? ? ? C . n A 1 400 HIS 400 400 ? ? ? C . n A 1 401 THR 401 401 ? ? ? C . n A 1 402 THR 402 402 ? ? ? C . n A 1 403 GLU 403 403 ? ? ? C . n A 1 404 ASP 404 404 ? ? ? C . n A 1 405 LYS 405 405 ? ? ? C . n A 1 406 VAL 406 406 ? ? ? C . n A 1 407 GLU 407 407 ? ? ? C . n A 1 408 HIS 408 408 ? ? ? C . n A 1 409 HIS 409 409 ? ? ? C . n A 1 410 HIS 410 410 ? ? ? C . n A 1 411 HIS 411 411 ? ? ? C . n A 1 412 HIS 412 412 ? ? ? C . n A 1 413 HIS 413 413 ? ? ? C . n A 1 414 HIS 414 414 ? ? ? C . n A 1 415 HIS 415 415 ? ? ? C . n B 2 1 A 1 1 1 A A E . n B 2 2 C 2 2 2 C C E . n B 2 3 C 3 3 3 C C E . n B 2 4 A 4 4 4 A A E . n B 2 5 G 5 5 5 G G E . n B 2 6 A 6 6 6 A A E . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details 'UCSF CHIMERA 1.11.2_b41362.' _pdbx_struct_assembly.oligomeric_details 30-meric _pdbx_struct_assembly.oligomeric_count 30 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'point symmetry operation' ? ? -0.598050 0.801459 0.000000 0.00006 -0.801459 -0.598050 -0.000000 -0.00001 -0.000000 -0.000000 1.000000 -31.47973 3 'point symmetry operation' ? ? -0.912756 0.408504 0.000000 0.00004 -0.408504 -0.912756 0.000000 0.00009 0.000000 0.000000 1.000000 -27.54496 4 'point symmetry operation' ? ? -0.996122 -0.087987 0.000000 0.00007 0.087987 -0.996122 -0.000000 -0.00004 0.000001 -0.000000 1.000000 -23.60985 5 'point symmetry operation' ? ? -0.827017 -0.562177 -0.000000 0.00000 0.562177 -0.827017 0.000000 0.00007 -0.000000 0.000000 1.000000 -19.67487 6 'point symmetry operation' ? ? -0.448302 -0.893882 -0.000000 -0.00012 0.893882 -0.448302 0.000000 -0.00001 -0.000000 -0.000000 1.000000 -15.73980 7 'point symmetry operation' ? ? 0.044036 -0.999030 -0.000000 -0.00014 0.999030 0.044036 0.000000 0.00013 -0.000000 -0.000001 1.000000 -11.80482 8 'point symmetry operation' ? ? 0.525213 -0.850971 -0.000000 -0.00012 0.850971 0.525213 0.000000 -0.00000 -0.000000 -0.000000 1.000000 -7.86990 9 'point symmetry operation' ? ? 0.873274 -0.487230 0.000000 0.00012 0.487230 0.873274 0.000000 -0.00004 0.000000 0.000000 1.000000 -3.93496 10 'point symmetry operation' ? ? 0.873274 0.487230 0.000000 0.00009 -0.487230 0.873274 -0.000000 -0.00000 -0.000000 0.000000 1.000000 3.93498 11 'point symmetry operation' ? ? 0.525213 0.850971 0.000000 -0.00011 -0.850971 0.525213 -0.000000 -0.00000 -0.000000 0.000000 1.000000 7.86997 12 'point symmetry operation' ? ? 0.044036 0.999030 0.000000 -0.00001 -0.999030 0.044036 0.000000 0.00013 0.000000 -0.000000 1.000000 11.80484 13 'point symmetry operation' ? ? -0.448303 0.893882 0.000000 -0.00010 -0.893882 -0.448303 0.000000 0.00010 0.000000 0.000000 1.000000 15.73986 14 'point symmetry operation' ? ? -0.827017 0.562177 0.000000 0.00014 -0.562177 -0.827017 -0.000000 -0.00004 0.000000 -0.000001 1.000000 19.67474 15 'point symmetry operation' ? ? -0.996122 0.087987 0.000000 0.00007 -0.087987 -0.996122 -0.000000 -0.00009 0.000000 -0.000000 1.000000 23.60982 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-06-12 2 'Structure model' 1 1 2019-07-03 3 'Structure model' 1 2 2019-11-06 4 'Structure model' 1 3 2019-12-18 5 'Structure model' 1 4 2020-07-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' Other 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' em_admin 2 2 'Structure model' pdbx_database_proc 3 2 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' citation 5 4 'Structure model' atom_sites 6 5 'Structure model' refine # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_em_admin.last_update' 2 2 'Structure model' '_pdbx_struct_oper_list.matrix[1][1]' 3 2 'Structure model' '_pdbx_struct_oper_list.matrix[1][2]' 4 2 'Structure model' '_pdbx_struct_oper_list.matrix[1][3]' 5 2 'Structure model' '_pdbx_struct_oper_list.matrix[2][1]' 6 2 'Structure model' '_pdbx_struct_oper_list.matrix[2][2]' 7 2 'Structure model' '_pdbx_struct_oper_list.matrix[2][3]' 8 2 'Structure model' '_pdbx_struct_oper_list.matrix[3][1]' 9 2 'Structure model' '_pdbx_struct_oper_list.matrix[3][2]' 10 2 'Structure model' '_pdbx_struct_oper_list.matrix[3][3]' 11 2 'Structure model' '_pdbx_struct_oper_list.name' 12 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 13 2 'Structure model' '_pdbx_struct_oper_list.type' 14 2 'Structure model' '_pdbx_struct_oper_list.vector[1]' 15 2 'Structure model' '_pdbx_struct_oper_list.vector[2]' 16 2 'Structure model' '_pdbx_struct_oper_list.vector[3]' 17 3 'Structure model' '_citation.journal_volume' 18 3 'Structure model' '_citation.page_first' 19 3 'Structure model' '_citation.page_last' 20 4 'Structure model' '_atom_sites.fract_transf_matrix[1][1]' 21 4 'Structure model' '_atom_sites.fract_transf_matrix[2][2]' 22 4 'Structure model' '_atom_sites.fract_transf_matrix[3][3]' 23 5 'Structure model' '_refine.pdbx_refine_id' # _em_3d_reconstruction.entry_id 6H5S _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 102353 _em_3d_reconstruction.resolution 3.3 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type HELICAL _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.euler_angles_details ? # _em_buffer.id 1 _em_buffer.details '50 mM Na-phosphate pH 6, 150 mM NaCl, 2 mM DTT' _em_buffer.pH 6 _em_buffer.specimen_id 1 _em_buffer.name ? # loop_ _em_entity_assembly.id _em_entity_assembly.parent_id _em_entity_assembly.details _em_entity_assembly.name _em_entity_assembly.source _em_entity_assembly.type _em_entity_assembly.entity_id_list _em_entity_assembly.synonym _em_entity_assembly.oligomeric_details 1 0 ? ;Cryo-EM map of in vitro assembled Measles virus N into nucleocapsid-like particles (NCLPs) bound to viral genomic 5-prime RNA hexamers. ; 'MULTIPLE SOURCES' COMPLEX '1, 2' ? ? 2 1 ? 'Measles virus N' RECOMBINANT COMPLEX 1 ? ? 3 1 ? '5-prime RNA' RECOMBINANT COMPLEX 2 ? ? # _em_imaging.id 1 _em_imaging.entry_id 6H5S _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen ? _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI POLARA 300' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_max ? _em_imaging.nominal_defocus_min ? _em_imaging.nominal_magnification ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model ? _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_sample_support.id 1 _em_sample_support.specimen_id 1 _em_sample_support.method ? _em_sample_support.film_material ? _em_sample_support.grid_material ? _em_sample_support.grid_mesh_size ? _em_sample_support.grid_type ? _em_sample_support.details ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature 293.15 _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity 100 _em_vitrification.instrument 'FEI VITROBOT MARK IV' _em_vitrification.entry_id 6H5S _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 6H5S _em_experiment.id 1 _em_experiment.aggregation_state 'HELICAL ARRAY' _em_experiment.reconstruction_method HELICAL _em_experiment.entity_assembly_id 1 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 C _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 236 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 C _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 236 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 C _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 236 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 129.42 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation 14.12 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN C 14 ? ? -131.27 -37.62 2 1 THR C 21 ? ? -122.97 -167.28 3 1 ALA C 27 ? ? -95.05 45.92 4 1 ASP C 42 ? ? 75.65 176.64 5 1 SER C 83 ? ? 54.20 77.90 6 1 TRP C 146 ? ? -160.42 -169.34 7 1 LYS C 180 ? ? -140.98 45.99 8 1 THR C 187 ? ? -92.51 30.84 9 1 PHE C 209 ? ? -94.39 56.20 10 1 ALA C 283 ? ? -91.75 50.96 11 1 ASP C 358 ? ? 53.00 77.50 12 1 SER C 372 ? ? -100.98 65.12 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 C MET 1 ? A MET 1 2 1 Y 1 C SER 118 ? A SER 118 3 1 Y 1 C ARG 119 ? A ARG 119 4 1 Y 1 C GLY 120 ? A GLY 120 5 1 Y 1 C THR 121 ? A THR 121 6 1 Y 1 C ASN 122 ? A ASN 122 7 1 Y 1 C HIS 133 ? A HIS 133 8 1 Y 1 C ASP 134 ? A ASP 134 9 1 Y 1 C ASP 135 ? A ASP 135 10 1 Y 1 C PRO 136 ? A PRO 136 11 1 Y 1 C ILE 137 ? A ILE 137 12 1 Y 1 C SER 138 ? A SER 138 13 1 Y 1 C SER 139 ? A SER 139 14 1 Y 1 C ASP 140 ? A ASP 140 15 1 Y 1 C SER 378 ? A SER 378 16 1 Y 1 C THR 379 ? A THR 379 17 1 Y 1 C LEU 380 ? A LEU 380 18 1 Y 1 C ALA 381 ? A ALA 381 19 1 Y 1 C SER 382 ? A SER 382 20 1 Y 1 C GLU 383 ? A GLU 383 21 1 Y 1 C LEU 384 ? A LEU 384 22 1 Y 1 C GLY 385 ? A GLY 385 23 1 Y 1 C ILE 386 ? A ILE 386 24 1 Y 1 C THR 387 ? A THR 387 25 1 Y 1 C ALA 388 ? A ALA 388 26 1 Y 1 C GLU 389 ? A GLU 389 27 1 Y 1 C ASP 390 ? A ASP 390 28 1 Y 1 C ALA 391 ? A ALA 391 29 1 Y 1 C ARG 392 ? A ARG 392 30 1 Y 1 C LEU 393 ? A LEU 393 31 1 Y 1 C VAL 394 ? A VAL 394 32 1 Y 1 C SER 395 ? A SER 395 33 1 Y 1 C GLU 396 ? A GLU 396 34 1 Y 1 C ILE 397 ? A ILE 397 35 1 Y 1 C ALA 398 ? A ALA 398 36 1 Y 1 C MET 399 ? A MET 399 37 1 Y 1 C HIS 400 ? A HIS 400 38 1 Y 1 C THR 401 ? A THR 401 39 1 Y 1 C THR 402 ? A THR 402 40 1 Y 1 C GLU 403 ? A GLU 403 41 1 Y 1 C ASP 404 ? A ASP 404 42 1 Y 1 C LYS 405 ? A LYS 405 43 1 Y 1 C VAL 406 ? A VAL 406 44 1 Y 1 C GLU 407 ? A GLU 407 45 1 Y 1 C HIS 408 ? A HIS 408 46 1 Y 1 C HIS 409 ? A HIS 409 47 1 Y 1 C HIS 410 ? A HIS 410 48 1 Y 1 C HIS 411 ? A HIS 411 49 1 Y 1 C HIS 412 ? A HIS 412 50 1 Y 1 C HIS 413 ? A HIS 413 51 1 Y 1 C HIS 414 ? A HIS 414 52 1 Y 1 C HIS 415 ? A HIS 415 # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' _em_ctf_correction.details ? # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.units ? _em_entity_assembly_molwt.value ? # loop_ _em_entity_assembly_naturalsource.id _em_entity_assembly_naturalsource.entity_assembly_id _em_entity_assembly_naturalsource.cell _em_entity_assembly_naturalsource.cellular_location _em_entity_assembly_naturalsource.ncbi_tax_id _em_entity_assembly_naturalsource.organ _em_entity_assembly_naturalsource.organelle _em_entity_assembly_naturalsource.organism _em_entity_assembly_naturalsource.strain _em_entity_assembly_naturalsource.tissue 2 2 ? ? 11234 ? ? 'Measles virus' ? ? 3 3 ? ? 32630 ? ? 'synthetic construct' ? ? # loop_ _em_entity_assembly_recombinant.id _em_entity_assembly_recombinant.entity_assembly_id _em_entity_assembly_recombinant.cell _em_entity_assembly_recombinant.ncbi_tax_id _em_entity_assembly_recombinant.organism _em_entity_assembly_recombinant.plasmid _em_entity_assembly_recombinant.strain 2 2 ? 562 'Escherichia coli' ? ? 3 3 ? 32630 'synthetic construct' ? ? # _em_helical_entity.id 1 _em_helical_entity.image_processing_id 1 _em_helical_entity.angular_rotation_per_subunit -29.15924186 _em_helical_entity.axial_rise_per_subunit 3.934877693 _em_helical_entity.axial_symmetry C1 _em_helical_entity.details ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 30 _em_image_recording.average_exposure_time ? _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K2 SUMMIT (4k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # _em_imaging_optics.id 1 _em_imaging_optics.imaging_id 1 _em_imaging_optics.chr_aberration_corrector ? _em_imaging_optics.energyfilter_lower ? _em_imaging_optics.energyfilter_name ? _em_imaging_optics.energyfilter_upper ? _em_imaging_optics.energyfilter_slit_width ? _em_imaging_optics.phase_plate ? _em_imaging_optics.sph_aberration_corrector ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'PARTICLE SELECTION' ? ? ? 1 ? ? 2 'IMAGE ACQUISITION' ? ? ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? ? ? 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? ? ? ? ? ? 8 'MODEL REFINEMENT' ? ? ? ? ? ? 9 OTHER ? ? ? ? ? ? 10 'INITIAL EULER ASSIGNMENT' ? ? ? 1 ? ? 11 'FINAL EULER ASSIGNMENT' ? ? ? 1 ? ? 12 CLASSIFICATION ? ? ? 1 ? ? 13 RECONSTRUCTION ? ? ? 1 ? ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration 1 _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # loop_ _pdbx_audit_support.country _pdbx_audit_support.funding_organization _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal France GRAL ANR-10-LABX-49-01 1 France FRISBI ANR-10-INSB-05-02 2 ? 'European Commission' 'EMBOCOFUND2012, GA-2012-600394' 3 France 'Fondation Recherche Medicale (FRM)' ARF20160936266 4 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support microscopy _pdbx_struct_assembly_auth_evidence.details ? #