data_6H9N # _entry.id 6H9N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.296 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6H9N WWPDB D_1200011160 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6H9N _pdbx_database_status.recvd_initial_deposition_date 2018-08-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kureisaite-Ciziene, D.' 1 ? 'Lowe, J.' 2 0000-0002-5218-6615 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev MBio _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2150-7511 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural Analysis of the Interaction between the Bacterial Cell Division Proteins FtsQ and FtsB.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/mBio.01346-18 _citation.pdbx_database_id_PubMed 30206170 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kureisaite-Ciziene, D.' 1 ? primary 'Varadajan, A.' 2 ? primary 'McLaughlin, S.H.' 3 ? primary 'Glas, M.' 4 ? primary 'Monton Silva, A.' 5 ? primary 'Luirink, R.' 6 ? primary 'Mueller, C.' 7 ? primary 'den Blaauwen, T.' 8 ? primary 'Grossmann, T.N.' 9 ? primary 'Luirink, J.' 10 ? primary 'Lowe, J.' 11 0000-0002-5218-6615 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6H9N _cell.details ? _cell.formula_units_Z ? _cell.length_a 93.785 _cell.length_a_esd ? _cell.length_b 93.785 _cell.length_b_esd ? _cell.length_c 106.392 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6H9N _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cell division protein FtsQ' 26269.643 1 ? ? ? ? 2 polymer man 'Cell division protein FtsB' 11433.473 1 ? ? ? ? 3 water nat water 18.015 7 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQH MVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDT MKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQGSHHHHHH ; ;MSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQH MVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDT MKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQGSHHHHHH ; A ? 2 'polypeptide(L)' no no ;MGSSHHHHHHSSGLVPRGSHMGKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGGQEALEERARNELSMTRP GETFYRLVPDASKRAQSAGQNNR ; ;MGSSHHHHHHSSGLVPRGSHMGKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGGQEALEERARNELSMTRP GETFYRLVPDASKRAQSAGQNNR ; B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LYS n 1 4 LEU n 1 5 VAL n 1 6 LEU n 1 7 THR n 1 8 GLY n 1 9 GLU n 1 10 ARG n 1 11 HIS n 1 12 TYR n 1 13 THR n 1 14 ARG n 1 15 ASN n 1 16 ASP n 1 17 ASP n 1 18 ILE n 1 19 ARG n 1 20 GLN n 1 21 SER n 1 22 ILE n 1 23 LEU n 1 24 ALA n 1 25 LEU n 1 26 GLY n 1 27 GLU n 1 28 PRO n 1 29 GLY n 1 30 THR n 1 31 PHE n 1 32 MET n 1 33 THR n 1 34 GLN n 1 35 ASP n 1 36 VAL n 1 37 ASN n 1 38 ILE n 1 39 ILE n 1 40 GLN n 1 41 THR n 1 42 GLN n 1 43 ILE n 1 44 GLU n 1 45 GLN n 1 46 ARG n 1 47 LEU n 1 48 PRO n 1 49 TRP n 1 50 ILE n 1 51 LYS n 1 52 GLN n 1 53 VAL n 1 54 SER n 1 55 VAL n 1 56 ARG n 1 57 LYS n 1 58 GLN n 1 59 TRP n 1 60 PRO n 1 61 ASP n 1 62 GLU n 1 63 LEU n 1 64 LYS n 1 65 ILE n 1 66 HIS n 1 67 LEU n 1 68 VAL n 1 69 GLU n 1 70 TYR n 1 71 VAL n 1 72 PRO n 1 73 ILE n 1 74 ALA n 1 75 ARG n 1 76 TRP n 1 77 ASN n 1 78 ASP n 1 79 GLN n 1 80 HIS n 1 81 MET n 1 82 VAL n 1 83 ASP n 1 84 ALA n 1 85 GLU n 1 86 GLY n 1 87 ASN n 1 88 THR n 1 89 PHE n 1 90 SER n 1 91 VAL n 1 92 PRO n 1 93 PRO n 1 94 GLU n 1 95 ARG n 1 96 THR n 1 97 SER n 1 98 LYS n 1 99 GLN n 1 100 VAL n 1 101 LEU n 1 102 PRO n 1 103 MET n 1 104 LEU n 1 105 TYR n 1 106 GLY n 1 107 PRO n 1 108 GLU n 1 109 GLY n 1 110 SER n 1 111 ALA n 1 112 ASN n 1 113 GLU n 1 114 VAL n 1 115 LEU n 1 116 GLN n 1 117 GLY n 1 118 TYR n 1 119 ARG n 1 120 GLU n 1 121 MET n 1 122 GLY n 1 123 GLN n 1 124 MET n 1 125 LEU n 1 126 ALA n 1 127 LYS n 1 128 ASP n 1 129 ARG n 1 130 PHE n 1 131 THR n 1 132 LEU n 1 133 LYS n 1 134 GLU n 1 135 ALA n 1 136 ALA n 1 137 MET n 1 138 THR n 1 139 ALA n 1 140 ARG n 1 141 ARG n 1 142 SER n 1 143 TRP n 1 144 GLN n 1 145 LEU n 1 146 THR n 1 147 LEU n 1 148 ASN n 1 149 ASN n 1 150 ASP n 1 151 ILE n 1 152 LYS n 1 153 LEU n 1 154 ASN n 1 155 LEU n 1 156 GLY n 1 157 ARG n 1 158 GLY n 1 159 ASP n 1 160 THR n 1 161 MET n 1 162 LYS n 1 163 ARG n 1 164 LEU n 1 165 ALA n 1 166 ARG n 1 167 PHE n 1 168 VAL n 1 169 GLU n 1 170 LEU n 1 171 TYR n 1 172 PRO n 1 173 VAL n 1 174 LEU n 1 175 GLN n 1 176 GLN n 1 177 GLN n 1 178 ALA n 1 179 GLN n 1 180 THR n 1 181 ASP n 1 182 GLY n 1 183 LYS n 1 184 ARG n 1 185 ILE n 1 186 SER n 1 187 TYR n 1 188 VAL n 1 189 ASP n 1 190 LEU n 1 191 ARG n 1 192 TYR n 1 193 ASP n 1 194 SER n 1 195 GLY n 1 196 ALA n 1 197 ALA n 1 198 VAL n 1 199 GLY n 1 200 TRP n 1 201 ALA n 1 202 PRO n 1 203 LEU n 1 204 PRO n 1 205 PRO n 1 206 GLU n 1 207 GLU n 1 208 SER n 1 209 THR n 1 210 GLN n 1 211 GLN n 1 212 GLN n 1 213 ASN n 1 214 GLN n 1 215 ALA n 1 216 GLN n 1 217 ALA n 1 218 GLU n 1 219 GLN n 1 220 GLN n 1 221 GLY n 1 222 SER n 1 223 HIS n 1 224 HIS n 1 225 HIS n 1 226 HIS n 1 227 HIS n 1 228 HIS n 2 1 MET n 2 2 GLY n 2 3 SER n 2 4 SER n 2 5 HIS n 2 6 HIS n 2 7 HIS n 2 8 HIS n 2 9 HIS n 2 10 HIS n 2 11 SER n 2 12 SER n 2 13 GLY n 2 14 LEU n 2 15 VAL n 2 16 PRO n 2 17 ARG n 2 18 GLY n 2 19 SER n 2 20 HIS n 2 21 MET n 2 22 GLY n 2 23 LYS n 2 24 ASN n 2 25 GLY n 2 26 ILE n 2 27 HIS n 2 28 ASP n 2 29 TYR n 2 30 THR n 2 31 ARG n 2 32 VAL n 2 33 ASN n 2 34 ASP n 2 35 ASP n 2 36 VAL n 2 37 ALA n 2 38 ALA n 2 39 GLN n 2 40 GLN n 2 41 ALA n 2 42 THR n 2 43 ASN n 2 44 ALA n 2 45 LYS n 2 46 LEU n 2 47 LYS n 2 48 ALA n 2 49 ARG n 2 50 ASN n 2 51 ASP n 2 52 GLN n 2 53 LEU n 2 54 PHE n 2 55 ALA n 2 56 GLU n 2 57 ILE n 2 58 ASP n 2 59 ASP n 2 60 LEU n 2 61 ASN n 2 62 GLY n 2 63 GLY n 2 64 GLN n 2 65 GLU n 2 66 ALA n 2 67 LEU n 2 68 GLU n 2 69 GLU n 2 70 ARG n 2 71 ALA n 2 72 ARG n 2 73 ASN n 2 74 GLU n 2 75 LEU n 2 76 SER n 2 77 MET n 2 78 THR n 2 79 ARG n 2 80 PRO n 2 81 GLY n 2 82 GLU n 2 83 THR n 2 84 PHE n 2 85 TYR n 2 86 ARG n 2 87 LEU n 2 88 VAL n 2 89 PRO n 2 90 ASP n 2 91 ALA n 2 92 SER n 2 93 LYS n 2 94 ARG n 2 95 ALA n 2 96 GLN n 2 97 SER n 2 98 ALA n 2 99 GLY n 2 100 GLN n 2 101 ASN n 2 102 ASN n 2 103 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 228 ? ? 'ftsQ, b0093, JW0091' ? ? ? ? ? ? 'Escherichia coli K-12' 83333 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 103 ? ? 'ftsB, EC55989_3020' ? ? ? ? ? ? 'Escherichia coli 55989' 585055 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP FTSQ_ECOLI P06136 ? 1 ;SKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQHM VDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTM KRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ ; 58 2 UNP FTSB_ECO55 B7LEG6 ? 2 ;GKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGGQEALEERARNELSMTRPGETFYRLVPDASKRAQSAGQN NR ; 22 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6H9N A 2 ? 220 ? P06136 58 ? 276 ? 58 276 2 2 6H9N B 22 ? 103 ? B7LEG6 22 ? 103 ? 22 103 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6H9N MET A 1 ? UNP P06136 ? ? 'initiating methionine' 57 1 1 6H9N GLY A 221 ? UNP P06136 ? ? 'expression tag' 277 2 1 6H9N SER A 222 ? UNP P06136 ? ? 'expression tag' 278 3 1 6H9N HIS A 223 ? UNP P06136 ? ? 'expression tag' 279 4 1 6H9N HIS A 224 ? UNP P06136 ? ? 'expression tag' 280 5 1 6H9N HIS A 225 ? UNP P06136 ? ? 'expression tag' 281 6 1 6H9N HIS A 226 ? UNP P06136 ? ? 'expression tag' 282 7 1 6H9N HIS A 227 ? UNP P06136 ? ? 'expression tag' 283 8 1 6H9N HIS A 228 ? UNP P06136 ? ? 'expression tag' 284 9 2 6H9N MET B 1 ? UNP B7LEG6 ? ? 'initiating methionine' 1 10 2 6H9N GLY B 2 ? UNP B7LEG6 ? ? 'expression tag' 2 11 2 6H9N SER B 3 ? UNP B7LEG6 ? ? 'expression tag' 3 12 2 6H9N SER B 4 ? UNP B7LEG6 ? ? 'expression tag' 4 13 2 6H9N HIS B 5 ? UNP B7LEG6 ? ? 'expression tag' 5 14 2 6H9N HIS B 6 ? UNP B7LEG6 ? ? 'expression tag' 6 15 2 6H9N HIS B 7 ? UNP B7LEG6 ? ? 'expression tag' 7 16 2 6H9N HIS B 8 ? UNP B7LEG6 ? ? 'expression tag' 8 17 2 6H9N HIS B 9 ? UNP B7LEG6 ? ? 'expression tag' 9 18 2 6H9N HIS B 10 ? UNP B7LEG6 ? ? 'expression tag' 10 19 2 6H9N SER B 11 ? UNP B7LEG6 ? ? 'expression tag' 11 20 2 6H9N SER B 12 ? UNP B7LEG6 ? ? 'expression tag' 12 21 2 6H9N GLY B 13 ? UNP B7LEG6 ? ? 'expression tag' 13 22 2 6H9N LEU B 14 ? UNP B7LEG6 ? ? 'expression tag' 14 23 2 6H9N VAL B 15 ? UNP B7LEG6 ? ? 'expression tag' 15 24 2 6H9N PRO B 16 ? UNP B7LEG6 ? ? 'expression tag' 16 25 2 6H9N ARG B 17 ? UNP B7LEG6 ? ? 'expression tag' 17 26 2 6H9N GLY B 18 ? UNP B7LEG6 ? ? 'expression tag' 18 27 2 6H9N SER B 19 ? UNP B7LEG6 ? ? 'expression tag' 19 28 2 6H9N HIS B 20 ? UNP B7LEG6 ? ? 'expression tag' 20 29 2 6H9N MET B 21 ? UNP B7LEG6 ? ? 'expression tag' 21 30 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6H9N _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.10 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.35 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.15 M potassium thiocyanate, 20 % PEG 550 MME, 0.1 M sodium cacodylate pH 6.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-02-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92819 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.92819 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6H9N _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.6 _reflns.d_resolution_low 30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15037 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.8 _reflns.pdbx_Rmerge_I_obs 0.082 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.024 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.6 _reflns_shell.d_res_low 2.74 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2155 _reflns_shell.percent_possible_all 99.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.702 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.477 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.821 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6H9N _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.600 _refine.ls_d_res_low 29.994 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15024 _refine.ls_number_reflns_R_free 1340 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.31 _refine.ls_percent_reflns_R_free 4.84 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2243 _refine.ls_R_factor_R_free 0.2519 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2228 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2VH1 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.93 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.42 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1842 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 1849 _refine_hist.d_res_high 2.600 _refine_hist.d_res_low 29.994 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1878 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.162 ? 2540 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 22.200 ? 1151 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.058 ? 275 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 333 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6000 2.6929 . . 136 2627 99.00 . . . 0.3891 . 0.3760 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6929 2.8006 . . 118 2655 99.00 . . . 0.3339 . 0.3420 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8006 2.9280 . . 143 2621 100.00 . . . 0.3433 . 0.3037 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9280 3.0822 . . 134 2618 98.00 . . . 0.3322 . 0.2895 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0822 3.2751 . . 111 2666 99.00 . . . 0.3142 . 0.2766 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2751 3.5276 . . 145 2611 100.00 . . . 0.3577 . 0.2483 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5276 3.8820 . . 137 2661 100.00 . . . 0.2705 . 0.2424 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8820 4.4421 . . 136 2633 99.00 . . . 0.2916 . 0.1971 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4421 5.5907 . . 121 2657 100.00 . . . 0.2090 . 0.1879 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.5907 29.9955 . . 159 2595 99.00 . . . 0.1601 . 0.1832 . . . . . . . . . . # _struct.entry_id 6H9N _struct.title 'Complex of the periplasmic domains of bacterial cell division proteins FtsQ and FtsB' _struct.pdbx_descriptor 'Cell division protein FtsQ, Cell division protein FtsB' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6H9N _struct_keywords.text 'bacterial cell division, divisome, CELL CYCLE' _struct_keywords.pdbx_keywords 'CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 14 ? ALA A 24 ? ARG A 70 ALA A 80 1 ? 11 HELX_P HELX_P2 AA2 ASP A 35 ? LEU A 47 ? ASP A 91 LEU A 103 1 ? 13 HELX_P HELX_P3 AA3 PRO A 92 ? THR A 96 ? PRO A 148 THR A 152 5 ? 5 HELX_P HELX_P4 AA4 SER A 110 ? LYS A 127 ? SER A 166 LYS A 183 1 ? 18 HELX_P HELX_P5 AA5 ASP A 159 ? ASP A 181 ? ASP A 215 ASP A 237 1 ? 23 HELX_P HELX_P6 AA6 GLU B 65 ? GLU B 74 ? GLU B 65 GLU B 74 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TRP _struct_mon_prot_cis.label_seq_id 59 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TRP _struct_mon_prot_cis.auth_seq_id 115 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 60 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 116 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 20.62 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 10 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? parallel AA2 8 9 ? anti-parallel AA2 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 3 ? GLU A 9 ? LYS A 59 GLU A 65 AA1 2 GLU A 62 ? GLU A 69 ? GLU A 118 GLU A 125 AA1 3 ILE A 50 ? GLN A 58 ? ILE A 106 GLN A 114 AA2 1 THR A 88 ? PHE A 89 ? THR A 144 PHE A 145 AA2 2 HIS A 80 ? VAL A 82 ? HIS A 136 VAL A 138 AA2 3 ALA A 74 ? TRP A 76 ? ALA A 130 TRP A 132 AA2 4 MET A 103 ? TYR A 105 ? MET A 159 TYR A 161 AA2 5 LEU A 132 ? MET A 137 ? LEU A 188 MET A 193 AA2 6 TRP A 143 ? LEU A 147 ? TRP A 199 LEU A 203 AA2 7 LYS A 152 ? GLY A 156 ? LYS A 208 GLY A 212 AA2 8 LYS A 183 ? ASP A 189 ? LYS A 239 ASP A 245 AA2 9 GLY A 195 ? PRO A 202 ? GLY A 251 PRO A 258 AA2 10 THR B 83 ? ARG B 86 ? THR B 83 ARG B 86 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 7 ? N THR A 63 O ILE A 65 ? O ILE A 121 AA1 2 3 O VAL A 68 ? O VAL A 124 N GLN A 52 ? N GLN A 108 AA2 1 2 O PHE A 89 ? O PHE A 145 N MET A 81 ? N MET A 137 AA2 2 3 O VAL A 82 ? O VAL A 138 N ALA A 74 ? N ALA A 130 AA2 3 4 N ARG A 75 ? N ARG A 131 O LEU A 104 ? O LEU A 160 AA2 4 5 N MET A 103 ? N MET A 159 O ALA A 135 ? O ALA A 191 AA2 5 6 N LYS A 133 ? N LYS A 189 O THR A 146 ? O THR A 202 AA2 6 7 N LEU A 145 ? N LEU A 201 O LEU A 153 ? O LEU A 209 AA2 7 8 N ASN A 154 ? N ASN A 210 O VAL A 188 ? O VAL A 244 AA2 8 9 N ASP A 189 ? N ASP A 245 O ALA A 197 ? O ALA A 253 AA2 9 10 N VAL A 198 ? N VAL A 254 O THR B 83 ? O THR B 83 # _atom_sites.entry_id 6H9N _atom_sites.fract_transf_matrix[1][1] 0.010663 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010663 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009399 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 57 ? ? ? A . n A 1 2 SER 2 58 58 SER SER A . n A 1 3 LYS 3 59 59 LYS LYS A . n A 1 4 LEU 4 60 60 LEU LEU A . n A 1 5 VAL 5 61 61 VAL VAL A . n A 1 6 LEU 6 62 62 LEU LEU A . n A 1 7 THR 7 63 63 THR THR A . n A 1 8 GLY 8 64 64 GLY GLY A . n A 1 9 GLU 9 65 65 GLU GLU A . n A 1 10 ARG 10 66 66 ARG ARG A . n A 1 11 HIS 11 67 67 HIS HIS A . n A 1 12 TYR 12 68 68 TYR TYR A . n A 1 13 THR 13 69 69 THR THR A . n A 1 14 ARG 14 70 70 ARG ARG A . n A 1 15 ASN 15 71 71 ASN ASN A . n A 1 16 ASP 16 72 72 ASP ASP A . n A 1 17 ASP 17 73 73 ASP ASP A . n A 1 18 ILE 18 74 74 ILE ILE A . n A 1 19 ARG 19 75 75 ARG ARG A . n A 1 20 GLN 20 76 76 GLN GLN A . n A 1 21 SER 21 77 77 SER SER A . n A 1 22 ILE 22 78 78 ILE ILE A . n A 1 23 LEU 23 79 79 LEU LEU A . n A 1 24 ALA 24 80 80 ALA ALA A . n A 1 25 LEU 25 81 81 LEU LEU A . n A 1 26 GLY 26 82 82 GLY GLY A . n A 1 27 GLU 27 83 83 GLU GLU A . n A 1 28 PRO 28 84 84 PRO PRO A . n A 1 29 GLY 29 85 85 GLY GLY A . n A 1 30 THR 30 86 86 THR THR A . n A 1 31 PHE 31 87 87 PHE PHE A . n A 1 32 MET 32 88 88 MET MET A . n A 1 33 THR 33 89 89 THR THR A . n A 1 34 GLN 34 90 90 GLN GLN A . n A 1 35 ASP 35 91 91 ASP ASP A . n A 1 36 VAL 36 92 92 VAL VAL A . n A 1 37 ASN 37 93 93 ASN ASN A . n A 1 38 ILE 38 94 94 ILE ILE A . n A 1 39 ILE 39 95 95 ILE ILE A . n A 1 40 GLN 40 96 96 GLN GLN A . n A 1 41 THR 41 97 97 THR THR A . n A 1 42 GLN 42 98 98 GLN GLN A . n A 1 43 ILE 43 99 99 ILE ILE A . n A 1 44 GLU 44 100 100 GLU GLU A . n A 1 45 GLN 45 101 101 GLN GLN A . n A 1 46 ARG 46 102 102 ARG ARG A . n A 1 47 LEU 47 103 103 LEU LEU A . n A 1 48 PRO 48 104 104 PRO PRO A . n A 1 49 TRP 49 105 105 TRP TRP A . n A 1 50 ILE 50 106 106 ILE ILE A . n A 1 51 LYS 51 107 107 LYS LYS A . n A 1 52 GLN 52 108 108 GLN GLN A . n A 1 53 VAL 53 109 109 VAL VAL A . n A 1 54 SER 54 110 110 SER SER A . n A 1 55 VAL 55 111 111 VAL VAL A . n A 1 56 ARG 56 112 112 ARG ARG A . n A 1 57 LYS 57 113 113 LYS LYS A . n A 1 58 GLN 58 114 114 GLN GLN A . n A 1 59 TRP 59 115 115 TRP TRP A . n A 1 60 PRO 60 116 116 PRO PRO A . n A 1 61 ASP 61 117 117 ASP ASP A . n A 1 62 GLU 62 118 118 GLU GLU A . n A 1 63 LEU 63 119 119 LEU LEU A . n A 1 64 LYS 64 120 120 LYS LYS A . n A 1 65 ILE 65 121 121 ILE ILE A . n A 1 66 HIS 66 122 122 HIS HIS A . n A 1 67 LEU 67 123 123 LEU LEU A . n A 1 68 VAL 68 124 124 VAL VAL A . n A 1 69 GLU 69 125 125 GLU GLU A . n A 1 70 TYR 70 126 126 TYR TYR A . n A 1 71 VAL 71 127 127 VAL VAL A . n A 1 72 PRO 72 128 128 PRO PRO A . n A 1 73 ILE 73 129 129 ILE ILE A . n A 1 74 ALA 74 130 130 ALA ALA A . n A 1 75 ARG 75 131 131 ARG ARG A . n A 1 76 TRP 76 132 132 TRP TRP A . n A 1 77 ASN 77 133 133 ASN ASN A . n A 1 78 ASP 78 134 134 ASP ASP A . n A 1 79 GLN 79 135 135 GLN GLN A . n A 1 80 HIS 80 136 136 HIS HIS A . n A 1 81 MET 81 137 137 MET MET A . n A 1 82 VAL 82 138 138 VAL VAL A . n A 1 83 ASP 83 139 139 ASP ASP A . n A 1 84 ALA 84 140 140 ALA ALA A . n A 1 85 GLU 85 141 141 GLU GLU A . n A 1 86 GLY 86 142 142 GLY GLY A . n A 1 87 ASN 87 143 143 ASN ASN A . n A 1 88 THR 88 144 144 THR THR A . n A 1 89 PHE 89 145 145 PHE PHE A . n A 1 90 SER 90 146 146 SER SER A . n A 1 91 VAL 91 147 147 VAL VAL A . n A 1 92 PRO 92 148 148 PRO PRO A . n A 1 93 PRO 93 149 149 PRO PRO A . n A 1 94 GLU 94 150 150 GLU GLU A . n A 1 95 ARG 95 151 151 ARG ARG A . n A 1 96 THR 96 152 152 THR THR A . n A 1 97 SER 97 153 153 SER SER A . n A 1 98 LYS 98 154 154 LYS LYS A . n A 1 99 GLN 99 155 155 GLN GLN A . n A 1 100 VAL 100 156 156 VAL VAL A . n A 1 101 LEU 101 157 157 LEU LEU A . n A 1 102 PRO 102 158 158 PRO PRO A . n A 1 103 MET 103 159 159 MET MET A . n A 1 104 LEU 104 160 160 LEU LEU A . n A 1 105 TYR 105 161 161 TYR TYR A . n A 1 106 GLY 106 162 162 GLY GLY A . n A 1 107 PRO 107 163 163 PRO PRO A . n A 1 108 GLU 108 164 164 GLU GLU A . n A 1 109 GLY 109 165 165 GLY GLY A . n A 1 110 SER 110 166 166 SER SER A . n A 1 111 ALA 111 167 167 ALA ALA A . n A 1 112 ASN 112 168 168 ASN ASN A . n A 1 113 GLU 113 169 169 GLU GLU A . n A 1 114 VAL 114 170 170 VAL VAL A . n A 1 115 LEU 115 171 171 LEU LEU A . n A 1 116 GLN 116 172 172 GLN GLN A . n A 1 117 GLY 117 173 173 GLY GLY A . n A 1 118 TYR 118 174 174 TYR TYR A . n A 1 119 ARG 119 175 175 ARG ARG A . n A 1 120 GLU 120 176 176 GLU GLU A . n A 1 121 MET 121 177 177 MET MET A . n A 1 122 GLY 122 178 178 GLY GLY A . n A 1 123 GLN 123 179 179 GLN GLN A . n A 1 124 MET 124 180 180 MET MET A . n A 1 125 LEU 125 181 181 LEU LEU A . n A 1 126 ALA 126 182 182 ALA ALA A . n A 1 127 LYS 127 183 183 LYS LYS A . n A 1 128 ASP 128 184 184 ASP ASP A . n A 1 129 ARG 129 185 185 ARG ARG A . n A 1 130 PHE 130 186 186 PHE PHE A . n A 1 131 THR 131 187 187 THR THR A . n A 1 132 LEU 132 188 188 LEU LEU A . n A 1 133 LYS 133 189 189 LYS LYS A . n A 1 134 GLU 134 190 190 GLU GLU A . n A 1 135 ALA 135 191 191 ALA ALA A . n A 1 136 ALA 136 192 192 ALA ALA A . n A 1 137 MET 137 193 193 MET MET A . n A 1 138 THR 138 194 194 THR THR A . n A 1 139 ALA 139 195 195 ALA ALA A . n A 1 140 ARG 140 196 196 ARG ARG A . n A 1 141 ARG 141 197 197 ARG ARG A . n A 1 142 SER 142 198 198 SER SER A . n A 1 143 TRP 143 199 199 TRP TRP A . n A 1 144 GLN 144 200 200 GLN GLN A . n A 1 145 LEU 145 201 201 LEU LEU A . n A 1 146 THR 146 202 202 THR THR A . n A 1 147 LEU 147 203 203 LEU LEU A . n A 1 148 ASN 148 204 204 ASN ASN A . n A 1 149 ASN 149 205 205 ASN ASN A . n A 1 150 ASP 150 206 206 ASP ASP A . n A 1 151 ILE 151 207 207 ILE ILE A . n A 1 152 LYS 152 208 208 LYS LYS A . n A 1 153 LEU 153 209 209 LEU LEU A . n A 1 154 ASN 154 210 210 ASN ASN A . n A 1 155 LEU 155 211 211 LEU LEU A . n A 1 156 GLY 156 212 212 GLY GLY A . n A 1 157 ARG 157 213 213 ARG ARG A . n A 1 158 GLY 158 214 214 GLY GLY A . n A 1 159 ASP 159 215 215 ASP ASP A . n A 1 160 THR 160 216 216 THR THR A . n A 1 161 MET 161 217 217 MET MET A . n A 1 162 LYS 162 218 218 LYS LYS A . n A 1 163 ARG 163 219 219 ARG ARG A . n A 1 164 LEU 164 220 220 LEU LEU A . n A 1 165 ALA 165 221 221 ALA ALA A . n A 1 166 ARG 166 222 222 ARG ARG A . n A 1 167 PHE 167 223 223 PHE PHE A . n A 1 168 VAL 168 224 224 VAL VAL A . n A 1 169 GLU 169 225 225 GLU GLU A . n A 1 170 LEU 170 226 226 LEU LEU A . n A 1 171 TYR 171 227 227 TYR TYR A . n A 1 172 PRO 172 228 228 PRO PRO A . n A 1 173 VAL 173 229 229 VAL VAL A . n A 1 174 LEU 174 230 230 LEU LEU A . n A 1 175 GLN 175 231 231 GLN GLN A . n A 1 176 GLN 176 232 232 GLN GLN A . n A 1 177 GLN 177 233 233 GLN GLN A . n A 1 178 ALA 178 234 234 ALA ALA A . n A 1 179 GLN 179 235 235 GLN GLN A . n A 1 180 THR 180 236 236 THR THR A . n A 1 181 ASP 181 237 237 ASP ASP A . n A 1 182 GLY 182 238 238 GLY GLY A . n A 1 183 LYS 183 239 239 LYS LYS A . n A 1 184 ARG 184 240 240 ARG ARG A . n A 1 185 ILE 185 241 241 ILE ILE A . n A 1 186 SER 186 242 242 SER SER A . n A 1 187 TYR 187 243 243 TYR TYR A . n A 1 188 VAL 188 244 244 VAL VAL A . n A 1 189 ASP 189 245 245 ASP ASP A . n A 1 190 LEU 190 246 246 LEU LEU A . n A 1 191 ARG 191 247 247 ARG ARG A . n A 1 192 TYR 192 248 248 TYR TYR A . n A 1 193 ASP 193 249 249 ASP ASP A . n A 1 194 SER 194 250 250 SER SER A . n A 1 195 GLY 195 251 251 GLY GLY A . n A 1 196 ALA 196 252 252 ALA ALA A . n A 1 197 ALA 197 253 253 ALA ALA A . n A 1 198 VAL 198 254 254 VAL VAL A . n A 1 199 GLY 199 255 255 GLY GLY A . n A 1 200 TRP 200 256 256 TRP TRP A . n A 1 201 ALA 201 257 257 ALA ALA A . n A 1 202 PRO 202 258 258 PRO PRO A . n A 1 203 LEU 203 259 259 LEU LEU A . n A 1 204 PRO 204 260 260 PRO PRO A . n A 1 205 PRO 205 261 ? ? ? A . n A 1 206 GLU 206 262 ? ? ? A . n A 1 207 GLU 207 263 ? ? ? A . n A 1 208 SER 208 264 ? ? ? A . n A 1 209 THR 209 265 ? ? ? A . n A 1 210 GLN 210 266 ? ? ? A . n A 1 211 GLN 211 267 ? ? ? A . n A 1 212 GLN 212 268 ? ? ? A . n A 1 213 ASN 213 269 ? ? ? A . n A 1 214 GLN 214 270 ? ? ? A . n A 1 215 ALA 215 271 ? ? ? A . n A 1 216 GLN 216 272 ? ? ? A . n A 1 217 ALA 217 273 ? ? ? A . n A 1 218 GLU 218 274 ? ? ? A . n A 1 219 GLN 219 275 ? ? ? A . n A 1 220 GLN 220 276 ? ? ? A . n A 1 221 GLY 221 277 ? ? ? A . n A 1 222 SER 222 278 ? ? ? A . n A 1 223 HIS 223 279 ? ? ? A . n A 1 224 HIS 224 280 ? ? ? A . n A 1 225 HIS 225 281 ? ? ? A . n A 1 226 HIS 226 282 ? ? ? A . n A 1 227 HIS 227 283 ? ? ? A . n A 1 228 HIS 228 284 ? ? ? A . n B 2 1 MET 1 1 ? ? ? B . n B 2 2 GLY 2 2 ? ? ? B . n B 2 3 SER 3 3 ? ? ? B . n B 2 4 SER 4 4 ? ? ? B . n B 2 5 HIS 5 5 ? ? ? B . n B 2 6 HIS 6 6 ? ? ? B . n B 2 7 HIS 7 7 ? ? ? B . n B 2 8 HIS 8 8 ? ? ? B . n B 2 9 HIS 9 9 ? ? ? B . n B 2 10 HIS 10 10 ? ? ? B . n B 2 11 SER 11 11 ? ? ? B . n B 2 12 SER 12 12 ? ? ? B . n B 2 13 GLY 13 13 ? ? ? B . n B 2 14 LEU 14 14 ? ? ? B . n B 2 15 VAL 15 15 ? ? ? B . n B 2 16 PRO 16 16 ? ? ? B . n B 2 17 ARG 17 17 ? ? ? B . n B 2 18 GLY 18 18 ? ? ? B . n B 2 19 SER 19 19 ? ? ? B . n B 2 20 HIS 20 20 ? ? ? B . n B 2 21 MET 21 21 ? ? ? B . n B 2 22 GLY 22 22 ? ? ? B . n B 2 23 LYS 23 23 ? ? ? B . n B 2 24 ASN 24 24 ? ? ? B . n B 2 25 GLY 25 25 ? ? ? B . n B 2 26 ILE 26 26 ? ? ? B . n B 2 27 HIS 27 27 ? ? ? B . n B 2 28 ASP 28 28 ? ? ? B . n B 2 29 TYR 29 29 ? ? ? B . n B 2 30 THR 30 30 ? ? ? B . n B 2 31 ARG 31 31 ? ? ? B . n B 2 32 VAL 32 32 ? ? ? B . n B 2 33 ASN 33 33 ? ? ? B . n B 2 34 ASP 34 34 ? ? ? B . n B 2 35 ASP 35 35 ? ? ? B . n B 2 36 VAL 36 36 ? ? ? B . n B 2 37 ALA 37 37 ? ? ? B . n B 2 38 ALA 38 38 ? ? ? B . n B 2 39 GLN 39 39 ? ? ? B . n B 2 40 GLN 40 40 ? ? ? B . n B 2 41 ALA 41 41 ? ? ? B . n B 2 42 THR 42 42 ? ? ? B . n B 2 43 ASN 43 43 ? ? ? B . n B 2 44 ALA 44 44 ? ? ? B . n B 2 45 LYS 45 45 ? ? ? B . n B 2 46 LEU 46 46 ? ? ? B . n B 2 47 LYS 47 47 ? ? ? B . n B 2 48 ALA 48 48 ? ? ? B . n B 2 49 ARG 49 49 ? ? ? B . n B 2 50 ASN 50 50 ? ? ? B . n B 2 51 ASP 51 51 ? ? ? B . n B 2 52 GLN 52 52 ? ? ? B . n B 2 53 LEU 53 53 ? ? ? B . n B 2 54 PHE 54 54 ? ? ? B . n B 2 55 ALA 55 55 ? ? ? B . n B 2 56 GLU 56 56 ? ? ? B . n B 2 57 ILE 57 57 ? ? ? B . n B 2 58 ASP 58 58 ? ? ? B . n B 2 59 ASP 59 59 ? ? ? B . n B 2 60 LEU 60 60 ? ? ? B . n B 2 61 ASN 61 61 ? ? ? B . n B 2 62 GLY 62 62 ? ? ? B . n B 2 63 GLY 63 63 ? ? ? B . n B 2 64 GLN 64 64 64 GLN GLN B . n B 2 65 GLU 65 65 65 GLU GLU B . n B 2 66 ALA 66 66 66 ALA ALA B . n B 2 67 LEU 67 67 67 LEU LEU B . n B 2 68 GLU 68 68 68 GLU GLU B . n B 2 69 GLU 69 69 69 GLU GLU B . n B 2 70 ARG 70 70 70 ARG ARG B . n B 2 71 ALA 71 71 71 ALA ALA B . n B 2 72 ARG 72 72 72 ARG ARG B . n B 2 73 ASN 73 73 73 ASN ASN B . n B 2 74 GLU 74 74 74 GLU GLU B . n B 2 75 LEU 75 75 75 LEU LEU B . n B 2 76 SER 76 76 76 SER SER B . n B 2 77 MET 77 77 77 MET MET B . n B 2 78 THR 78 78 78 THR THR B . n B 2 79 ARG 79 79 79 ARG ARG B . n B 2 80 PRO 80 80 80 PRO PRO B . n B 2 81 GLY 81 81 81 GLY GLY B . n B 2 82 GLU 82 82 82 GLU GLU B . n B 2 83 THR 83 83 83 THR THR B . n B 2 84 PHE 84 84 84 PHE PHE B . n B 2 85 TYR 85 85 85 TYR TYR B . n B 2 86 ARG 86 86 86 ARG ARG B . n B 2 87 LEU 87 87 87 LEU LEU B . n B 2 88 VAL 88 88 ? ? ? B . n B 2 89 PRO 89 89 ? ? ? B . n B 2 90 ASP 90 90 ? ? ? B . n B 2 91 ALA 91 91 ? ? ? B . n B 2 92 SER 92 92 ? ? ? B . n B 2 93 LYS 93 93 ? ? ? B . n B 2 94 ARG 94 94 ? ? ? B . n B 2 95 ALA 95 95 ? ? ? B . n B 2 96 GLN 96 96 ? ? ? B . n B 2 97 SER 97 97 ? ? ? B . n B 2 98 ALA 98 98 ? ? ? B . n B 2 99 GLY 99 99 ? ? ? B . n B 2 100 GLN 100 100 ? ? ? B . n B 2 101 ASN 101 101 ? ? ? B . n B 2 102 ASN 102 102 ? ? ? B . n B 2 103 ARG 103 103 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 301 5 HOH HOH A . C 3 HOH 2 302 2 HOH HOH A . C 3 HOH 3 303 1 HOH HOH A . C 3 HOH 4 304 3 HOH HOH A . C 3 HOH 5 305 7 HOH HOH A . C 3 HOH 6 306 6 HOH HOH A . C 3 HOH 7 307 4 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1550 ? 1 MORE -2 ? 1 'SSA (A^2)' 13060 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-09-05 2 'Structure model' 1 1 2018-09-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13_2998: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 80 ? ? -67.73 16.39 2 1 LEU A 81 ? ? -138.75 -40.68 3 1 MET A 88 ? ? -58.36 -83.77 4 1 PRO A 116 ? ? -57.18 -74.24 5 1 ALA A 130 ? ? -171.34 149.30 6 1 ASN A 133 ? ? 42.26 -122.16 7 1 HIS A 136 ? ? -113.38 -169.36 8 1 ARG A 197 ? ? 71.58 41.68 9 1 ASP A 206 ? ? 75.46 -1.28 10 1 ASP A 215 ? ? -61.26 92.44 11 1 SER A 250 ? ? -158.05 43.83 12 1 THR B 78 ? ? -124.86 -152.97 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 THR _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 86 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 PHE _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 87 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -133.78 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 57 ? A MET 1 2 1 Y 1 A PRO 261 ? A PRO 205 3 1 Y 1 A GLU 262 ? A GLU 206 4 1 Y 1 A GLU 263 ? A GLU 207 5 1 Y 1 A SER 264 ? A SER 208 6 1 Y 1 A THR 265 ? A THR 209 7 1 Y 1 A GLN 266 ? A GLN 210 8 1 Y 1 A GLN 267 ? A GLN 211 9 1 Y 1 A GLN 268 ? A GLN 212 10 1 Y 1 A ASN 269 ? A ASN 213 11 1 Y 1 A GLN 270 ? A GLN 214 12 1 Y 1 A ALA 271 ? A ALA 215 13 1 Y 1 A GLN 272 ? A GLN 216 14 1 Y 1 A ALA 273 ? A ALA 217 15 1 Y 1 A GLU 274 ? A GLU 218 16 1 Y 1 A GLN 275 ? A GLN 219 17 1 Y 1 A GLN 276 ? A GLN 220 18 1 Y 1 A GLY 277 ? A GLY 221 19 1 Y 1 A SER 278 ? A SER 222 20 1 Y 1 A HIS 279 ? A HIS 223 21 1 Y 1 A HIS 280 ? A HIS 224 22 1 Y 1 A HIS 281 ? A HIS 225 23 1 Y 1 A HIS 282 ? A HIS 226 24 1 Y 1 A HIS 283 ? A HIS 227 25 1 Y 1 A HIS 284 ? A HIS 228 26 1 Y 1 B MET 1 ? B MET 1 27 1 Y 1 B GLY 2 ? B GLY 2 28 1 Y 1 B SER 3 ? B SER 3 29 1 Y 1 B SER 4 ? B SER 4 30 1 Y 1 B HIS 5 ? B HIS 5 31 1 Y 1 B HIS 6 ? B HIS 6 32 1 Y 1 B HIS 7 ? B HIS 7 33 1 Y 1 B HIS 8 ? B HIS 8 34 1 Y 1 B HIS 9 ? B HIS 9 35 1 Y 1 B HIS 10 ? B HIS 10 36 1 Y 1 B SER 11 ? B SER 11 37 1 Y 1 B SER 12 ? B SER 12 38 1 Y 1 B GLY 13 ? B GLY 13 39 1 Y 1 B LEU 14 ? B LEU 14 40 1 Y 1 B VAL 15 ? B VAL 15 41 1 Y 1 B PRO 16 ? B PRO 16 42 1 Y 1 B ARG 17 ? B ARG 17 43 1 Y 1 B GLY 18 ? B GLY 18 44 1 Y 1 B SER 19 ? B SER 19 45 1 Y 1 B HIS 20 ? B HIS 20 46 1 Y 1 B MET 21 ? B MET 21 47 1 Y 1 B GLY 22 ? B GLY 22 48 1 Y 1 B LYS 23 ? B LYS 23 49 1 Y 1 B ASN 24 ? B ASN 24 50 1 Y 1 B GLY 25 ? B GLY 25 51 1 Y 1 B ILE 26 ? B ILE 26 52 1 Y 1 B HIS 27 ? B HIS 27 53 1 Y 1 B ASP 28 ? B ASP 28 54 1 Y 1 B TYR 29 ? B TYR 29 55 1 Y 1 B THR 30 ? B THR 30 56 1 Y 1 B ARG 31 ? B ARG 31 57 1 Y 1 B VAL 32 ? B VAL 32 58 1 Y 1 B ASN 33 ? B ASN 33 59 1 Y 1 B ASP 34 ? B ASP 34 60 1 Y 1 B ASP 35 ? B ASP 35 61 1 Y 1 B VAL 36 ? B VAL 36 62 1 Y 1 B ALA 37 ? B ALA 37 63 1 Y 1 B ALA 38 ? B ALA 38 64 1 Y 1 B GLN 39 ? B GLN 39 65 1 Y 1 B GLN 40 ? B GLN 40 66 1 Y 1 B ALA 41 ? B ALA 41 67 1 Y 1 B THR 42 ? B THR 42 68 1 Y 1 B ASN 43 ? B ASN 43 69 1 Y 1 B ALA 44 ? B ALA 44 70 1 Y 1 B LYS 45 ? B LYS 45 71 1 Y 1 B LEU 46 ? B LEU 46 72 1 Y 1 B LYS 47 ? B LYS 47 73 1 Y 1 B ALA 48 ? B ALA 48 74 1 Y 1 B ARG 49 ? B ARG 49 75 1 Y 1 B ASN 50 ? B ASN 50 76 1 Y 1 B ASP 51 ? B ASP 51 77 1 Y 1 B GLN 52 ? B GLN 52 78 1 Y 1 B LEU 53 ? B LEU 53 79 1 Y 1 B PHE 54 ? B PHE 54 80 1 Y 1 B ALA 55 ? B ALA 55 81 1 Y 1 B GLU 56 ? B GLU 56 82 1 Y 1 B ILE 57 ? B ILE 57 83 1 Y 1 B ASP 58 ? B ASP 58 84 1 Y 1 B ASP 59 ? B ASP 59 85 1 Y 1 B LEU 60 ? B LEU 60 86 1 Y 1 B ASN 61 ? B ASN 61 87 1 Y 1 B GLY 62 ? B GLY 62 88 1 Y 1 B GLY 63 ? B GLY 63 89 1 Y 1 B VAL 88 ? B VAL 88 90 1 Y 1 B PRO 89 ? B PRO 89 91 1 Y 1 B ASP 90 ? B ASP 90 92 1 Y 1 B ALA 91 ? B ALA 91 93 1 Y 1 B SER 92 ? B SER 92 94 1 Y 1 B LYS 93 ? B LYS 93 95 1 Y 1 B ARG 94 ? B ARG 94 96 1 Y 1 B ALA 95 ? B ALA 95 97 1 Y 1 B GLN 96 ? B GLN 96 98 1 Y 1 B SER 97 ? B SER 97 99 1 Y 1 B ALA 98 ? B ALA 98 100 1 Y 1 B GLY 99 ? B GLY 99 101 1 Y 1 B GLN 100 ? B GLN 100 102 1 Y 1 B ASN 101 ? B ASN 101 103 1 Y 1 B ASN 102 ? B ASN 102 104 1 Y 1 B ARG 103 ? B ARG 103 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Wellcome Trust' 'United Kingdom' 202754/Z/16/Z 1 'Medical Research Council (United Kingdom)' 'United Kingdom' U105184326 2 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'surface plasmon resonance' _pdbx_struct_assembly_auth_evidence.details ? #