data_6HHH # _entry.id 6HHH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.307 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6HHH WWPDB D_1200011560 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6HHH _pdbx_database_status.recvd_initial_deposition_date 2018-08-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Landel, I.' 1 ? 'Weisner, J.' 2 ? 'Mueller, M.P.' 3 ? 'Scheinpflug, R.' 4 ? 'Rauh, D.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-6520 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 3573 _citation.page_last 3585 _citation.title 'Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/c8sc05212c _citation.pdbx_database_id_PubMed 30996949 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Uhlenbrock, N.' 1 0000-0002-4489-9535 primary 'Smith, S.' 2 ? primary 'Weisner, J.' 3 0000-0002-6103-7371 primary 'Landel, I.' 4 0000-0003-4433-0872 primary 'Lindemann, M.' 5 ? primary 'Le, T.A.' 6 ? primary 'Hardick, J.' 7 0000-0002-0062-1849 primary 'Gontla, R.' 8 ? primary 'Scheinpflug, R.' 9 ? primary 'Czodrowski, P.' 10 0000-0002-7390-8795 primary 'Janning, P.' 11 ? primary 'Depta, L.' 12 ? primary 'Quambusch, L.' 13 ? primary 'Muller, M.P.' 14 0000-0002-1529-8933 primary 'Engels, B.' 15 0000-0003-3057-389X primary 'Rauh, D.' 16 0000-0002-1970-7642 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6HHH _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.320 _cell.length_a_esd ? _cell.length_b 70.890 _cell.length_b_esd ? _cell.length_c 91.080 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6HHH _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RAC-alpha serine/threonine-protein kinase' 51746.035 1 ? ? ? ? 2 non-polymer syn '~{N}-[4-[4-[[4-(5-oxidanylidene-3-phenyl-6~{H}-1,6-naphthyridin-2-yl)phenyl]methyl]piperazin-1-yl]phenyl]propanamide' 543.658 1 ? ? ? ? 3 water nat water 18.015 21 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Akt1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQW TTVIERTFHVETPEEREEWTTAIQTVADGLKKQAAAEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGT FGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEV LEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAK EIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQM ; _entity_poly.pdbx_seq_one_letter_code_can ;GSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQW TTVIERTFHVETPEEREEWTTAIQTVADGLKKQAAAEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGT FGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEV LEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAK EIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ASP n 1 4 VAL n 1 5 ALA n 1 6 ILE n 1 7 VAL n 1 8 LYS n 1 9 GLU n 1 10 GLY n 1 11 TRP n 1 12 LEU n 1 13 HIS n 1 14 LYS n 1 15 ARG n 1 16 GLY n 1 17 GLU n 1 18 TYR n 1 19 ILE n 1 20 LYS n 1 21 THR n 1 22 TRP n 1 23 ARG n 1 24 PRO n 1 25 ARG n 1 26 TYR n 1 27 PHE n 1 28 LEU n 1 29 LEU n 1 30 LYS n 1 31 ASN n 1 32 ASP n 1 33 GLY n 1 34 THR n 1 35 PHE n 1 36 ILE n 1 37 GLY n 1 38 TYR n 1 39 LYS n 1 40 GLU n 1 41 ARG n 1 42 PRO n 1 43 GLN n 1 44 ASP n 1 45 VAL n 1 46 ASP n 1 47 GLN n 1 48 ARG n 1 49 GLU n 1 50 ALA n 1 51 PRO n 1 52 LEU n 1 53 ASN n 1 54 ASN n 1 55 PHE n 1 56 SER n 1 57 VAL n 1 58 ALA n 1 59 GLN n 1 60 CYS n 1 61 GLN n 1 62 LEU n 1 63 MET n 1 64 LYS n 1 65 THR n 1 66 GLU n 1 67 ARG n 1 68 PRO n 1 69 ARG n 1 70 PRO n 1 71 ASN n 1 72 THR n 1 73 PHE n 1 74 ILE n 1 75 ILE n 1 76 ARG n 1 77 CYS n 1 78 LEU n 1 79 GLN n 1 80 TRP n 1 81 THR n 1 82 THR n 1 83 VAL n 1 84 ILE n 1 85 GLU n 1 86 ARG n 1 87 THR n 1 88 PHE n 1 89 HIS n 1 90 VAL n 1 91 GLU n 1 92 THR n 1 93 PRO n 1 94 GLU n 1 95 GLU n 1 96 ARG n 1 97 GLU n 1 98 GLU n 1 99 TRP n 1 100 THR n 1 101 THR n 1 102 ALA n 1 103 ILE n 1 104 GLN n 1 105 THR n 1 106 VAL n 1 107 ALA n 1 108 ASP n 1 109 GLY n 1 110 LEU n 1 111 LYS n 1 112 LYS n 1 113 GLN n 1 114 ALA n 1 115 ALA n 1 116 ALA n 1 117 GLU n 1 118 MET n 1 119 ASP n 1 120 PHE n 1 121 ARG n 1 122 SER n 1 123 GLY n 1 124 SER n 1 125 PRO n 1 126 SER n 1 127 ASP n 1 128 ASN n 1 129 SER n 1 130 GLY n 1 131 ALA n 1 132 GLU n 1 133 GLU n 1 134 MET n 1 135 GLU n 1 136 VAL n 1 137 SER n 1 138 LEU n 1 139 ALA n 1 140 LYS n 1 141 PRO n 1 142 LYS n 1 143 HIS n 1 144 ARG n 1 145 VAL n 1 146 THR n 1 147 MET n 1 148 ASN n 1 149 GLU n 1 150 PHE n 1 151 GLU n 1 152 TYR n 1 153 LEU n 1 154 LYS n 1 155 LEU n 1 156 LEU n 1 157 GLY n 1 158 LYS n 1 159 GLY n 1 160 THR n 1 161 PHE n 1 162 GLY n 1 163 LYS n 1 164 VAL n 1 165 ILE n 1 166 LEU n 1 167 VAL n 1 168 LYS n 1 169 GLU n 1 170 LYS n 1 171 ALA n 1 172 THR n 1 173 GLY n 1 174 ARG n 1 175 TYR n 1 176 TYR n 1 177 ALA n 1 178 MET n 1 179 LYS n 1 180 ILE n 1 181 LEU n 1 182 LYS n 1 183 LYS n 1 184 GLU n 1 185 VAL n 1 186 ILE n 1 187 VAL n 1 188 ALA n 1 189 LYS n 1 190 ASP n 1 191 GLU n 1 192 VAL n 1 193 ALA n 1 194 HIS n 1 195 THR n 1 196 LEU n 1 197 THR n 1 198 GLU n 1 199 ASN n 1 200 ARG n 1 201 VAL n 1 202 LEU n 1 203 GLN n 1 204 ASN n 1 205 SER n 1 206 ARG n 1 207 HIS n 1 208 PRO n 1 209 PHE n 1 210 LEU n 1 211 THR n 1 212 ALA n 1 213 LEU n 1 214 LYS n 1 215 TYR n 1 216 SER n 1 217 PHE n 1 218 GLN n 1 219 THR n 1 220 HIS n 1 221 ASP n 1 222 ARG n 1 223 LEU n 1 224 CYS n 1 225 PHE n 1 226 VAL n 1 227 MET n 1 228 GLU n 1 229 TYR n 1 230 ALA n 1 231 ASN n 1 232 GLY n 1 233 GLY n 1 234 GLU n 1 235 LEU n 1 236 PHE n 1 237 PHE n 1 238 HIS n 1 239 LEU n 1 240 SER n 1 241 ARG n 1 242 GLU n 1 243 ARG n 1 244 VAL n 1 245 PHE n 1 246 SER n 1 247 GLU n 1 248 ASP n 1 249 ARG n 1 250 ALA n 1 251 ARG n 1 252 PHE n 1 253 TYR n 1 254 GLY n 1 255 ALA n 1 256 GLU n 1 257 ILE n 1 258 VAL n 1 259 SER n 1 260 ALA n 1 261 LEU n 1 262 ASP n 1 263 TYR n 1 264 LEU n 1 265 HIS n 1 266 SER n 1 267 GLU n 1 268 LYS n 1 269 ASN n 1 270 VAL n 1 271 VAL n 1 272 TYR n 1 273 ARG n 1 274 ASP n 1 275 LEU n 1 276 LYS n 1 277 LEU n 1 278 GLU n 1 279 ASN n 1 280 LEU n 1 281 MET n 1 282 LEU n 1 283 ASP n 1 284 LYS n 1 285 ASP n 1 286 GLY n 1 287 HIS n 1 288 ILE n 1 289 LYS n 1 290 ILE n 1 291 THR n 1 292 ASP n 1 293 PHE n 1 294 GLY n 1 295 LEU n 1 296 CYS n 1 297 LYS n 1 298 GLU n 1 299 GLY n 1 300 ILE n 1 301 LYS n 1 302 ASP n 1 303 GLY n 1 304 ALA n 1 305 THR n 1 306 MET n 1 307 LYS n 1 308 THR n 1 309 PHE n 1 310 CYS n 1 311 GLY n 1 312 THR n 1 313 PRO n 1 314 GLU n 1 315 TYR n 1 316 LEU n 1 317 ALA n 1 318 PRO n 1 319 GLU n 1 320 VAL n 1 321 LEU n 1 322 GLU n 1 323 ASP n 1 324 ASN n 1 325 ASP n 1 326 TYR n 1 327 GLY n 1 328 ARG n 1 329 ALA n 1 330 VAL n 1 331 ASP n 1 332 TRP n 1 333 TRP n 1 334 GLY n 1 335 LEU n 1 336 GLY n 1 337 VAL n 1 338 VAL n 1 339 MET n 1 340 TYR n 1 341 GLU n 1 342 MET n 1 343 MET n 1 344 CYS n 1 345 GLY n 1 346 ARG n 1 347 LEU n 1 348 PRO n 1 349 PHE n 1 350 TYR n 1 351 ASN n 1 352 GLN n 1 353 ASP n 1 354 HIS n 1 355 GLU n 1 356 LYS n 1 357 LEU n 1 358 PHE n 1 359 GLU n 1 360 LEU n 1 361 ILE n 1 362 LEU n 1 363 MET n 1 364 GLU n 1 365 GLU n 1 366 ILE n 1 367 ARG n 1 368 PHE n 1 369 PRO n 1 370 ARG n 1 371 THR n 1 372 LEU n 1 373 GLY n 1 374 PRO n 1 375 GLU n 1 376 ALA n 1 377 LYS n 1 378 SER n 1 379 LEU n 1 380 LEU n 1 381 SER n 1 382 GLY n 1 383 LEU n 1 384 LEU n 1 385 LYS n 1 386 LYS n 1 387 ASP n 1 388 PRO n 1 389 LYS n 1 390 GLN n 1 391 ARG n 1 392 LEU n 1 393 GLY n 1 394 GLY n 1 395 GLY n 1 396 SER n 1 397 GLU n 1 398 ASP n 1 399 ALA n 1 400 LYS n 1 401 GLU n 1 402 ILE n 1 403 MET n 1 404 GLN n 1 405 HIS n 1 406 ARG n 1 407 PHE n 1 408 PHE n 1 409 ALA n 1 410 GLY n 1 411 ILE n 1 412 VAL n 1 413 TRP n 1 414 GLN n 1 415 HIS n 1 416 VAL n 1 417 TYR n 1 418 GLU n 1 419 LYS n 1 420 LYS n 1 421 LEU n 1 422 SER n 1 423 PRO n 1 424 PRO n 1 425 PHE n 1 426 LYS n 1 427 PRO n 1 428 GLN n 1 429 VAL n 1 430 THR n 1 431 SER n 1 432 GLU n 1 433 THR n 1 434 ASP n 1 435 THR n 1 436 ARG n 1 437 TYR n 1 438 PHE n 1 439 ASP n 1 440 GLU n 1 441 GLU n 1 442 PHE n 1 443 THR n 1 444 ALA n 1 445 GLN n 1 446 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P31749 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ;SDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWT TVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTF GKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSR ERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVL EDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKE IMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQM ; _struct_ref.id 1 _struct_ref.pdbx_align_begin 2 _struct_ref.db_name UNP _struct_ref.db_code AKT1_HUMAN # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6HHH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 446 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P31749 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 446 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 446 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6HHF GLY A 1 ? UNP P31749 ? ? 'expression tag' 1 1 1 6HHF ALA A 114 ? UNP P31749 GLU 114 'engineered mutation' 114 2 1 6HHF ALA A 115 ? UNP P31749 GLU 115 'engineered mutation' 115 3 1 6HHF ALA A 116 ? UNP P31749 GLU 116 'engineered mutation' 116 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G4Q non-polymer . '~{N}-[4-[4-[[4-(5-oxidanylidene-3-phenyl-6~{H}-1,6-naphthyridin-2-yl)phenyl]methyl]piperazin-1-yl]phenyl]propanamide' ? 'C34 H33 N5 O2' 543.658 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6HHH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.19 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.93 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1.25 mM Na-acetate, 3.75 mM Na-citrate, 15% v/v PEG 2000 MME, pH 7.5, 3 mg/mL Akt1, (in 25 mM TRIS, 100 mM NaCl, 10 % Glycerol, 5 mM DTT, pH 7.5), 1ul reservoir + 1ul protein solution ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.99992 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.99992 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6HHH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 45.54 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13005 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.0 _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.48 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.075 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.8 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.77 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1303 _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.997 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.997 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.921 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6HHH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.700 _refine.ls_d_res_low 45.540 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13003 _refine.ls_number_reflns_R_free 651 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.97 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2170 _refine.ls_R_factor_R_free 0.2657 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2144 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6HHG _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.96 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.28 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 3132 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 41 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 3194 _refine_hist.d_res_high 2.700 _refine_hist.d_res_low 45.540 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 3254 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.787 ? 4382 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.178 ? 1245 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.029 ? 454 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 556 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.7001 2.9086 . . 127 2398 100.00 . . . 0.3380 . 0.2692 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9086 3.2012 . . 129 2448 100.00 . . . 0.2935 . 0.2509 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2012 3.6643 . . 128 2435 100.00 . . . 0.2966 . 0.2288 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6643 4.6159 . . 130 2476 100.00 . . . 0.2362 . 0.1970 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.6159 45.5465 . . 137 2595 100.00 . . . 0.2584 . 0.2058 . . . . . . . . . . # _struct.entry_id 6HHH _struct.title 'Crystal Structure of AKT1 in Complex with Covalent-Allosteric AKT Inhibitor 31' _struct.pdbx_descriptor 'RAC-alpha serine/threonine-protein kinase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6HHH _struct_keywords.text 'Akt1, covalent-allosteric, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 52 ? SER A 56 ? LEU A 52 SER A 56 5 ? 5 HELX_P HELX_P2 AA2 THR A 92 ? LEU A 110 ? THR A 92 LEU A 110 1 ? 19 HELX_P HELX_P3 AA3 THR A 146 ? ASN A 148 ? THR A 146 ASN A 148 5 ? 3 HELX_P HELX_P4 AA4 GLU A 234 ? ARG A 243 ? GLU A 234 ARG A 243 1 ? 10 HELX_P HELX_P5 AA5 SER A 246 ? GLU A 267 ? SER A 246 GLU A 267 1 ? 22 HELX_P HELX_P6 AA6 LYS A 276 ? GLU A 278 ? LYS A 276 GLU A 278 5 ? 3 HELX_P HELX_P7 AA7 GLY A 311 ? LEU A 316 ? GLY A 311 LEU A 316 5 ? 6 HELX_P HELX_P8 AA8 ALA A 317 ? GLU A 322 ? ALA A 317 GLU A 322 1 ? 6 HELX_P HELX_P9 AA9 ARG A 328 ? GLY A 345 ? ARG A 328 GLY A 345 1 ? 18 HELX_P HELX_P10 AB1 ASP A 353 ? MET A 363 ? ASP A 353 MET A 363 1 ? 11 HELX_P HELX_P11 AB2 GLY A 373 ? LEU A 384 ? GLY A 373 LEU A 384 1 ? 12 HELX_P HELX_P12 AB3 ASP A 398 ? GLN A 404 ? ASP A 398 GLN A 404 1 ? 7 HELX_P HELX_P13 AB4 HIS A 405 ? ALA A 409 ? HIS A 405 ALA A 409 5 ? 5 HELX_P HELX_P14 AB5 VAL A 412 ? GLU A 418 ? VAL A 412 GLU A 418 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 60 SG ? ? ? 1_555 A CYS 77 SG ? ? A CYS 60 A CYS 77 1_555 ? ? ? ? ? ? ? 2.043 ? covale1 covale none ? A CYS 296 SG ? ? ? 1_555 B G4Q . CBN ? ? A CYS 296 A G4Q 501 1_555 ? ? ? ? ? ? ? 1.831 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 67 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 67 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 68 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 68 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.70 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 5 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 35 ? TYR A 38 ? PHE A 35 TYR A 38 AA1 2 TRP A 22 ? LYS A 30 ? TRP A 22 LYS A 30 AA1 3 ILE A 6 ? ARG A 15 ? ILE A 6 ARG A 15 AA1 4 THR A 82 ? HIS A 89 ? THR A 82 HIS A 89 AA1 5 THR A 72 ? GLN A 79 ? THR A 72 GLN A 79 AA1 6 CYS A 60 ? THR A 65 ? CYS A 60 THR A 65 AA2 1 PHE A 150 ? LYS A 158 ? PHE A 150 LYS A 158 AA2 2 GLY A 162 ? GLU A 169 ? GLY A 162 GLU A 169 AA2 3 TYR A 175 ? LYS A 182 ? TYR A 175 LYS A 182 AA2 4 ARG A 222 ? GLU A 228 ? ARG A 222 GLU A 228 AA2 5 LEU A 213 ? GLN A 218 ? LEU A 213 GLN A 218 AA3 1 LEU A 280 ? LEU A 282 ? LEU A 280 LEU A 282 AA3 2 ILE A 288 ? ILE A 290 ? ILE A 288 ILE A 290 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 36 ? O ILE A 36 N LEU A 28 ? N LEU A 28 AA1 2 3 O LEU A 29 ? O LEU A 29 N VAL A 7 ? N VAL A 7 AA1 3 4 N ARG A 15 ? N ARG A 15 O THR A 87 ? O THR A 87 AA1 4 5 O ILE A 84 ? O ILE A 84 N CYS A 77 ? N CYS A 77 AA1 5 6 O ILE A 74 ? O ILE A 74 N MET A 63 ? N MET A 63 AA2 1 2 N GLY A 157 ? N GLY A 157 O VAL A 164 ? O VAL A 164 AA2 2 3 N VAL A 167 ? N VAL A 167 O TYR A 176 ? O TYR A 176 AA2 3 4 N LEU A 181 ? N LEU A 181 O LEU A 223 ? O LEU A 223 AA2 4 5 O CYS A 224 ? O CYS A 224 N PHE A 217 ? N PHE A 217 AA3 1 2 N MET A 281 ? N MET A 281 O LYS A 289 ? O LYS A 289 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id G4Q _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 19 _struct_site.details 'binding site for residue G4Q A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 19 GLU A 17 ? GLU A 17 . ? 1_555 ? 2 AC1 19 TRP A 80 ? TRP A 80 . ? 1_555 ? 3 AC1 19 THR A 82 ? THR A 82 . ? 1_555 ? 4 AC1 19 ILE A 84 ? ILE A 84 . ? 1_555 ? 5 AC1 19 GLU A 85 ? GLU A 85 . ? 1_555 ? 6 AC1 19 SER A 205 ? SER A 205 . ? 1_555 ? 7 AC1 19 LEU A 210 ? LEU A 210 . ? 1_555 ? 8 AC1 19 THR A 211 ? THR A 211 . ? 1_555 ? 9 AC1 19 LYS A 268 ? LYS A 268 . ? 1_555 ? 10 AC1 19 TYR A 272 ? TYR A 272 . ? 1_555 ? 11 AC1 19 ASP A 274 ? ASP A 274 . ? 1_555 ? 12 AC1 19 ILE A 290 ? ILE A 290 . ? 1_555 ? 13 AC1 19 THR A 291 ? THR A 291 . ? 1_555 ? 14 AC1 19 ASP A 292 ? ASP A 292 . ? 1_555 ? 15 AC1 19 CYS A 296 ? CYS A 296 . ? 1_555 ? 16 AC1 19 LYS A 297 ? LYS A 297 . ? 1_555 ? 17 AC1 19 GLU A 298 ? GLU A 298 . ? 1_555 ? 18 AC1 19 HOH C . ? HOH A 601 . ? 1_555 ? 19 AC1 19 HOH C . ? HOH A 605 . ? 1_555 ? # _atom_sites.entry_id 6HHH _atom_sites.fract_transf_matrix[1][1] 0.014221 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014106 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010979 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ASP 46 46 ? ? ? A . n A 1 47 GLN 47 47 ? ? ? A . n A 1 48 ARG 48 48 ? ? ? A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 TRP 99 99 99 TRP TRP A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 GLN 113 113 ? ? ? A . n A 1 114 ALA 114 114 ? ? ? A . n A 1 115 ALA 115 115 ? ? ? A . n A 1 116 ALA 116 116 ? ? ? A . n A 1 117 GLU 117 117 ? ? ? A . n A 1 118 MET 118 118 ? ? ? A . n A 1 119 ASP 119 119 ? ? ? A . n A 1 120 PHE 120 120 ? ? ? A . n A 1 121 ARG 121 121 ? ? ? A . n A 1 122 SER 122 122 ? ? ? A . n A 1 123 GLY 123 123 ? ? ? A . n A 1 124 SER 124 124 ? ? ? A . n A 1 125 PRO 125 125 ? ? ? A . n A 1 126 SER 126 126 ? ? ? A . n A 1 127 ASP 127 127 ? ? ? A . n A 1 128 ASN 128 128 ? ? ? A . n A 1 129 SER 129 129 ? ? ? A . n A 1 130 GLY 130 130 ? ? ? A . n A 1 131 ALA 131 131 ? ? ? A . n A 1 132 GLU 132 132 ? ? ? A . n A 1 133 GLU 133 133 ? ? ? A . n A 1 134 MET 134 134 ? ? ? A . n A 1 135 GLU 135 135 ? ? ? A . n A 1 136 VAL 136 136 ? ? ? A . n A 1 137 SER 137 137 ? ? ? A . n A 1 138 LEU 138 138 ? ? ? A . n A 1 139 ALA 139 139 ? ? ? A . n A 1 140 LYS 140 140 ? ? ? A . n A 1 141 PRO 141 141 ? ? ? A . n A 1 142 LYS 142 142 ? ? ? A . n A 1 143 HIS 143 143 ? ? ? A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 MET 147 147 147 MET MET A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 ILE 165 165 165 ILE ILE A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 THR 172 172 172 THR THR A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 ARG 174 174 174 ARG ARG A . n A 1 175 TYR 175 175 175 TYR TYR A . n A 1 176 TYR 176 176 176 TYR TYR A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 MET 178 178 178 MET MET A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 ILE 186 186 ? ? ? A . n A 1 187 VAL 187 187 ? ? ? A . n A 1 188 ALA 188 188 ? ? ? A . n A 1 189 LYS 189 189 ? ? ? A . n A 1 190 ASP 190 190 ? ? ? A . n A 1 191 GLU 191 191 ? ? ? A . n A 1 192 VAL 192 192 ? ? ? A . n A 1 193 ALA 193 193 ? ? ? A . n A 1 194 HIS 194 194 ? ? ? A . n A 1 195 THR 195 195 ? ? ? A . n A 1 196 LEU 196 196 ? ? ? A . n A 1 197 THR 197 197 ? ? ? A . n A 1 198 GLU 198 198 ? ? ? A . n A 1 199 ASN 199 199 ? ? ? A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 GLN 203 203 203 GLN GLN A . n A 1 204 ASN 204 204 204 ASN ASN A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 ARG 206 206 206 ARG ARG A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 PHE 209 209 209 PHE PHE A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 THR 211 211 211 THR THR A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 LYS 214 214 214 LYS LYS A . n A 1 215 TYR 215 215 215 TYR TYR A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 PHE 217 217 217 PHE PHE A . n A 1 218 GLN 218 218 218 GLN GLN A . n A 1 219 THR 219 219 219 THR THR A . n A 1 220 HIS 220 220 220 HIS HIS A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 ARG 222 222 222 ARG ARG A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 CYS 224 224 224 CYS CYS A . n A 1 225 PHE 225 225 225 PHE PHE A . n A 1 226 VAL 226 226 226 VAL VAL A . n A 1 227 MET 227 227 227 MET MET A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 TYR 229 229 229 TYR TYR A . n A 1 230 ALA 230 230 230 ALA ALA A . n A 1 231 ASN 231 231 231 ASN ASN A . n A 1 232 GLY 232 232 232 GLY GLY A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 GLU 234 234 234 GLU GLU A . n A 1 235 LEU 235 235 235 LEU LEU A . n A 1 236 PHE 236 236 236 PHE PHE A . n A 1 237 PHE 237 237 237 PHE PHE A . n A 1 238 HIS 238 238 238 HIS HIS A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 SER 240 240 240 SER SER A . n A 1 241 ARG 241 241 241 ARG ARG A . n A 1 242 GLU 242 242 242 GLU GLU A . n A 1 243 ARG 243 243 243 ARG ARG A . n A 1 244 VAL 244 244 244 VAL VAL A . n A 1 245 PHE 245 245 245 PHE PHE A . n A 1 246 SER 246 246 246 SER SER A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 ASP 248 248 248 ASP ASP A . n A 1 249 ARG 249 249 249 ARG ARG A . n A 1 250 ALA 250 250 250 ALA ALA A . n A 1 251 ARG 251 251 251 ARG ARG A . n A 1 252 PHE 252 252 252 PHE PHE A . n A 1 253 TYR 253 253 253 TYR TYR A . n A 1 254 GLY 254 254 254 GLY GLY A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 GLU 256 256 256 GLU GLU A . n A 1 257 ILE 257 257 257 ILE ILE A . n A 1 258 VAL 258 258 258 VAL VAL A . n A 1 259 SER 259 259 259 SER SER A . n A 1 260 ALA 260 260 260 ALA ALA A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 ASP 262 262 262 ASP ASP A . n A 1 263 TYR 263 263 263 TYR TYR A . n A 1 264 LEU 264 264 264 LEU LEU A . n A 1 265 HIS 265 265 265 HIS HIS A . n A 1 266 SER 266 266 266 SER SER A . n A 1 267 GLU 267 267 267 GLU GLU A . n A 1 268 LYS 268 268 268 LYS LYS A . n A 1 269 ASN 269 269 269 ASN ASN A . n A 1 270 VAL 270 270 270 VAL VAL A . n A 1 271 VAL 271 271 271 VAL VAL A . n A 1 272 TYR 272 272 272 TYR TYR A . n A 1 273 ARG 273 273 273 ARG ARG A . n A 1 274 ASP 274 274 274 ASP ASP A . n A 1 275 LEU 275 275 275 LEU LEU A . n A 1 276 LYS 276 276 276 LYS LYS A . n A 1 277 LEU 277 277 277 LEU LEU A . n A 1 278 GLU 278 278 278 GLU GLU A . n A 1 279 ASN 279 279 279 ASN ASN A . n A 1 280 LEU 280 280 280 LEU LEU A . n A 1 281 MET 281 281 281 MET MET A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 LYS 284 284 284 LYS LYS A . n A 1 285 ASP 285 285 285 ASP ASP A . n A 1 286 GLY 286 286 286 GLY GLY A . n A 1 287 HIS 287 287 287 HIS HIS A . n A 1 288 ILE 288 288 288 ILE ILE A . n A 1 289 LYS 289 289 289 LYS LYS A . n A 1 290 ILE 290 290 290 ILE ILE A . n A 1 291 THR 291 291 291 THR THR A . n A 1 292 ASP 292 292 292 ASP ASP A . n A 1 293 PHE 293 293 293 PHE PHE A . n A 1 294 GLY 294 294 294 GLY GLY A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 CYS 296 296 296 CYS CYS A . n A 1 297 LYS 297 297 297 LYS LYS A . n A 1 298 GLU 298 298 298 GLU GLU A . n A 1 299 GLY 299 299 299 GLY GLY A . n A 1 300 ILE 300 300 ? ? ? A . n A 1 301 LYS 301 301 ? ? ? A . n A 1 302 ASP 302 302 ? ? ? A . n A 1 303 GLY 303 303 ? ? ? A . n A 1 304 ALA 304 304 ? ? ? A . n A 1 305 THR 305 305 ? ? ? A . n A 1 306 MET 306 306 ? ? ? A . n A 1 307 LYS 307 307 ? ? ? A . n A 1 308 THR 308 308 ? ? ? A . n A 1 309 PHE 309 309 ? ? ? A . n A 1 310 CYS 310 310 ? ? ? A . n A 1 311 GLY 311 311 311 GLY GLY A . n A 1 312 THR 312 312 312 THR THR A . n A 1 313 PRO 313 313 313 PRO PRO A . n A 1 314 GLU 314 314 314 GLU GLU A . n A 1 315 TYR 315 315 315 TYR TYR A . n A 1 316 LEU 316 316 316 LEU LEU A . n A 1 317 ALA 317 317 317 ALA ALA A . n A 1 318 PRO 318 318 318 PRO PRO A . n A 1 319 GLU 319 319 319 GLU GLU A . n A 1 320 VAL 320 320 320 VAL VAL A . n A 1 321 LEU 321 321 321 LEU LEU A . n A 1 322 GLU 322 322 322 GLU GLU A . n A 1 323 ASP 323 323 323 ASP ASP A . n A 1 324 ASN 324 324 324 ASN ASN A . n A 1 325 ASP 325 325 325 ASP ASP A . n A 1 326 TYR 326 326 326 TYR TYR A . n A 1 327 GLY 327 327 327 GLY GLY A . n A 1 328 ARG 328 328 328 ARG ARG A . n A 1 329 ALA 329 329 329 ALA ALA A . n A 1 330 VAL 330 330 330 VAL VAL A . n A 1 331 ASP 331 331 331 ASP ASP A . n A 1 332 TRP 332 332 332 TRP TRP A . n A 1 333 TRP 333 333 333 TRP TRP A . n A 1 334 GLY 334 334 334 GLY GLY A . n A 1 335 LEU 335 335 335 LEU LEU A . n A 1 336 GLY 336 336 336 GLY GLY A . n A 1 337 VAL 337 337 337 VAL VAL A . n A 1 338 VAL 338 338 338 VAL VAL A . n A 1 339 MET 339 339 339 MET MET A . n A 1 340 TYR 340 340 340 TYR TYR A . n A 1 341 GLU 341 341 341 GLU GLU A . n A 1 342 MET 342 342 342 MET MET A . n A 1 343 MET 343 343 343 MET MET A . n A 1 344 CYS 344 344 344 CYS CYS A . n A 1 345 GLY 345 345 345 GLY GLY A . n A 1 346 ARG 346 346 346 ARG ARG A . n A 1 347 LEU 347 347 347 LEU LEU A . n A 1 348 PRO 348 348 348 PRO PRO A . n A 1 349 PHE 349 349 349 PHE PHE A . n A 1 350 TYR 350 350 350 TYR TYR A . n A 1 351 ASN 351 351 351 ASN ASN A . n A 1 352 GLN 352 352 352 GLN GLN A . n A 1 353 ASP 353 353 353 ASP ASP A . n A 1 354 HIS 354 354 354 HIS HIS A . n A 1 355 GLU 355 355 355 GLU GLU A . n A 1 356 LYS 356 356 356 LYS LYS A . n A 1 357 LEU 357 357 357 LEU LEU A . n A 1 358 PHE 358 358 358 PHE PHE A . n A 1 359 GLU 359 359 359 GLU GLU A . n A 1 360 LEU 360 360 360 LEU LEU A . n A 1 361 ILE 361 361 361 ILE ILE A . n A 1 362 LEU 362 362 362 LEU LEU A . n A 1 363 MET 363 363 363 MET MET A . n A 1 364 GLU 364 364 364 GLU GLU A . n A 1 365 GLU 365 365 365 GLU GLU A . n A 1 366 ILE 366 366 366 ILE ILE A . n A 1 367 ARG 367 367 367 ARG ARG A . n A 1 368 PHE 368 368 368 PHE PHE A . n A 1 369 PRO 369 369 369 PRO PRO A . n A 1 370 ARG 370 370 370 ARG ARG A . n A 1 371 THR 371 371 371 THR THR A . n A 1 372 LEU 372 372 372 LEU LEU A . n A 1 373 GLY 373 373 373 GLY GLY A . n A 1 374 PRO 374 374 374 PRO PRO A . n A 1 375 GLU 375 375 375 GLU GLU A . n A 1 376 ALA 376 376 376 ALA ALA A . n A 1 377 LYS 377 377 377 LYS LYS A . n A 1 378 SER 378 378 378 SER SER A . n A 1 379 LEU 379 379 379 LEU LEU A . n A 1 380 LEU 380 380 380 LEU LEU A . n A 1 381 SER 381 381 381 SER SER A . n A 1 382 GLY 382 382 382 GLY GLY A . n A 1 383 LEU 383 383 383 LEU LEU A . n A 1 384 LEU 384 384 384 LEU LEU A . n A 1 385 LYS 385 385 385 LYS LYS A . n A 1 386 LYS 386 386 386 LYS LYS A . n A 1 387 ASP 387 387 387 ASP ASP A . n A 1 388 PRO 388 388 388 PRO PRO A . n A 1 389 LYS 389 389 389 LYS LYS A . n A 1 390 GLN 390 390 390 GLN GLN A . n A 1 391 ARG 391 391 391 ARG ARG A . n A 1 392 LEU 392 392 392 LEU LEU A . n A 1 393 GLY 393 393 393 GLY GLY A . n A 1 394 GLY 394 394 394 GLY GLY A . n A 1 395 GLY 395 395 395 GLY GLY A . n A 1 396 SER 396 396 396 SER SER A . n A 1 397 GLU 397 397 397 GLU GLU A . n A 1 398 ASP 398 398 398 ASP ASP A . n A 1 399 ALA 399 399 399 ALA ALA A . n A 1 400 LYS 400 400 400 LYS LYS A . n A 1 401 GLU 401 401 401 GLU GLU A . n A 1 402 ILE 402 402 402 ILE ILE A . n A 1 403 MET 403 403 403 MET MET A . n A 1 404 GLN 404 404 404 GLN GLN A . n A 1 405 HIS 405 405 405 HIS HIS A . n A 1 406 ARG 406 406 406 ARG ARG A . n A 1 407 PHE 407 407 407 PHE PHE A . n A 1 408 PHE 408 408 408 PHE PHE A . n A 1 409 ALA 409 409 409 ALA ALA A . n A 1 410 GLY 410 410 410 GLY GLY A . n A 1 411 ILE 411 411 411 ILE ILE A . n A 1 412 VAL 412 412 412 VAL VAL A . n A 1 413 TRP 413 413 413 TRP TRP A . n A 1 414 GLN 414 414 414 GLN GLN A . n A 1 415 HIS 415 415 415 HIS HIS A . n A 1 416 VAL 416 416 416 VAL VAL A . n A 1 417 TYR 417 417 417 TYR TYR A . n A 1 418 GLU 418 418 418 GLU GLU A . n A 1 419 LYS 419 419 419 LYS LYS A . n A 1 420 LYS 420 420 420 LYS LYS A . n A 1 421 LEU 421 421 421 LEU LEU A . n A 1 422 SER 422 422 422 SER SER A . n A 1 423 PRO 423 423 423 PRO PRO A . n A 1 424 PRO 424 424 424 PRO PRO A . n A 1 425 PHE 425 425 425 PHE PHE A . n A 1 426 LYS 426 426 426 LYS LYS A . n A 1 427 PRO 427 427 427 PRO PRO A . n A 1 428 GLN 428 428 428 GLN GLN A . n A 1 429 VAL 429 429 429 VAL VAL A . n A 1 430 THR 430 430 430 THR THR A . n A 1 431 SER 431 431 431 SER SER A . n A 1 432 GLU 432 432 432 GLU GLU A . n A 1 433 THR 433 433 433 THR THR A . n A 1 434 ASP 434 434 434 ASP ASP A . n A 1 435 THR 435 435 435 THR THR A . n A 1 436 ARG 436 436 436 ARG ARG A . n A 1 437 TYR 437 437 437 TYR TYR A . n A 1 438 PHE 438 438 438 PHE PHE A . n A 1 439 ASP 439 439 439 ASP ASP A . n A 1 440 GLU 440 440 ? ? ? A . n A 1 441 GLU 441 441 ? ? ? A . n A 1 442 PHE 442 442 ? ? ? A . n A 1 443 THR 443 443 ? ? ? A . n A 1 444 ALA 444 444 ? ? ? A . n A 1 445 GLN 445 445 ? ? ? A . n A 1 446 MET 446 446 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 G4Q 1 501 1 G4Q DRG A . C 3 HOH 1 601 62 HOH HOH A . C 3 HOH 2 602 33 HOH HOH A . C 3 HOH 3 603 30 HOH HOH A . C 3 HOH 4 604 7 HOH HOH A . C 3 HOH 5 605 61 HOH HOH A . C 3 HOH 6 606 29 HOH HOH A . C 3 HOH 7 607 35 HOH HOH A . C 3 HOH 8 608 4 HOH HOH A . C 3 HOH 9 609 58 HOH HOH A . C 3 HOH 10 610 57 HOH HOH A . C 3 HOH 11 611 18 HOH HOH A . C 3 HOH 12 612 54 HOH HOH A . C 3 HOH 13 613 27 HOH HOH A . C 3 HOH 14 614 48 HOH HOH A . C 3 HOH 15 615 13 HOH HOH A . C 3 HOH 16 616 66 HOH HOH A . C 3 HOH 17 617 59 HOH HOH A . C 3 HOH 18 618 45 HOH HOH A . C 3 HOH 19 619 47 HOH HOH A . C 3 HOH 20 620 36 HOH HOH A . C 3 HOH 21 621 10 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 19240 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-02-20 2 'Structure model' 1 1 2019-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_database_proc 4 2 'Structure model' pdbx_struct_ref_seq_depositor_info # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_ISSN' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_pdbx_struct_ref_seq_depositor_info.db_seq_one_letter_code' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -5.7983 _pdbx_refine_tls.origin_y 3.3897 _pdbx_refine_tls.origin_z -7.4617 _pdbx_refine_tls.T[1][1] 0.4710 _pdbx_refine_tls.T[2][2] 0.3721 _pdbx_refine_tls.T[3][3] 0.3997 _pdbx_refine_tls.T[1][2] -0.0638 _pdbx_refine_tls.T[1][3] 0.0795 _pdbx_refine_tls.T[2][3] -0.0622 _pdbx_refine_tls.L[1][1] 3.2472 _pdbx_refine_tls.L[2][2] 4.9324 _pdbx_refine_tls.L[3][3] 3.3412 _pdbx_refine_tls.L[1][2] 1.3407 _pdbx_refine_tls.L[1][3] 0.1913 _pdbx_refine_tls.L[2][3] 0.6357 _pdbx_refine_tls.S[1][1] -0.1801 _pdbx_refine_tls.S[1][2] 0.0041 _pdbx_refine_tls.S[1][3] -0.1641 _pdbx_refine_tls.S[2][1] 0.1355 _pdbx_refine_tls.S[2][2] 0.0384 _pdbx_refine_tls.S[2][3] 0.0052 _pdbx_refine_tls.S[3][1] 0.3950 _pdbx_refine_tls.S[3][2] -0.1546 _pdbx_refine_tls.S[3][3] 0.1049 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '(chain A)' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 205 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 601 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.01 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 80 ? ? 54.94 -102.68 2 1 LEU A 202 ? ? -97.84 34.20 3 1 ARG A 243 ? ? 61.70 -60.77 4 1 ARG A 273 ? ? 71.01 -6.93 5 1 TYR A 350 ? ? -134.23 -35.23 6 1 ASP A 398 ? ? 54.55 -127.20 7 1 THR A 435 ? ? -95.31 38.33 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A ASP 46 ? A ASP 46 3 1 Y 1 A GLN 47 ? A GLN 47 4 1 Y 1 A ARG 48 ? A ARG 48 5 1 Y 1 A GLN 113 ? A GLN 113 6 1 Y 1 A ALA 114 ? A ALA 114 7 1 Y 1 A ALA 115 ? A ALA 115 8 1 Y 1 A ALA 116 ? A ALA 116 9 1 Y 1 A GLU 117 ? A GLU 117 10 1 Y 1 A MET 118 ? A MET 118 11 1 Y 1 A ASP 119 ? A ASP 119 12 1 Y 1 A PHE 120 ? A PHE 120 13 1 Y 1 A ARG 121 ? A ARG 121 14 1 Y 1 A SER 122 ? A SER 122 15 1 Y 1 A GLY 123 ? A GLY 123 16 1 Y 1 A SER 124 ? A SER 124 17 1 Y 1 A PRO 125 ? A PRO 125 18 1 Y 1 A SER 126 ? A SER 126 19 1 Y 1 A ASP 127 ? A ASP 127 20 1 Y 1 A ASN 128 ? A ASN 128 21 1 Y 1 A SER 129 ? A SER 129 22 1 Y 1 A GLY 130 ? A GLY 130 23 1 Y 1 A ALA 131 ? A ALA 131 24 1 Y 1 A GLU 132 ? A GLU 132 25 1 Y 1 A GLU 133 ? A GLU 133 26 1 Y 1 A MET 134 ? A MET 134 27 1 Y 1 A GLU 135 ? A GLU 135 28 1 Y 1 A VAL 136 ? A VAL 136 29 1 Y 1 A SER 137 ? A SER 137 30 1 Y 1 A LEU 138 ? A LEU 138 31 1 Y 1 A ALA 139 ? A ALA 139 32 1 Y 1 A LYS 140 ? A LYS 140 33 1 Y 1 A PRO 141 ? A PRO 141 34 1 Y 1 A LYS 142 ? A LYS 142 35 1 Y 1 A HIS 143 ? A HIS 143 36 1 Y 1 A ILE 186 ? A ILE 186 37 1 Y 1 A VAL 187 ? A VAL 187 38 1 Y 1 A ALA 188 ? A ALA 188 39 1 Y 1 A LYS 189 ? A LYS 189 40 1 Y 1 A ASP 190 ? A ASP 190 41 1 Y 1 A GLU 191 ? A GLU 191 42 1 Y 1 A VAL 192 ? A VAL 192 43 1 Y 1 A ALA 193 ? A ALA 193 44 1 Y 1 A HIS 194 ? A HIS 194 45 1 Y 1 A THR 195 ? A THR 195 46 1 Y 1 A LEU 196 ? A LEU 196 47 1 Y 1 A THR 197 ? A THR 197 48 1 Y 1 A GLU 198 ? A GLU 198 49 1 Y 1 A ASN 199 ? A ASN 199 50 1 Y 1 A ILE 300 ? A ILE 300 51 1 Y 1 A LYS 301 ? A LYS 301 52 1 Y 1 A ASP 302 ? A ASP 302 53 1 Y 1 A GLY 303 ? A GLY 303 54 1 Y 1 A ALA 304 ? A ALA 304 55 1 Y 1 A THR 305 ? A THR 305 56 1 Y 1 A MET 306 ? A MET 306 57 1 Y 1 A LYS 307 ? A LYS 307 58 1 Y 1 A THR 308 ? A THR 308 59 1 Y 1 A PHE 309 ? A PHE 309 60 1 Y 1 A CYS 310 ? A CYS 310 61 1 Y 1 A GLU 440 ? A GLU 440 62 1 Y 1 A GLU 441 ? A GLU 441 63 1 Y 1 A PHE 442 ? A PHE 442 64 1 Y 1 A THR 443 ? A THR 443 65 1 Y 1 A ALA 444 ? A ALA 444 66 1 Y 1 A GLN 445 ? A GLN 445 67 1 Y 1 A MET 446 ? A MET 446 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'German Federal Ministry for Education and Research' Germany 'BMBF 01GS08104' 1 'German Federal Ministry for Education and Research' Germany 01ZX1303C 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '~{N}-[4-[4-[[4-(5-oxidanylidene-3-phenyl-6~{H}-1,6-naphthyridin-2-yl)phenyl]methyl]piperazin-1-yl]phenyl]propanamide' G4Q 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #