data_6HAM # _entry.id 6HAM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.313 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6HAM WWPDB D_1200011345 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6HAM _pdbx_database_status.recvd_initial_deposition_date 2018-08-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kantaev, R.' 1 ? 'Inbal, R.' 2 ? 'Goldenzweig, A.' 3 ? 'Barak, Y.' 4 ? 'Dym, O.' 5 ? 'Peleg, Y.' 6 ? 'Albek, S.' 7 ? 'Fleishman, S.J.' 8 ? 'Haran, G.' 9 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Phys.Chem.B _citation.journal_id_ASTM JPCBFK _citation.journal_id_CSD 1278 _citation.journal_id_ISSN 1089-5647 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 122 _citation.language ? _citation.page_first 11030 _citation.page_last 11038 _citation.title 'Manipulating the Folding Landscape of a Multidomain Protein.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jpcb.8b04834 _citation.pdbx_database_id_PubMed 30088929 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kantaev, R.' 1 ? primary 'Riven, I.' 2 ? primary 'Goldenzweig, A.' 3 ? primary 'Barak, Y.' 4 ? primary 'Dym, O.' 5 ? primary 'Peleg, Y.' 6 ? primary 'Albeck, S.' 7 ? primary 'Fleishman, S.J.' 8 0000-0003-3177-7560 primary 'Haran, G.' 9 0000-0003-1837-9779 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6HAM _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.440 _cell.length_a_esd ? _cell.length_b 58.440 _cell.length_b_esd ? _cell.length_c 77.837 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6HAM _symmetry.cell_setting ? _symmetry.Int_Tables_number 78 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Adenylate kinase' 23696.146 1 2.7.4.3 ? ? ? 2 non-polymer syn "BIS(ADENOSINE)-5'-PENTAPHOSPHATE" 916.367 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AK,ATP-AMP transphosphorylase,ATP:AMP phosphotransferase,Adenylate monophosphate kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAIKSGSELGKQAKDIMDAGKLVTDEIIIALVKERICQEDSRNG FLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQ EETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVCEVRADLEKILG ; _entity_poly.pdbx_seq_one_letter_code_can ;MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAIKSGSELGKQAKDIMDAGKLVTDEIIIALVKERICQEDSRNG FLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQ EETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVCEVRADLEKILG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 ILE n 1 4 ILE n 1 5 LEU n 1 6 LEU n 1 7 GLY n 1 8 ALA n 1 9 PRO n 1 10 GLY n 1 11 ALA n 1 12 GLY n 1 13 LYS n 1 14 GLY n 1 15 THR n 1 16 GLN n 1 17 ALA n 1 18 GLN n 1 19 PHE n 1 20 ILE n 1 21 MET n 1 22 GLU n 1 23 LYS n 1 24 TYR n 1 25 GLY n 1 26 ILE n 1 27 PRO n 1 28 GLN n 1 29 ILE n 1 30 SER n 1 31 THR n 1 32 GLY n 1 33 ASP n 1 34 MET n 1 35 LEU n 1 36 ARG n 1 37 ALA n 1 38 ALA n 1 39 ILE n 1 40 LYS n 1 41 SER n 1 42 GLY n 1 43 SER n 1 44 GLU n 1 45 LEU n 1 46 GLY n 1 47 LYS n 1 48 GLN n 1 49 ALA n 1 50 LYS n 1 51 ASP n 1 52 ILE n 1 53 MET n 1 54 ASP n 1 55 ALA n 1 56 GLY n 1 57 LYS n 1 58 LEU n 1 59 VAL n 1 60 THR n 1 61 ASP n 1 62 GLU n 1 63 ILE n 1 64 ILE n 1 65 ILE n 1 66 ALA n 1 67 LEU n 1 68 VAL n 1 69 LYS n 1 70 GLU n 1 71 ARG n 1 72 ILE n 1 73 CYS n 1 74 GLN n 1 75 GLU n 1 76 ASP n 1 77 SER n 1 78 ARG n 1 79 ASN n 1 80 GLY n 1 81 PHE n 1 82 LEU n 1 83 LEU n 1 84 ASP n 1 85 GLY n 1 86 PHE n 1 87 PRO n 1 88 ARG n 1 89 THR n 1 90 ILE n 1 91 PRO n 1 92 GLN n 1 93 ALA n 1 94 ASP n 1 95 ALA n 1 96 MET n 1 97 LYS n 1 98 GLU n 1 99 ALA n 1 100 GLY n 1 101 ILE n 1 102 ASN n 1 103 VAL n 1 104 ASP n 1 105 TYR n 1 106 VAL n 1 107 LEU n 1 108 GLU n 1 109 PHE n 1 110 ASP n 1 111 VAL n 1 112 PRO n 1 113 ASP n 1 114 GLU n 1 115 LEU n 1 116 ILE n 1 117 VAL n 1 118 ASP n 1 119 ARG n 1 120 ILE n 1 121 VAL n 1 122 GLY n 1 123 ARG n 1 124 ARG n 1 125 VAL n 1 126 HIS n 1 127 ALA n 1 128 PRO n 1 129 SER n 1 130 GLY n 1 131 ARG n 1 132 VAL n 1 133 TYR n 1 134 HIS n 1 135 VAL n 1 136 LYS n 1 137 PHE n 1 138 ASN n 1 139 PRO n 1 140 PRO n 1 141 LYS n 1 142 VAL n 1 143 GLU n 1 144 GLY n 1 145 LYS n 1 146 ASP n 1 147 ASP n 1 148 VAL n 1 149 THR n 1 150 GLY n 1 151 GLU n 1 152 GLU n 1 153 LEU n 1 154 THR n 1 155 THR n 1 156 ARG n 1 