data_6H97 # _entry.id 6H97 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6H97 pdb_00006h97 10.2210/pdb6h97/pdb WWPDB D_1200011289 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-11-21 2 'Structure model' 1 1 2019-04-24 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' pdbx_database_proc 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6H97 _pdbx_database_status.recvd_initial_deposition_date 2018-08-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Koehnke, J.' 1 ? 'Sikandar, A.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 140 _citation.language ? _citation.page_first 16641 _citation.page_last 16649 _citation.title 'Adaptation of a Bacterial Multidrug Resistance System Revealed by the Structure and Function of AlbA.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.8b08895 _citation.pdbx_database_id_PubMed 30422653 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sikandar, A.' 1 ? primary 'Cirnski, K.' 2 ? primary 'Testolin, G.' 3 ? primary 'Volz, C.' 4 ? primary 'Bronstrup, M.' 5 ? primary 'Kalinina, O.V.' 6 ? primary 'Muller, R.' 7 ? primary 'Koehnke, J.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Albicidin resistance protein' 26479.945 1 ? ? ? ? 2 water nat water 18.015 5 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMKMYDRWFSQQELQVLPFAEQDEQRNQTWLELVGEAQQLMDERCPADEPRAIALATRWMEQLEQDTAGRPEFLTRLNE MHAAEPQMREQTGVTPEMIDFIVRAFAESKLAIWARYLNDEELAFTRQHYFDRLMEWPALVADLHRACREKRDPASPGGQ QLAQRWLALFQSYAGKDAQTQQKFRYAMEQEPHLMKGTWMTSEVLSWLQQAIGVMMRQAQGLPPNN ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMKMYDRWFSQQELQVLPFAEQDEQRNQTWLELVGEAQQLMDERCPADEPRAIALATRWMEQLEQDTAGRPEFLTRLNE MHAAEPQMREQTGVTPEMIDFIVRAFAESKLAIWARYLNDEELAFTRQHYFDRLMEWPALVADLHRACREKRDPASPGGQ QLAQRWLALFQSYAGKDAQTQQKFRYAMEQEPHLMKGTWMTSEVLSWLQQAIGVMMRQAQGLPPNN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 LYS n 1 5 MET n 1 6 TYR n 1 7 ASP n 1 8 ARG n 1 9 TRP n 1 10 PHE n 1 11 SER n 1 12 GLN n 1 13 GLN n 1 14 GLU n 1 15 LEU n 1 16 GLN n 1 17 VAL n 1 18 LEU n 1 19 PRO n 1 20 PHE n 1 21 ALA n 1 22 GLU n 1 23 GLN n 1 24 ASP n 1 25 GLU n 1 26 GLN n 1 27 ARG n 1 28 ASN n 1 29 GLN n 1 30 THR n 1 31 TRP n 1 32 LEU n 1 33 GLU n 1 34 LEU n 1 35 VAL n 1 36 GLY n 1 37 GLU n 1 38 ALA n 1 39 GLN n 1 40 GLN n 1 41 LEU n 1 42 MET n 1 43 ASP n 1 44 GLU n 1 45 ARG n 1 46 CYS n 1 47 PRO n 1 48 ALA n 1 49 ASP n 1 50 GLU n 1 51 PRO n 1 52 ARG n 1 53 ALA n 1 54 ILE n 1 55 ALA n 1 56 LEU n 1 57 ALA n 1 58 THR n 1 59 ARG n 1 60 TRP n 1 61 MET n 1 62 GLU n 1 63 GLN n 1 64 LEU n 1 65 GLU n 1 66 GLN n 1 67 ASP n 1 68 THR n 1 69 ALA n 1 70 GLY n 1 71 ARG n 1 72 PRO n 1 73 GLU n 1 74 PHE n 1 75 LEU n 1 76 THR n 1 77 ARG n 1 78 LEU n 1 79 ASN n 1 80 GLU n 1 81 MET n 1 82 HIS n 1 83 ALA n 1 84 ALA n 1 85 GLU n 1 86 PRO n 1 87 GLN n 1 88 MET n 1 89 ARG n 1 90 GLU n 1 91 GLN n 1 92 THR n 1 93 GLY n 1 94 VAL n 1 95 THR n 1 96 PRO n 1 97 GLU n 1 98 MET n 1 99 ILE n 1 100 ASP n 1 101 PHE n 1 102 ILE n 1 103 VAL n 1 104 ARG n 1 105 ALA n 1 106 PHE n 1 107 ALA n 1 108 GLU n 1 109 SER n 1 110 LYS n 1 111 LEU n 1 112 ALA n 1 113 ILE n 1 114 TRP n 1 115 ALA n 1 116 ARG n 1 117 TYR n 1 118 LEU n 1 119 ASN n 1 120 ASP n 1 121 GLU n 1 122 GLU n 1 123 LEU n 1 124 ALA n 1 125 PHE n 1 126 THR n 1 127 ARG n 1 128 GLN n 1 129 HIS n 1 130 TYR n 1 131 PHE n 1 132 ASP n 1 133 ARG n 1 134 LEU n 1 135 MET n 1 136 GLU n 1 137 TRP n 1 138 PRO n 1 139 ALA n 1 140 LEU n 1 141 VAL n 1 142 ALA n 1 143 ASP n 1 144 LEU n 1 145 HIS n 1 146 ARG n 1 147 ALA n 1 148 CYS n 1 149 ARG n 1 150 GLU n 1 151 LYS n 1 152 ARG n 1 153 ASP n 1 154 PRO n 1 155 ALA n 1 156 SER n 1 157 PRO n 1 158 GLY n 1 159 GLY n 1 160 GLN n 1 161 GLN n 1 162 LEU n 1 163 ALA n 1 164 GLN n 1 165 ARG n 1 166 TRP n 1 167 LEU n 1 168 ALA n 1 169 LEU n 1 170 PHE n 1 171 GLN n 1 172 SER n 1 173 TYR n 1 174 ALA n 1 175 GLY n 1 176 LYS n 1 177 ASP n 1 178 ALA n 1 179 GLN n 1 180 THR n 1 181 GLN n 1 182 GLN n 1 183 LYS n 1 184 PHE n 1 185 ARG n 1 186 TYR n 1 187 ALA n 1 188 MET n 1 189 GLU n 1 190 GLN n 1 191 GLU n 1 192 PRO n 1 193 HIS n 1 194 LEU n 1 195 MET n 1 196 LYS n 1 197 GLY n 1 198 THR n 1 199 TRP n 1 200 MET n 1 201 THR n 1 202 SER n 1 203 GLU n 1 204 VAL n 1 205 LEU n 1 206 SER n 1 207 TRP n 1 208 LEU n 1 209 GLN n 1 210 GLN n 1 211 ALA n 1 212 ILE n 1 213 GLY n 1 214 VAL n 1 215 MET n 1 216 MET n 1 217 ARG n 1 218 GLN n 1 219 ALA n 1 220 GLN n 1 221 GLY n 1 222 LEU n 1 223 PRO n 1 224 PRO n 1 225 ASN n 1 226 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 226 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene albA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Klebsiella oxytoca' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 571 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 -1 GLY GLY A . n A 1 2 SER 2 -2 0 SER SER A . n A 1 3 MET 3 -1 1 MET MET A . n A 1 4 LYS 4 0 2 LYS LYS A . n A 1 5 MET 5 1 3 MET MET A . n A 1 6 TYR 6 2 4 TYR TYR A . n A 1 7 ASP 7 3 5 ASP ASP A . n A 1 8 ARG 8 4 6 ARG ARG A . n A 1 9 TRP 9 5 7 TRP TRP A . n A 1 10 PHE 10 6 8 PHE PHE A . n A 1 11 SER 11 7 9 SER SER A . n A 1 12 GLN 12 8 10 GLN GLN A . n A 1 13 GLN 13 9 11 GLN GLN A . n A 1 14 GLU 14 10 12 GLU GLU A . n A 1 15 LEU 15 11 13 LEU LEU A . n A 1 16 GLN 16 12 14 GLN GLN A . n A 1 17 VAL 17 13 15 VAL VAL A . n A 1 18 LEU 18 14 16 LEU LEU A . n A 1 19 PRO 19 15 17 PRO PRO A . n A 1 20 PHE 20 16 18 PHE PHE A . n A 1 21 ALA 21 17 19 ALA ALA A . n A 1 22 GLU 22 18 20 GLU GLU A . n A 1 23 GLN 23 19 21 GLN GLN A . n A 1 24 ASP 24 20 22 ASP ASP A . n A 1 25 GLU 25 21 23 GLU GLU A . n A 1 26 GLN 26 22 24 GLN GLN A . n A 1 27 ARG 27 23 25 ARG ARG A . n A 1 28 ASN 28 24 26 ASN ASN A . n A 1 29 GLN 29 25 27 GLN GLN A . n A 1 30 THR 30 26 28 THR THR A . n A 1 31 TRP 31 27 29 TRP TRP A . n A 1 32 LEU 32 28 30 LEU LEU A . n A 1 33 GLU 33 29 31 GLU GLU A . n A 1 34 LEU 34 30 32 LEU LEU A . n A 1 35 VAL 35 31 33 VAL VAL A . n A 1 36 GLY 36 32 34 GLY GLY A . n A 1 37 GLU 37 33 35 GLU GLU A . n A 1 38 ALA 38 34 36 ALA ALA A . n A 1 39 GLN 39 35 37 GLN GLN A . n A 1 40 GLN 40 36 38 GLN GLN A . n A 1 41 LEU 41 37 39 LEU LEU A . n A 1 42 MET 42 38 40 MET MET A . n A 1 43 ASP 43 39 41 ASP ASP A . n A 1 44 GLU 44 40 42 GLU GLU A . n A 1 45 ARG 45 41 43 ARG ARG A . n A 1 46 CYS 46 42 44 CYS CYS A . n A 1 47 PRO 47 43 45 PRO PRO A . n A 1 48 ALA 48 44 46 ALA ALA A . n A 1 49 ASP 49 45 47 ASP ASP A . n A 1 50 GLU 50 46 48 GLU GLU A . n A 1 51 PRO 51 47 49 PRO PRO A . n A 1 52 ARG 52 48 50 ARG ARG A . n A 1 53 ALA 53 49 51 ALA ALA A . n A 1 54 ILE 54 50 52 ILE ILE A . n A 1 55 ALA 55 51 53 ALA ALA A . n A 1 56 LEU 56 52 54 LEU LEU A . n A 1 57 ALA 57 53 55 ALA ALA A . n A 1 58 THR 58 54 56 THR THR A . n A 1 59 ARG 59 55 57 ARG ARG A . n A 1 60 TRP 60 56 58 TRP TRP A . n A 1 61 MET 61 57 59 MET MET A . n A 1 62 GLU 62 58 60 GLU GLU A . n A 1 63 GLN 63 59 61 GLN GLN A . n A 1 64 LEU 64 60 62 LEU LEU A . n A 1 65 GLU 65 61 63 GLU GLU A . n A 1 66 GLN 66 62 64 GLN GLN A . n A 1 67 ASP 67 63 65 ASP ASP A . n A 1 68 THR 68 64 66 THR THR A . n A 1 69 ALA 69 65 67 ALA ALA A . n A 1 70 GLY 70 66 68 GLY GLY A . n A 1 71 ARG 71 67 69 ARG ARG A . n A 1 72 PRO 72 68 70 PRO PRO A . n A 1 73 GLU 73 69 71 GLU GLU A . n A 1 74 PHE 74 70 72 PHE PHE A . n A 1 75 LEU 75 71 73 LEU LEU A . n A 1 76 THR 76 72 74 THR THR A . n A 1 77 ARG 77 73 75 ARG ARG A . n A 1 78 LEU 78 74 76 LEU LEU A . n A 1 79 ASN 79 75 77 ASN ASN A . n A 1 80 GLU 80 76 78 GLU GLU A . n A 1 81 MET 81 77 79 MET MET A . n A 1 82 HIS 82 78 80 HIS HIS A . n A 1 83 ALA 83 79 81 ALA ALA A . n A 1 84 ALA 84 80 82 ALA ALA A . n A 1 85 GLU 85 81 83 GLU GLU A . n A 1 86 PRO 86 82 84 PRO PRO A . n A 1 87 GLN 87 83 85 GLN GLN A . n A 1 88 MET 88 84 86 MET MET A . n A 1 89 ARG 89 85 87 ARG ARG A . n A 1 90 GLU 90 86 88 GLU GLU A . n A 1 91 GLN 91 87 89 GLN GLN A . n A 1 92 THR 92 88 90 THR THR A . n A 1 93 GLY 93 89 91 GLY GLY A . n A 1 94 VAL 94 90 92 VAL VAL A . n A 1 95 THR 95 91 93 THR THR A . n A 1 96 PRO 96 92 94 PRO PRO A . n A 1 97 GLU 97 93 95 GLU GLU A . n A 1 98 MET 98 94 96 MET MET A . n A 1 99 ILE 99 95 97 ILE ILE A . n A 1 100 ASP 100 96 98 ASP ASP A . n A 1 101 PHE 101 97 99 PHE PHE A . n A 1 102 ILE 102 98 100 ILE ILE A . n A 1 103 VAL 103 99 101 VAL VAL A . n A 1 104 ARG 104 100 102 ARG ARG A . n A 1 105 ALA 105 101 103 ALA ALA A . n A 1 106 PHE 106 102 104 PHE PHE A . n A 1 107 ALA 107 103 105 ALA ALA A . n A 1 108 GLU 108 104 106 GLU GLU A . n A 1 109 SER 109 105 107 SER SER A . n A 1 110 LYS 110 106 108 LYS LYS A . n A 1 111 LEU 111 107 109 LEU LEU A . n A 1 112 ALA 112 108 110 ALA ALA A . n A 1 113 ILE 113 109 111 ILE ILE A . n A 1 114 TRP 114 110 112 TRP TRP A . n A 1 115 ALA 115 111 113 ALA ALA A . n A 1 116 ARG 116 112 114 ARG ARG A . n A 1 117 TYR 117 113 115 TYR TYR A . n A 1 118 LEU 118 114 116 LEU LEU A . n A 1 119 ASN 119 115 117 ASN ASN A . n A 1 120 ASP 120 116 118 ASP ASP A . n A 1 121 GLU 121 117 119 GLU GLU A . n A 1 122 GLU 122 118 120 GLU GLU A . n A 1 123 LEU 123 119 121 LEU LEU A . n A 1 124 ALA 124 120 122 ALA ALA A . n A 1 125 PHE 125 121 123 PHE PHE A . n A 1 126 THR 126 122 124 THR THR A . n A 1 127 ARG 127 123 125 ARG ARG A . n A 1 128 GLN 128 124 126 GLN GLN A . n A 1 129 HIS 129 125 127 HIS HIS A . n A 1 130 TYR 130 126 128 TYR TYR A . n A 1 131 PHE 131 127 129 PHE PHE A . n A 1 132 ASP 132 128 130 ASP ASP A . n A 1 133 ARG 133 129 131 ARG ARG A . n A 1 134 LEU 134 130 132 LEU LEU A . n A 1 135 MET 135 131 133 MET MET A . n A 1 136 GLU 136 132 134 GLU GLU A . n A 1 137 TRP 137 133 135 TRP TRP A . n A 1 138 PRO 138 134 136 PRO PRO A . n A 1 139 ALA 139 135 137 ALA ALA A . n A 1 140 LEU 140 136 138 LEU LEU A . n A 1 141 VAL 141 137 139 VAL VAL A . n A 1 142 ALA 142 138 140 ALA ALA A . n A 1 143 ASP 143 139 141 ASP ASP A . n A 1 144 LEU 144 140 142 LEU LEU A . n A 1 145 HIS 145 141 143 HIS HIS A . n A 1 146 ARG 146 142 144 ARG ARG A . n A 1 147 ALA 147 143 145 ALA ALA A . n A 1 148 CYS 148 144 146 CYS CYS A . n A 1 149 ARG 149 145 147 ARG ARG A . n A 1 150 GLU 150 146 148 GLU GLU A . n A 1 151 LYS 151 147 149 LYS LYS A . n A 1 152 ARG 152 148 150 ARG ARG A . n A 1 153 ASP 153 149 151 ASP ASP A . n A 1 154 PRO 154 150 152 PRO PRO A . n A 1 155 ALA 155 151 153 ALA ALA A . n A 1 156 SER 156 152 154 SER SER A . n A 1 157 PRO 157 153 155 PRO PRO A . n A 1 158 GLY 158 154 156 GLY GLY A . n A 1 159 GLY 159 155 157 GLY GLY A . n A 1 160 GLN 160 156 158 GLN GLN A . n A 1 161 GLN 161 157 159 GLN GLN A . n A 1 162 LEU 162 158 160 LEU LEU A . n A 1 163 ALA 163 159 161 ALA ALA A . n A 1 164 GLN 164 160 162 GLN GLN A . n A 1 165 ARG 165 161 163 ARG ARG A . n A 1 166 TRP 166 162 164 TRP TRP A . n A 1 167 LEU 167 163 165 LEU LEU A . n A 1 168 ALA 168 164 166 ALA ALA A . n A 1 169 LEU 169 165 167 LEU LEU A . n A 1 170 PHE 170 166 168 PHE PHE A . n A 1 171 GLN 171 167 169 GLN GLN A . n A 1 172 SER 172 168 170 SER SER A . n A 1 173 TYR 173 169 171 TYR TYR A . n A 1 174 ALA 174 170 172 ALA ALA A . n A 1 175 GLY 175 171 173 GLY GLY A . n A 1 176 LYS 176 172 174 LYS LYS A . n A 1 177 ASP 177 173 175 ASP ASP A . n A 1 178 ALA 178 174 176 ALA ALA A . n A 1 179 GLN 179 175 177 GLN GLN A . n A 1 180 THR 180 176 178 THR THR A . n A 1 181 GLN 181 177 179 GLN GLN A . n A 1 182 GLN 182 178 180 GLN GLN A . n A 1 183 LYS 183 179 181 LYS LYS A . n A 1 184 PHE 184 180 182 PHE PHE A . n A 1 185 ARG 185 181 183 ARG ARG A . n A 1 186 TYR 186 182 184 TYR TYR A . n A 1 187 ALA 187 183 185 ALA ALA A . n A 1 188 MET 188 184 186 MET MET A . n A 1 189 GLU 189 185 187 GLU GLU A . n A 1 190 GLN 190 186 188 GLN GLN A . n A 1 191 GLU 191 187 189 GLU GLU A . n A 1 192 PRO 192 188 190 PRO PRO A . n A 1 193 HIS 193 189 191 HIS HIS A . n A 1 194 LEU 194 190 192 LEU LEU A . n A 1 195 MET 195 191 193 MET MET A . n A 1 196 LYS 196 192 194 LYS LYS A . n A 1 197 GLY 197 193 195 GLY GLY A . n A 1 198 THR 198 194 196 THR THR A . n A 1 199 TRP 199 195 197 TRP TRP A . n A 1 200 MET 200 196 198 MET MET A . n A 1 201 THR 201 197 199 THR THR A . n A 1 202 SER 202 198 200 SER SER A . n A 1 203 GLU 203 199 201 GLU GLU A . n A 1 204 VAL 204 200 202 VAL VAL A . n A 1 205 LEU 205 201 203 LEU LEU A . n A 1 206 SER 206 202 204 SER SER A . n A 1 207 TRP 207 203 205 TRP TRP A . n A 1 208 LEU 208 204 206 LEU LEU A . n A 1 209 GLN 209 205 207 GLN GLN A . n A 1 210 GLN 210 206 208 GLN GLN A . n A 1 211 ALA 211 207 209 ALA ALA A . n A 1 212 ILE 212 208 210 ILE ILE A . n A 1 213 GLY 213 209 211 GLY GLY A . n A 1 214 VAL 214 210 212 VAL VAL A . n A 1 215 MET 215 211 213 MET MET A . n A 1 216 MET 216 212 214 MET MET A . n A 1 217 ARG 217 213 215 ARG ARG A . n A 1 218 GLN 218 214 216 GLN GLN A . n A 1 219 ALA 219 215 217 ALA ALA A . n A 1 220 GLN 220 216 218 GLN GLN A . n A 1 221 GLY 221 217 219 GLY GLY A . n A 1 222 LEU 222 218 220 LEU LEU A . n A 1 223 PRO 223 219 221 PRO PRO A . n A 1 224 PRO 224 220 222 PRO PRO A . n A 1 225 ASN 225 221 223 ASN ASN A . n A 1 226 ASN 226 222 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 2 HOH HOH A . B 2 HOH 2 302 3 HOH HOH A . B 2 HOH 3 303 1 HOH HOH A . B 2 HOH 4 304 5 HOH HOH A . B 2 HOH 5 305 4 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13_2998: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6H97 _cell.details ? _cell.formula_units_Z ? _cell.length_a 69.922 _cell.length_a_esd ? _cell.length_b 69.922 _cell.length_b_esd ? _cell.length_c 95.225 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6H97 _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6H97 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.03 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2-0.4 M Ammonium Sulfate, 0.8-1.2 M Lithium Sulfate, 0.1 M sodium citrate tribasic' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-05-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97895 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97895 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6H97 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.598 _reflns.d_resolution_low 39.35 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7698 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.56 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2 _reflns.pdbx_Rmerge_I_obs 0.03635 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.76 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.598 _reflns_shell.d_res_low 2.691 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.3768 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6H97 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.598 _refine.ls_d_res_low 39.35 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7697 _refine.ls_number_reflns_R_free 385 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.60 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2200 _refine.ls_R_factor_R_free 0.2576 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2181 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.14 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.32 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1848 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 1853 _refine_hist.d_res_high 2.598 _refine_hist.d_res_low 39.35 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1893 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.521 ? 2560 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.298 ? 1151 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.032 ? 259 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 342 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5983 2.9742 . . 131 2352 99.00 . . . 0.3307 . 0.2946 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9742 3.7467 . . 118 2412 100.00 . . . 0.2866 . 0.2355 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7467 39.3594 . . 136 2548 100.00 . . . 0.2276 . 0.1912 . . . . . . . . . . # _struct.entry_id 6H97 _struct.title 'AlbAT99V mutant , albicidin resistance protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6H97 _struct_keywords.text 'albicidin resistance protein, albicidin binding protein' _struct_keywords.pdbx_keywords 'albicidin binding protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8KRS7_KLEOX _struct_ref.pdbx_db_accession Q8KRS7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MYDRWFSQQELQVLPFAEQDEQRNQTWLELVGEAQQLMGERCPADEPRAIALATRWMEQLEQDTAGRPEFLTRLNEMHAA EPQMREQTGVTPEMIDFITRAFAESKLAIWARYLNAEELAFTRQHYFDRLMEWPALVADLHRACREKRDPASPEGQQLAQ RWLALFQSYAGKDAQTQQKFRYAMEQEPHLMKGTWMTSEVLSWLQQAIGVMMRQAQG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6H97 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 221 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8KRS7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 217 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 217 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6H97 GLY A 1 ? UNP Q8KRS7 ? ? 'expression tag' -3 1 1 6H97 SER A 2 ? UNP Q8KRS7 ? ? 'expression tag' -2 2 1 6H97 MET A 3 ? UNP Q8KRS7 ? ? 'expression tag' -1 3 1 6H97 LYS A 4 ? UNP Q8KRS7 ? ? 'expression tag' 0 4 1 6H97 ASP A 43 ? UNP Q8KRS7 GLY 39 conflict 39 5 1 6H97 VAL A 103 ? UNP Q8KRS7 THR 99 'engineered mutation' 99 6 1 6H97 ASP A 120 ? UNP Q8KRS7 ALA 116 conflict 116 7 1 6H97 GLY A 158 ? UNP Q8KRS7 GLU 154 conflict 154 8 1 6H97 LEU A 222 ? UNP Q8KRS7 ? ? 'expression tag' 218 9 1 6H97 PRO A 223 ? UNP Q8KRS7 ? ? 'expression tag' 219 10 1 6H97 PRO A 224 ? UNP Q8KRS7 ? ? 'expression tag' 220 11 1 6H97 ASN A 225 ? UNP Q8KRS7 ? ? 'expression tag' 221 12 1 6H97 ASN A 226 ? UNP Q8KRS7 ? ? 'expression tag' 222 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13000 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? PHE A 10 ? SER A -2 PHE A 6 1 ? 9 HELX_P HELX_P2 AA2 SER A 11 ? GLN A 16 ? SER A 7 GLN A 12 1 ? 6 HELX_P HELX_P3 AA3 LEU A 18 ? GLU A 22 ? LEU A 14 GLU A 18 5 ? 5 HELX_P HELX_P4 AA4 ASP A 24 ? GLU A 44 ? ASP A 20 GLU A 40 1 ? 21 HELX_P HELX_P5 AA5 GLU A 50 ? THR A 68 ? GLU A 46 THR A 64 1 ? 19 HELX_P HELX_P6 AA6 ARG A 71 ? GLU A 85 ? ARG A 67 GLU A 81 1 ? 15 HELX_P HELX_P7 AA7 GLN A 87 ? GLY A 93 ? GLN A 83 GLY A 89 1 ? 7 HELX_P HELX_P8 AA8 THR A 95 ? ALA A 115 ? THR A 91 ALA A 111 1 ? 21 HELX_P HELX_P9 AA9 ASN A 119 ? TYR A 130 ? ASN A 115 TYR A 126 1 ? 12 HELX_P HELX_P10 AB1 ARG A 133 ? MET A 135 ? ARG A 129 MET A 131 5 ? 3 HELX_P HELX_P11 AB2 GLU A 136 ? GLU A 150 ? GLU A 132 GLU A 146 1 ? 15 HELX_P HELX_P12 AB3 SER A 156 ? GLY A 175 ? SER A 152 GLY A 171 1 ? 20 HELX_P HELX_P13 AB4 ASP A 177 ? GLU A 191 ? ASP A 173 GLU A 187 1 ? 15 HELX_P HELX_P14 AB5 PRO A 192 ? LYS A 196 ? PRO A 188 LYS A 192 5 ? 5 HELX_P HELX_P15 AB6 THR A 201 ? ARG A 217 ? THR A 197 ARG A 213 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG A SER 168 ? ? O A HOH 301 ? ? 1.88 2 1 OE1 A GLN 156 ? ? O A HOH 302 ? ? 2.01 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 83 ? ? -96.25 32.01 2 1 THR A 88 ? ? -145.09 -18.47 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 100.8214 85.2059 101.4178 0.6212 0.6055 0.6326 -0.0784 0.0892 0.1066 6.8177 4.1466 9.1612 -0.1935 -4.9642 -0.8238 0.1102 1.1518 0.9808 -0.0401 0.4302 0.2722 -0.5295 -0.6695 -0.4329 'X-RAY DIFFRACTION' 2 ? refined 88.4910 74.2618 91.7479 0.6030 0.6348 0.5176 0.1001 -0.0584 0.0477 3.4593 4.1898 8.4588 0.3262 -2.9320 -2.1039 -0.0966 0.9745 0.3957 0.2765 0.4193 0.1374 -1.0681 -1.0103 -0.2142 'X-RAY DIFFRACTION' 3 ? refined 92.0204 64.8742 93.4027 0.3062 0.4608 0.3679 0.0383 0.0197 -0.0327 3.9693 8.4008 7.3903 -0.6025 3.0962 0.7728 0.1226 0.5737 -0.0565 -0.0208 0.1312 0.5352 -0.0679 -0.4344 -0.1643 'X-RAY DIFFRACTION' 4 ? refined 95.8431 76.7441 104.6645 0.5151 0.3132 0.4621 0.0658 -0.0372 0.0173 4.6653 2.7409 7.7486 2.0821 0.0147 0.3818 -0.3352 -0.1050 0.5061 0.2399 0.1163 0.0065 -0.3765 -0.5609 0.3465 'X-RAY DIFFRACTION' 5 ? refined 93.9090 58.7997 98.7638 0.3296 0.4834 0.4213 -0.0090 0.0238 0.0267 4.9138 9.3332 1.9646 -4.5476 0.1094 0.1427 0.0592 -0.1860 -0.6304 -0.0284 -0.0416 0.9182 -0.1322 -0.2349 -0.0283 'X-RAY DIFFRACTION' 6 ? refined 99.0632 48.3096 104.4472 0.4992 0.5516 0.6158 -0.0419 0.0828 0.1388 5.4051 3.8473 7.5509 -1.4631 0.5077 2.1367 0.0938 -0.6357 -0.4809 -0.2334 0.0482 0.3188 0.2031 -0.4218 -0.0965 'X-RAY DIFFRACTION' 7 ? refined 115.4418 66.7073 106.3987 0.4222 0.5709 0.4815 0.0590 -0.0314 -0.0201 8.4570 4.5272 5.3695 -3.2595 -1.4149 -1.2525 0.0746 -0.8662 0.3901 -0.0079 -0.1710 -0.6606 -0.2059 0.6443 0.0099 'X-RAY DIFFRACTION' 8 ? refined 113.2318 56.4811 109.2992 0.5423 0.5746 0.3629 0.0526 0.0272 0.0297 8.6873 7.4694 2.5568 6.6851 -2.4076 -0.7619 0.4260 -0.7302 -0.2459 0.8891 -0.5245 -0.1035 -0.1127 -0.4731 -0.0008 'X-RAY DIFFRACTION' 9 ? refined 109.8820 46.5319 98.7917 0.6836 0.4775 0.6146 0.1172 0.0425 -0.0650 3.7185 5.0965 8.1157 0.0519 0.5289 -0.3547 0.0979 0.0710 -0.4231 0.4630 0.0172 -0.1797 0.8941 0.8862 0.0104 'X-RAY DIFFRACTION' 10 ? refined 113.9348 60.0507 98.4416 0.4602 0.5790 0.4355 -0.0259 0.0170 0.0174 5.6525 1.3137 0.4728 -2.3224 1.2612 -0.8049 0.1919 0.2008 0.0995 0.1048 -0.0826 -0.3687 -0.0037 0.0186 -0.0553 'X-RAY DIFFRACTION' 11 ? refined 126.3180 45.9507 101.3027 0.8654 0.7622 0.5480 0.1745 -0.0130 0.0657 2.7255 5.1437 7.9999 -1.3927 1.7613 4.5950 -0.9651 -0.4218 0.4405 1.0978 0.7355 0.1728 -2.1087 -0.9028 0.1615 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid -1 through 22 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 23 through 41 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 42 through 65 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 66 through 93 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 94 through 114 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 115 through 131 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 132 through 154 ) ; 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 155 through 172 ) ; 'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 173 through 188 ) ; 'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 189 through 214 ) ; 'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 215 through 223 ) ; # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id ASN _pdbx_unobs_or_zero_occ_residues.auth_seq_id 222 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id ASN _pdbx_unobs_or_zero_occ_residues.label_seq_id 226 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization ? _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number KO4116_3_1 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 6H97 _atom_sites.fract_transf_matrix[1][1] 0.014302 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014302 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010501 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_