157 LYS n 1 158 ASP n 1 159 ASP n 1 160 GLN n 1 161 GLU n 1 162 GLU n 1 163 THR n 1 164 VAL n 1 165 ARG n 1 166 LYS n 1 167 ARG n 1 168 LEU n 1 169 VAL n 1 170 GLU n 1 171 TYR n 1 172 HIS n 1 173 GLN n 1 174 MET n 1 175 THR n 1 176 ALA n 1 177 PRO n 1 178 LEU n 1 179 ILE n 1 180 GLY n 1 181 TYR n 1 182 TYR n 1 183 SER n 1 184 LYS n 1 185 GLU n 1 186 ALA n 1 187 GLU n 1 188 ALA n 1 189 GLY n 1 190 ASN n 1 191 THR n 1 192 LYS n 1 193 TYR n 1 194 ALA n 1 195 LYS n 1 196 VAL n 1 197 ASP n 1 198 GLY n 1 199 THR n 1 200 LYS n 1 201 PRO n 1 202 VAL n 1 203 CYS n 1 204 GLU n 1 205 VAL n 1 206 ARG n 1 207 ALA n 1 208 ASP n 1 209 LEU n 1 210 GLU n 1 211 LYS n 1 212 ILE n 1 213 LEU n 1 214 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 214 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'adk, dnaW, plsA, b0474, JW0463' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli (strain K12)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KAD_ECOLI _struct_ref.pdbx_db_accession P69441 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNG FLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQ EETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6HAM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 214 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P69441 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 214 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 214 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6HAM ILE A 39 ? UNP P69441 VAL 39 'engineered mutation' 39 1 1 6HAM ILE A 63 ? UNP P69441 LEU 63 'engineered mutation' 63 2 1 6HAM ILE A 64 ? UNP P69441 VAL 64 'engineered mutation' 64 3 1 6HAM CYS A 73 ? UNP P69441 ALA 73 'engineered mutation' 73 4 1 6HAM SER A 77 ? UNP P69441 CYS 77 'engineered mutation' 77 5 1 6HAM CYS A 203 ? UNP P69441 ALA 203 'engineered mutation' 203 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 AP5 non-polymer . "BIS(ADENOSINE)-5'-PENTAPHOSPHATE" ? 'C20 H29 N10 O22 P5' 916.367 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6HAM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.80 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.14 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;14% PEG 4000 0.05M Tris pH=8 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-05-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97950 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97950 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6HAM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.55 _reflns.d_resolution_low 46.73 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8598 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.98 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.02 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.43 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.55 _reflns_shell.d_res_low 2.64 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 864 _reflns_shell.percent_possible_all 100.00 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.1 _reflns_shell.pdbx_Rsym_value 0.20 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.95 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] 0.95 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -1.89 _refine.B_iso_max ? _refine.B_iso_mean 58.487 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.947 _refine.correlation_coeff_Fo_to_Fc_free 0.939 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6HAM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.55 _refine.ls_d_res_low 58.44 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8155 _refine.ls_number_reflns_R_free 444 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.99 _refine.ls_percent_reflns_R_free 5.2 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20511 _refine.ls_R_factor_R_free 0.24325 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.20311 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.594 _refine.pdbx_overall_ESU_R_Free 0.289 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 10.072 _refine.overall_SU_ML 0.217 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1640 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 57 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1697 _refine_hist.d_res_high 2.55 _refine_hist.d_res_low 58.44 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 0.015 1734 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.017 1578 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.669 1.729 2358 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.920 1.669 3703 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.949 5.000 215 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 29.254 22.118 85 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.919 15.000 304 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.344 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.093 0.200 237 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1913 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 283 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 4.370 5.891 860 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.355 5.886 859 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.281 8.835 1075 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.279 8.841 1076 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.017 6.242 874 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.014 6.240 875 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 7.044 9.182 1279 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 8.931 70.137 1892 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 8.929 70.116 1893 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.550 _refine_ls_shell.d_res_low 2.616 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 40 _refine_ls_shell.number_reflns_R_work 588 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.370 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.260 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6HAM _struct.title 'Adenylate kinase' _struct.pdbx_descriptor 'Adenylate kinase (E.C.2.7.4.3)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6HAM _struct_keywords.text 'Adenylat kinase, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 12 ? GLY A 25 ? GLY A 12 GLY A 25 1 ? 14 HELX_P HELX_P2 AA2 THR A 31 ? GLY A 42 ? THR A 31 GLY A 42 1 ? 12 HELX_P HELX_P3 AA3 SER A 43 ? ALA A 55 ? SER A 43 ALA A 55 1 ? 13 HELX_P HELX_P4 AA4 THR A 60 ? CYS A 73 ? THR A 60 CYS A 73 1 ? 14 HELX_P HELX_P5 AA5 THR A 89 ? ALA A 99 ? THR A 89 ALA A 99 1 ? 11 HELX_P HELX_P6 AA6 PRO A 112 ? VAL A 121 ? PRO A 112 VAL A 121 1 ? 10 HELX_P HELX_P7 AA7 ARG A 156 ? ASP A 159 ? ARG A 156 ASP A 159 5 ? 4 HELX_P HELX_P8 AA8 GLN A 160 ? THR A 175 ? GLN A 160 THR A 175 1 ? 16 HELX_P HELX_P9 AA9 PRO A 177 ? ALA A 188 ? PRO A 177 ALA A 188 1 ? 12 HELX_P HELX_P10 AB1 PRO A 201 ? GLY A 214 ? PRO A 201 GLY A 214 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 86 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 86 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 87 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 87 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -17.24 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 28 ? SER A 30 ? GLN A 28 SER A 30 AA1 2 PHE A 81 ? ASP A 84 ? PHE A 81 ASP A 84 AA1 3 ARG A 2 ? LEU A 6 ? ARG A 2 LEU A 6 AA1 4 TYR A 105 ? ASP A 110 ? TYR A 105 ASP A 110 AA1 5 LYS A 192 ? ASP A 197 ? LYS A 192 ASP A 197 AA2 1 ARG A 123 ? HIS A 126 ? ARG A 123 HIS A 126 AA2 2 ARG A 131 ? HIS A 134 ? ARG A 131 HIS A 134 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 29 ? N ILE A 29 O LEU A 82 ? O LEU A 82 AA1 2 3 O LEU A 83 ? O LEU A 83 N ILE A 3 ? N ILE A 3 AA1 3 4 N ILE A 4 ? N ILE A 4 O LEU A 107 ? O LEU A 107 AA1 4 5 N VAL A 106 ? N VAL A 106 O LYS A 192 ? O LYS A 192 AA2 1 2 N HIS A 126 ? N HIS A 126 O ARG A 131 ? O ARG A 131 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id AP5 _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 29 _struct_site.details 'binding site for residue AP5 A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 29 PRO A 9 ? PRO A 9 . ? 1_555 ? 2 AC1 29 GLY A 10 ? GLY A 10 . ? 1_555 ? 3 AC1 29 ALA A 11 ? ALA A 11 . ? 1_555 ? 4 AC1 29 GLY A 12 ? GLY A 12 . ? 1_555 ? 5 AC1 29 LYS A 13 ? LYS A 13 . ? 1_555 ? 6 AC1 29 GLY A 14 ? GLY A 14 . ? 1_555 ? 7 AC1 29 THR A 15 ? THR A 15 . ? 1_555 ? 8 AC1 29 THR A 31 ? THR A 31 . ? 1_555 ? 9 AC1 29 GLY A 32 ? GLY A 32 . ? 1_555 ? 10 AC1 29 LEU A 35 ? LEU A 35 . ? 1_555 ? 11 AC1 29 ARG A 36 ? ARG A 36 . ? 1_555 ? 12 AC1 29 MET A 53 ? MET A 53 . ? 1_555 ? 13 AC1 29 LYS A 57 ? LYS A 57 . ? 1_555 ? 14 AC1 29 VAL A 59 ? VAL A 59 . ? 1_555 ? 15 AC1 29 ILE A 64 ? ILE A 64 . ? 1_555 ? 16 AC1 29 GLY A 85 ? GLY A 85 . ? 1_555 ? 17 AC1 29 ARG A 88 ? ARG A 88 . ? 1_555 ? 18 AC1 29 GLN A 92 ? GLN A 92 . ? 1_555 ? 19 AC1 29 ARG A 119 ? ARG A 119 . ? 1_555 ? 20 AC1 29 ARG A 123 ? ARG A 123 . ? 1_555 ? 21 AC1 29 VAL A 132 ? VAL A 132 . ? 1_555 ? 22 AC1 29 TYR A 133 ? TYR A 133 . ? 1_555 ? 23 AC1 29 HIS A 134 ? HIS A 134 . ? 1_555 ? 24 AC1 29 PHE A 137 ? PHE A 137 . ? 1_555 ? 25 AC1 29 ARG A 156 ? ARG A 156 . ? 1_555 ? 26 AC1 29 ARG A 167 ? ARG A 167 . ? 1_555 ? 27 AC1 29 LYS A 200 ? LYS A 200 . ? 1_555 ? 28 AC1 29 PRO A 201 ? PRO A 201 . ? 1_555 ? 29 AC1 29 VAL A 202 ? VAL A 202 . ? 1_555 ? # _atom_sites.entry_id 6HAM _atom_sites.fract_transf_matrix[1][1] 0.017112 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017112 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012847 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 MET 96 96 96 MET MET A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 HIS 134 134 134 HIS HIS A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 TYR 171 171 171 TYR TYR A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 MET 174 174 174 MET MET A . n A 1 175 THR 175 175 175 THR THR A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 PRO 177 177 177 PRO PRO A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 TYR 181 181 181 TYR TYR A . n A 1 182 TYR 182 182 182 TYR TYR A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 ASN 190 190 190 ASN ASN A . n A 1 191 THR 191 191 191 THR THR A . n A 1 192 LYS 192 192 192 LYS LYS A . n A 1 193 TYR 193 193 193 TYR TYR A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 GLY 198 198 198 GLY GLY A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 PRO 201 201 201 PRO PRO A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 CYS 203 203 203 CYS CYS A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 ARG 206 206 206 ARG ARG A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 ASP 208 208 208 ASP ASP A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 GLU 210 210 210 GLU GLU A . n A 1 211 LYS 211 211 211 LYS LYS A . n A 1 212 ILE 212 212 212 ILE ILE A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 GLY 214 214 214 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id AP5 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 301 _pdbx_nonpoly_scheme.auth_seq_num 215 _pdbx_nonpoly_scheme.pdb_mon_id AP5 _pdbx_nonpoly_scheme.auth_mon_id AP5 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1480 ? 1 MORE -5 ? 1 'SSA (A^2)' 10460 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2019-08-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0222 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG1 A THR 15 ? ? O1A A AP5 301 ? ? 1.85 2 1 O A LYS 157 ? ? NE2 A GLN 160 ? ? 2.10 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 73 ? ? -75.08 27.89 2 1 ASN A 138 ? ? -150.15 61.94 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 18 ? CD ? A GLN 18 CD 2 1 Y 1 A GLN 18 ? OE1 ? A GLN 18 OE1 3 1 Y 1 A GLN 18 ? NE2 ? A GLN 18 NE2 4 1 Y 1 A LYS 23 ? CE ? A LYS 23 CE 5 1 Y 1 A LYS 23 ? NZ ? A LYS 23 NZ 6 1 Y 1 A GLU 75 ? CG ? A GLU 75 CG 7 1 Y 1 A GLU 75 ? CD ? A GLU 75 CD 8 1 Y 1 A GLU 75 ? OE1 ? A GLU 75 OE1 9 1 Y 1 A GLU 75 ? OE2 ? A GLU 75 OE2 10 1 Y 1 A GLU 162 ? CD ? A GLU 162 CD 11 1 Y 1 A GLU 162 ? OE1 ? A GLU 162 OE1 12 1 Y 1 A GLU 162 ? OE2 ? A GLU 162 OE2 13 1 Y 1 A LYS 192 ? CG ? A LYS 192 CG 14 1 Y 1 A LYS 192 ? CD ? A LYS 192 CD 15 1 Y 1 A LYS 192 ? CE ? A LYS 192 CE 16 1 Y 1 A LYS 192 ? NZ ? A LYS 192 NZ 17 1 Y 1 A LYS 211 ? CG ? A LYS 211 CG 18 1 Y 1 A LYS 211 ? CD ? A LYS 211 CD 19 1 Y 1 A LYS 211 ? CE ? A LYS 211 CE 20 1 Y 1 A LYS 211 ? NZ ? A LYS 211 NZ # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name "BIS(ADENOSINE)-5'-PENTAPHOSPHATE" _pdbx_entity_nonpoly.comp_id AP5 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #