data_6HJK # _entry.id 6HJK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.299 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6HJK WWPDB D_1200011773 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6HJK _pdbx_database_status.recvd_initial_deposition_date 2018-09-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bayliss, R.' 1 0000-0003-0604-2773 'McIntyre, P.J.' 2 0000-0002-9442-3367 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'ACS Chem. Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1554-8937 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 2956 _citation.page_last 2965 _citation.title 'Type II Kinase Inhibitors Targeting Cys-Gatekeeper Kinases Display Orthogonality with Wild Type and Ala/Gly-Gatekeeper Kinases.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acschembio.8b00592 _citation.pdbx_database_id_PubMed 30239186 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ocasio, C.A.' 1 0000-0002-4957-4131 primary 'Warkentin, A.A.' 2 ? primary 'McIntyre, P.J.' 3 ? primary 'Barkovich, K.J.' 4 ? primary 'Vesely, C.' 5 ? primary 'Spencer, J.' 6 0000-0001-5231-8836 primary 'Shokat, K.M.' 7 0000-0002-6900-8380 primary 'Bayliss, R.' 8 0000-0003-0604-2773 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6HJK _cell.details ? _cell.formula_units_Z ? _cell.length_a 88.769 _cell.length_a_esd ? _cell.length_b 88.769 _cell.length_b_esd ? _cell.length_c 77.280 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6HJK _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aurora kinase A' 32874.645 1 2.7.11.1 'L210C, C290A, C393A' ? ? 2 non-polymer syn ;(~{E})-~{N}-[4-(4-azanyl-1-propan-2-yl-pyrazolo[3,4-d]pyrimidin-3-yl)phenyl]-4-[4-fluoranyl-3-(trifluoromethyl)phenyl]-4-oxidanylidene-but-2-enamide ; 512.459 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 water nat water 18.015 18 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Aurora 2,Aurora/IPL1-related kinase 1,hARK1,Breast tumor-amplified kinase,Serine/threonine-protein kinase 15,Serine/threonine-protein kinase 6,Serine/threonine-protein kinase aurora-A ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYG YFHDATRVYLICEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWS VHAPSSRRTTLAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARD LISRLLKHNPSQRPMLREVLEHPWITANSSKPSNAQNKESASKQS ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYG YFHDATRVYLICEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWS VHAPSSRRTTLAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARD LISRLLKHNPSQRPMLREVLEHPWITANSSKPSNAQNKESASKQS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLU n 1 5 SER n 1 6 LYS n 1 7 LYS n 1 8 ARG n 1 9 GLN n 1 10 TRP n 1 11 ALA n 1 12 LEU n 1 13 GLU n 1 14 ASP n 1 15 PHE n 1 16 GLU n 1 17 ILE n 1 18 GLY n 1 19 ARG n 1 20 PRO n 1 21 LEU n 1 22 GLY n 1 23 LYS n 1 24 GLY n 1 25 LYS n 1 26 PHE n 1 27 GLY n 1 28 ASN n 1 29 VAL n 1 30 TYR n 1 31 LEU n 1 32 ALA n 1 33 ARG n 1 34 GLU n 1 35 LYS n 1 36 GLN n 1 37 SER n 1 38 LYS n 1 39 PHE n 1 40 ILE n 1 41 LEU n 1 42 ALA n 1 43 LEU n 1 44 LYS n 1 45 VAL n 1 46 LEU n 1 47 PHE n 1 48 LYS n 1 49 ALA n 1 50 GLN n 1 51 LEU n 1 52 GLU n 1 53 LYS n 1 54 ALA n 1 55 GLY n 1 56 VAL n 1 57 GLU n 1 58 HIS n 1 59 GLN n 1 60 LEU n 1 61 ARG n 1 62 ARG n 1 63 GLU n 1 64 VAL n 1 65 GLU n 1 66 ILE n 1 67 GLN n 1 68 SER n 1 69 HIS n 1 70 LEU n 1 71 ARG n 1 72 HIS n 1 73 PRO n 1 74 ASN n 1 75 ILE n 1 76 LEU n 1 77 ARG n 1 78 LEU n 1 79 TYR n 1 80 GLY n 1 81 TYR n 1 82 PHE n 1 83 HIS n 1 84 ASP n 1 85 ALA n 1 86 THR n 1 87 ARG n 1 88 VAL n 1 89 TYR n 1 90 LEU n 1 91 ILE n 1 92 CYS n 1 93 GLU n 1 94 TYR n 1 95 ALA n 1 96 PRO n 1 97 LEU n 1 98 GLY n 1 99 THR n 1 100 VAL n 1 101 TYR n 1 102 ARG n 1 103 GLU n 1 104 LEU n 1 105 GLN n 1 106 LYS n 1 107 LEU n 1 108 SER n 1 109 LYS n 1 110 PHE n 1 111 ASP n 1 112 GLU n 1 113 GLN n 1 114 ARG n 1 115 THR n 1 116 ALA n 1 117 THR n 1 118 TYR n 1 119 ILE n 1 120 THR n 1 121 GLU n 1 122 LEU n 1 123 ALA n 1 124 ASN n 1 125 ALA n 1 126 LEU n 1 127 SER n 1 128 TYR n 1 129 CYS n 1 130 HIS n 1 131 SER n 1 132 LYS n 1 133 ARG n 1 134 VAL n 1 135 ILE n 1 136 HIS n 1 137 ARG n 1 138 ASP n 1 139 ILE n 1 140 LYS n 1 141 PRO n 1 142 GLU n 1 143 ASN n 1 144 LEU n 1 145 LEU n 1 146 LEU n 1 147 GLY n 1 148 SER n 1 149 ALA n 1 150 GLY n 1 151 GLU n 1 152 LEU n 1 153 LYS n 1 154 ILE n 1 155 ALA n 1 156 ASP n 1 157 PHE n 1 158 GLY n 1 159 TRP n 1 160 SER n 1 161 VAL n 1 162 HIS n 1 163 ALA n 1 164 PRO n 1 165 SER n 1 166 SER n 1 167 ARG n 1 168 ARG n 1 169 THR n 1 170 THR n 1 171 LEU n 1 172 ALA n 1 173 GLY n 1 174 THR n 1 175 LEU n 1 176 ASP n 1 177 TYR n 1 178 LEU n 1 179 PRO n 1 180 PRO n 1 181 GLU n 1 182 MET n 1 183 ILE n 1 184 GLU n 1 185 GLY n 1 186 ARG n 1 187 MET n 1 188 HIS n 1 189 ASP n 1 190 GLU n 1 191 LYS n 1 192 VAL n 1 193 ASP n 1 194 LEU n 1 195 TRP n 1 196 SER n 1 197 LEU n 1 198 GLY n 1 199 VAL n 1 200 LEU n 1 201 CYS n 1 202 TYR n 1 203 GLU n 1 204 PHE n 1 205 LEU n 1 206 VAL n 1 207 GLY n 1 208 LYS n 1 209 PRO n 1 210 PRO n 1 211 PHE n 1 212 GLU n 1 213 ALA n 1 214 ASN n 1 215 THR n 1 216 TYR n 1 217 GLN n 1 218 GLU n 1 219 THR n 1 220 TYR n 1 221 LYS n 1 222 ARG n 1 223 ILE n 1 224 SER n 1 225 ARG n 1 226 VAL n 1 227 GLU n 1 228 PHE n 1 229 THR n 1 230 PHE n 1 231 PRO n 1 232 ASP n 1 233 PHE n 1 234 VAL n 1 235 THR n 1 236 GLU n 1 237 GLY n 1 238 ALA n 1 239 ARG n 1 240 ASP n 1 241 LEU n 1 242 ILE n 1 243 SER n 1 244 ARG n 1 245 LEU n 1 246 LEU n 1 247 LYS n 1 248 HIS n 1 249 ASN n 1 250 PRO n 1 251 SER n 1 252 GLN n 1 253 ARG n 1 254 PRO n 1 255 MET n 1 256 LEU n 1 257 ARG n 1 258 GLU n 1 259 VAL n 1 260 LEU n 1 261 GLU n 1 262 HIS n 1 263 PRO n 1 264 TRP n 1 265 ILE n 1 266 THR n 1 267 ALA n 1 268 ASN n 1 269 SER n 1 270 SER n 1 271 LYS n 1 272 PRO n 1 273 SER n 1 274 ASN n 1 275 ALA n 1 276 GLN n 1 277 ASN n 1 278 LYS n 1 279 GLU n 1 280 SER n 1 281 ALA n 1 282 SER n 1 283 LYS n 1 284 GLN n 1 285 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 285 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AURKA_HUMAN _struct_ref.pdbx_db_accession O14965 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFH DATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHA PSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLIS RLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS ; _struct_ref.pdbx_align_begin 122 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6HJK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 285 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14965 _struct_ref_seq.db_align_beg 122 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 403 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 122 _struct_ref_seq.pdbx_auth_seq_align_end 403 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6HJK GLY A 1 ? UNP O14965 ? ? 'expression tag' 119 1 1 6HJK ALA A 2 ? UNP O14965 ? ? 'expression tag' 120 2 1 6HJK MET A 3 ? UNP O14965 ? ? 'expression tag' 121 3 1 6HJK CYS A 92 ? UNP O14965 LEU 210 'engineered mutation' 210 4 1 6HJK ALA A 172 ? UNP O14965 CYS 290 'engineered mutation' 290 5 1 6HJK ALA A 275 ? UNP O14965 CYS 393 'engineered mutation' 393 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G7W non-polymer . ;(~{E})-~{N}-[4-(4-azanyl-1-propan-2-yl-pyrazolo[3,4-d]pyrimidin-3-yl)phenyl]-4-[4-fluoranyl-3-(trifluoromethyl)phenyl]-4-oxidanylidene-but-2-enamide ; ? 'C25 H20 F4 N6 O2' 512.459 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6HJK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.67 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M ammonium sulfate, 0.1 M tri-sodium citrate pH 5.6, 25 % w/v polyethylene glycol 4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92818 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.92818 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6HJK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 76.88 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14112 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.07 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.4 _reflns_shell.d_res_low 2.486 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.63 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1373 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.93 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6HJK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.400 _refine.ls_d_res_low 76.876 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14110 _refine.ls_number_reflns_R_free 732 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.98 _refine.ls_percent_reflns_R_free 5.19 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2189 _refine.ls_R_factor_R_free 0.2523 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2169 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.81 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.38 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1993 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 2054 _refine_hist.d_res_high 2.400 _refine_hist.d_res_low 76.876 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 2087 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.221 ? 2844 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.840 ? 752 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.051 ? 310 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 361 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4001 2.5854 . . 141 2618 100.00 . . . 0.3535 . 0.2818 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5854 2.8456 . . 142 2651 100.00 . . . 0.3071 . 0.2797 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8456 3.2574 . . 133 2659 100.00 . . . 0.2941 . 0.2702 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2574 4.1039 . . 148 2679 100.00 . . . 0.2778 . 0.2236 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.1039 76.9155 . . 168 2771 100.00 . . . 0.2113 . 0.1800 . . . . . . . . . . # _struct.entry_id 6HJK _struct.title 'Crystal Structure of Aurora-A L210C catalytic domain in complex with ASDO2' _struct.pdbx_descriptor 'Aurora kinase A (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6HJK _struct_keywords.text 'Protein kinase, mitosis, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 11 ? GLU A 13 ? ALA A 129 GLU A 131 5 ? 3 HELX_P HELX_P2 AA2 LYS A 48 ? ALA A 54 ? LYS A 166 ALA A 172 1 ? 7 HELX_P HELX_P3 AA3 VAL A 56 ? HIS A 69 ? VAL A 174 HIS A 187 1 ? 14 HELX_P HELX_P4 AA4 VAL A 100 ? SER A 108 ? VAL A 218 SER A 226 1 ? 9 HELX_P HELX_P5 AA5 ASP A 111 ? LYS A 132 ? ASP A 229 LYS A 250 1 ? 22 HELX_P HELX_P6 AA6 LYS A 140 ? GLU A 142 ? LYS A 258 GLU A 260 5 ? 3 HELX_P HELX_P7 AA7 THR A 174 ? LEU A 178 ? THR A 292 LEU A 296 5 ? 5 HELX_P HELX_P8 AA8 PRO A 179 ? GLU A 184 ? PRO A 297 GLU A 302 1 ? 6 HELX_P HELX_P9 AA9 LYS A 191 ? GLY A 207 ? LYS A 309 GLY A 325 1 ? 17 HELX_P HELX_P10 AB1 THR A 215 ? ARG A 225 ? THR A 333 ARG A 343 1 ? 11 HELX_P HELX_P11 AB2 THR A 235 ? LEU A 246 ? THR A 353 LEU A 364 1 ? 12 HELX_P HELX_P12 AB3 ASN A 249 ? ARG A 253 ? ASN A 367 ARG A 371 5 ? 5 HELX_P HELX_P13 AB4 MET A 255 ? GLU A 261 ? MET A 373 GLU A 379 1 ? 7 HELX_P HELX_P14 AB5 HIS A 262 ? SER A 269 ? HIS A 380 SER A 387 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ARG 137 A . ? ARG 255 A ASP 138 A ? ASP 256 A 1 -13.65 2 ALA 172 A . ? ALA 290 A GLY 173 A ? GLY 291 A 1 -8.47 3 GLY 173 A . ? GLY 291 A THR 174 A ? THR 292 A 1 25.11 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 15 ? LYS A 23 ? PHE A 133 LYS A 141 AA1 2 GLY A 27 ? GLU A 34 ? GLY A 145 GLU A 152 AA1 3 ILE A 40 ? PHE A 47 ? ILE A 158 PHE A 165 AA1 4 ARG A 87 ? CYS A 92 ? ARG A 205 CYS A 210 AA1 5 LEU A 78 ? HIS A 83 ? LEU A 196 HIS A 201 AA2 1 GLY A 98 ? THR A 99 ? GLY A 216 THR A 217 AA2 2 LEU A 144 ? LEU A 146 ? LEU A 262 LEU A 264 AA2 3 LEU A 152 ? ILE A 154 ? LEU A 270 ILE A 272 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 18 ? N GLY A 136 O LEU A 31 ? O LEU A 149 AA1 2 3 N ALA A 32 ? N ALA A 150 O LEU A 41 ? O LEU A 159 AA1 3 4 N LEU A 46 ? N LEU A 164 O VAL A 88 ? O VAL A 206 AA1 4 5 O ILE A 91 ? O ILE A 209 N TYR A 79 ? N TYR A 197 AA2 1 2 N GLY A 98 ? N GLY A 216 O LEU A 146 ? O LEU A 264 AA2 2 3 N LEU A 145 ? N LEU A 263 O LYS A 153 ? O LYS A 271 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A G7W 501 ? 14 'binding site for residue G7W A 501' AC2 Software A SO4 502 ? 3 'binding site for residue SO4 A 502' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 LEU A 21 ? LEU A 139 . ? 1_555 ? 2 AC1 14 PHE A 26 ? PHE A 144 . ? 1_555 ? 3 AC1 14 VAL A 29 ? VAL A 147 . ? 1_555 ? 4 AC1 14 LYS A 44 ? LYS A 162 . ? 1_555 ? 5 AC1 14 VAL A 56 ? VAL A 174 . ? 1_555 ? 6 AC1 14 LEU A 60 ? LEU A 178 . ? 1_555 ? 7 AC1 14 LEU A 76 ? LEU A 194 . ? 1_555 ? 8 AC1 14 GLU A 93 ? GLU A 211 . ? 1_555 ? 9 AC1 14 TYR A 94 ? TYR A 212 . ? 1_555 ? 10 AC1 14 ALA A 95 ? ALA A 213 . ? 1_555 ? 11 AC1 14 LEU A 145 ? LEU A 263 . ? 1_555 ? 12 AC1 14 GLY A 158 ? GLY A 276 . ? 1_555 ? 13 AC1 14 TRP A 159 ? TRP A 277 . ? 1_555 ? 14 AC1 14 VAL A 161 ? VAL A 279 . ? 1_555 ? 15 AC2 3 SER A 148 ? SER A 266 . ? 1_555 ? 16 AC2 3 LYS A 221 ? LYS A 339 . ? 6_454 ? 17 AC2 3 ARG A 225 ? ARG A 343 . ? 6_454 ? # _atom_sites.entry_id 6HJK _atom_sites.fract_transf_matrix[1][1] 0.011265 _atom_sites.fract_transf_matrix[1][2] 0.006504 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013008 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012940 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL F H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 119 ? ? ? A . n A 1 2 ALA 2 120 ? ? ? A . n A 1 3 MET 3 121 ? ? ? A . n A 1 4 GLU 4 122 ? ? ? A . n A 1 5 SER 5 123 ? ? ? A . n A 1 6 LYS 6 124 ? ? ? A . n A 1 7 LYS 7 125 ? ? ? A . n A 1 8 ARG 8 126 ? ? ? A . n A 1 9 GLN 9 127 127 GLN GLN A . n A 1 10 TRP 10 128 128 TRP TRP A . n A 1 11 ALA 11 129 129 ALA ALA A . n A 1 12 LEU 12 130 130 LEU LEU A . n A 1 13 GLU 13 131 131 GLU GLU A . n A 1 14 ASP 14 132 132 ASP ASP A . n A 1 15 PHE 15 133 133 PHE PHE A . n A 1 16 GLU 16 134 134 GLU GLU A . n A 1 17 ILE 17 135 135 ILE ILE A . n A 1 18 GLY 18 136 136 GLY GLY A . n A 1 19 ARG 19 137 137 ARG ARG A . n A 1 20 PRO 20 138 138 PRO PRO A . n A 1 21 LEU 21 139 139 LEU LEU A . n A 1 22 GLY 22 140 140 GLY GLY A . n A 1 23 LYS 23 141 141 LYS LYS A . n A 1 24 GLY 24 142 142 GLY GLY A . n A 1 25 LYS 25 143 143 LYS LYS A . n A 1 26 PHE 26 144 144 PHE PHE A . n A 1 27 GLY 27 145 145 GLY GLY A . n A 1 28 ASN 28 146 146 ASN ASN A . n A 1 29 VAL 29 147 147 VAL VAL A . n A 1 30 TYR 30 148 148 TYR TYR A . n A 1 31 LEU 31 149 149 LEU LEU A . n A 1 32 ALA 32 150 150 ALA ALA A . n A 1 33 ARG 33 151 151 ARG ARG A . n A 1 34 GLU 34 152 152 GLU GLU A . n A 1 35 LYS 35 153 153 LYS LYS A . n A 1 36 GLN 36 154 154 GLN GLN A . n A 1 37 SER 37 155 155 SER SER A . n A 1 38 LYS 38 156 156 LYS LYS A . n A 1 39 PHE 39 157 157 PHE PHE A . n A 1 40 ILE 40 158 158 ILE ILE A . n A 1 41 LEU 41 159 159 LEU LEU A . n A 1 42 ALA 42 160 160 ALA ALA A . n A 1 43 LEU 43 161 161 LEU LEU A . n A 1 44 LYS 44 162 162 LYS LYS A . n A 1 45 VAL 45 163 163 VAL VAL A . n A 1 46 LEU 46 164 164 LEU LEU A . n A 1 47 PHE 47 165 165 PHE PHE A . n A 1 48 LYS 48 166 166 LYS LYS A . n A 1 49 ALA 49 167 167 ALA ALA A . n A 1 50 GLN 50 168 168 GLN GLN A . n A 1 51 LEU 51 169 169 LEU LEU A . n A 1 52 GLU 52 170 170 GLU GLU A . n A 1 53 LYS 53 171 171 LYS LYS A . n A 1 54 ALA 54 172 172 ALA ALA A . n A 1 55 GLY 55 173 173 GLY GLY A . n A 1 56 VAL 56 174 174 VAL VAL A . n A 1 57 GLU 57 175 175 GLU GLU A . n A 1 58 HIS 58 176 176 HIS HIS A . n A 1 59 GLN 59 177 177 GLN GLN A . n A 1 60 LEU 60 178 178 LEU LEU A . n A 1 61 ARG 61 179 179 ARG ARG A . n A 1 62 ARG 62 180 180 ARG ARG A . n A 1 63 GLU 63 181 181 GLU GLU A . n A 1 64 VAL 64 182 182 VAL VAL A . n A 1 65 GLU 65 183 183 GLU GLU A . n A 1 66 ILE 66 184 184 ILE ILE A . n A 1 67 GLN 67 185 185 GLN GLN A . n A 1 68 SER 68 186 186 SER SER A . n A 1 69 HIS 69 187 187 HIS HIS A . n A 1 70 LEU 70 188 188 LEU LEU A . n A 1 71 ARG 71 189 189 ARG ARG A . n A 1 72 HIS 72 190 190 HIS HIS A . n A 1 73 PRO 73 191 191 PRO PRO A . n A 1 74 ASN 74 192 192 ASN ASN A . n A 1 75 ILE 75 193 193 ILE ILE A . n A 1 76 LEU 76 194 194 LEU LEU A . n A 1 77 ARG 77 195 195 ARG ARG A . n A 1 78 LEU 78 196 196 LEU LEU A . n A 1 79 TYR 79 197 197 TYR TYR A . n A 1 80 GLY 80 198 198 GLY GLY A . n A 1 81 TYR 81 199 199 TYR TYR A . n A 1 82 PHE 82 200 200 PHE PHE A . n A 1 83 HIS 83 201 201 HIS HIS A . n A 1 84 ASP 84 202 202 ASP ASP A . n A 1 85 ALA 85 203 203 ALA ALA A . n A 1 86 THR 86 204 204 THR THR A . n A 1 87 ARG 87 205 205 ARG ARG A . n A 1 88 VAL 88 206 206 VAL VAL A . n A 1 89 TYR 89 207 207 TYR TYR A . n A 1 90 LEU 90 208 208 LEU LEU A . n A 1 91 ILE 91 209 209 ILE ILE A . n A 1 92 CYS 92 210 210 CYS CYS A . n A 1 93 GLU 93 211 211 GLU GLU A . n A 1 94 TYR 94 212 212 TYR TYR A . n A 1 95 ALA 95 213 213 ALA ALA A . n A 1 96 PRO 96 214 214 PRO PRO A . n A 1 97 LEU 97 215 215 LEU LEU A . n A 1 98 GLY 98 216 216 GLY GLY A . n A 1 99 THR 99 217 217 THR THR A . n A 1 100 VAL 100 218 218 VAL VAL A . n A 1 101 TYR 101 219 219 TYR TYR A . n A 1 102 ARG 102 220 220 ARG ARG A . n A 1 103 GLU 103 221 221 GLU GLU A . n A 1 104 LEU 104 222 222 LEU LEU A . n A 1 105 GLN 105 223 223 GLN GLN A . n A 1 106 LYS 106 224 224 LYS LYS A . n A 1 107 LEU 107 225 225 LEU LEU A . n A 1 108 SER 108 226 226 SER SER A . n A 1 109 LYS 109 227 227 LYS LYS A . n A 1 110 PHE 110 228 228 PHE PHE A . n A 1 111 ASP 111 229 229 ASP ASP A . n A 1 112 GLU 112 230 230 GLU GLU A . n A 1 113 GLN 113 231 231 GLN GLN A . n A 1 114 ARG 114 232 232 ARG ARG A . n A 1 115 THR 115 233 233 THR THR A . n A 1 116 ALA 116 234 234 ALA ALA A . n A 1 117 THR 117 235 235 THR THR A . n A 1 118 TYR 118 236 236 TYR TYR A . n A 1 119 ILE 119 237 237 ILE ILE A . n A 1 120 THR 120 238 238 THR THR A . n A 1 121 GLU 121 239 239 GLU GLU A . n A 1 122 LEU 122 240 240 LEU LEU A . n A 1 123 ALA 123 241 241 ALA ALA A . n A 1 124 ASN 124 242 242 ASN ASN A . n A 1 125 ALA 125 243 243 ALA ALA A . n A 1 126 LEU 126 244 244 LEU LEU A . n A 1 127 SER 127 245 245 SER SER A . n A 1 128 TYR 128 246 246 TYR TYR A . n A 1 129 CYS 129 247 247 CYS CYS A . n A 1 130 HIS 130 248 248 HIS HIS A . n A 1 131 SER 131 249 249 SER SER A . n A 1 132 LYS 132 250 250 LYS LYS A . n A 1 133 ARG 133 251 251 ARG ARG A . n A 1 134 VAL 134 252 252 VAL VAL A . n A 1 135 ILE 135 253 253 ILE ILE A . n A 1 136 HIS 136 254 254 HIS HIS A . n A 1 137 ARG 137 255 255 ARG ARG A . n A 1 138 ASP 138 256 256 ASP ASP A . n A 1 139 ILE 139 257 257 ILE ILE A . n A 1 140 LYS 140 258 258 LYS LYS A . n A 1 141 PRO 141 259 259 PRO PRO A . n A 1 142 GLU 142 260 260 GLU GLU A . n A 1 143 ASN 143 261 261 ASN ASN A . n A 1 144 LEU 144 262 262 LEU LEU A . n A 1 145 LEU 145 263 263 LEU LEU A . n A 1 146 LEU 146 264 264 LEU LEU A . n A 1 147 GLY 147 265 265 GLY GLY A . n A 1 148 SER 148 266 266 SER SER A . n A 1 149 ALA 149 267 267 ALA ALA A . n A 1 150 GLY 150 268 268 GLY GLY A . n A 1 151 GLU 151 269 269 GLU GLU A . n A 1 152 LEU 152 270 270 LEU LEU A . n A 1 153 LYS 153 271 271 LYS LYS A . n A 1 154 ILE 154 272 272 ILE ILE A . n A 1 155 ALA 155 273 273 ALA ALA A . n A 1 156 ASP 156 274 274 ASP ASP A . n A 1 157 PHE 157 275 275 PHE PHE A . n A 1 158 GLY 158 276 276 GLY GLY A . n A 1 159 TRP 159 277 277 TRP TRP A . n A 1 160 SER 160 278 278 SER SER A . n A 1 161 VAL 161 279 279 VAL VAL A . n A 1 162 HIS 162 280 ? ? ? A . n A 1 163 ALA 163 281 ? ? ? A . n A 1 164 PRO 164 282 ? ? ? A . n A 1 165 SER 165 283 ? ? ? A . n A 1 166 SER 166 284 ? ? ? A . n A 1 167 ARG 167 285 ? ? ? A . n A 1 168 ARG 168 286 ? ? ? A . n A 1 169 THR 169 287 ? ? ? A . n A 1 170 THR 170 288 ? ? ? A . n A 1 171 LEU 171 289 ? ? ? A . n A 1 172 ALA 172 290 290 ALA ALA A . n A 1 173 GLY 173 291 291 GLY GLY A . n A 1 174 THR 174 292 292 THR THR A . n A 1 175 LEU 175 293 293 LEU LEU A . n A 1 176 ASP 176 294 294 ASP ASP A . n A 1 177 TYR 177 295 295 TYR TYR A . n A 1 178 LEU 178 296 296 LEU LEU A . n A 1 179 PRO 179 297 297 PRO PRO A . n A 1 180 PRO 180 298 298 PRO PRO A . n A 1 181 GLU 181 299 299 GLU GLU A . n A 1 182 MET 182 300 300 MET MET A . n A 1 183 ILE 183 301 301 ILE ILE A . n A 1 184 GLU 184 302 302 GLU GLU A . n A 1 185 GLY 185 303 303 GLY GLY A . n A 1 186 ARG 186 304 304 ARG ARG A . n A 1 187 MET 187 305 305 MET MET A . n A 1 188 HIS 188 306 306 HIS HIS A . n A 1 189 ASP 189 307 307 ASP ASP A . n A 1 190 GLU 190 308 308 GLU GLU A . n A 1 191 LYS 191 309 309 LYS LYS A . n A 1 192 VAL 192 310 310 VAL VAL A . n A 1 193 ASP 193 311 311 ASP ASP A . n A 1 194 LEU 194 312 312 LEU LEU A . n A 1 195 TRP 195 313 313 TRP TRP A . n A 1 196 SER 196 314 314 SER SER A . n A 1 197 LEU 197 315 315 LEU LEU A . n A 1 198 GLY 198 316 316 GLY GLY A . n A 1 199 VAL 199 317 317 VAL VAL A . n A 1 200 LEU 200 318 318 LEU LEU A . n A 1 201 CYS 201 319 319 CYS CYS A . n A 1 202 TYR 202 320 320 TYR TYR A . n A 1 203 GLU 203 321 321 GLU GLU A . n A 1 204 PHE 204 322 322 PHE PHE A . n A 1 205 LEU 205 323 323 LEU LEU A . n A 1 206 VAL 206 324 324 VAL VAL A . n A 1 207 GLY 207 325 325 GLY GLY A . n A 1 208 LYS 208 326 326 LYS LYS A . n A 1 209 PRO 209 327 327 PRO PRO A . n A 1 210 PRO 210 328 328 PRO PRO A . n A 1 211 PHE 211 329 329 PHE PHE A . n A 1 212 GLU 212 330 330 GLU GLU A . n A 1 213 ALA 213 331 331 ALA ALA A . n A 1 214 ASN 214 332 332 ASN ASN A . n A 1 215 THR 215 333 333 THR THR A . n A 1 216 TYR 216 334 334 TYR TYR A . n A 1 217 GLN 217 335 335 GLN GLN A . n A 1 218 GLU 218 336 336 GLU GLU A . n A 1 219 THR 219 337 337 THR THR A . n A 1 220 TYR 220 338 338 TYR TYR A . n A 1 221 LYS 221 339 339 LYS LYS A . n A 1 222 ARG 222 340 340 ARG ARG A . n A 1 223 ILE 223 341 341 ILE ILE A . n A 1 224 SER 224 342 342 SER SER A . n A 1 225 ARG 225 343 343 ARG ARG A . n A 1 226 VAL 226 344 344 VAL VAL A . n A 1 227 GLU 227 345 345 GLU GLU A . n A 1 228 PHE 228 346 346 PHE PHE A . n A 1 229 THR 229 347 347 THR THR A . n A 1 230 PHE 230 348 348 PHE PHE A . n A 1 231 PRO 231 349 349 PRO PRO A . n A 1 232 ASP 232 350 350 ASP ASP A . n A 1 233 PHE 233 351 351 PHE PHE A . n A 1 234 VAL 234 352 352 VAL VAL A . n A 1 235 THR 235 353 353 THR THR A . n A 1 236 GLU 236 354 354 GLU GLU A . n A 1 237 GLY 237 355 355 GLY GLY A . n A 1 238 ALA 238 356 356 ALA ALA A . n A 1 239 ARG 239 357 357 ARG ARG A . n A 1 240 ASP 240 358 358 ASP ASP A . n A 1 241 LEU 241 359 359 LEU LEU A . n A 1 242 ILE 242 360 360 ILE ILE A . n A 1 243 SER 243 361 361 SER SER A . n A 1 244 ARG 244 362 362 ARG ARG A . n A 1 245 LEU 245 363 363 LEU LEU A . n A 1 246 LEU 246 364 364 LEU LEU A . n A 1 247 LYS 247 365 365 LYS LYS A . n A 1 248 HIS 248 366 366 HIS HIS A . n A 1 249 ASN 249 367 367 ASN ASN A . n A 1 250 PRO 250 368 368 PRO PRO A . n A 1 251 SER 251 369 369 SER SER A . n A 1 252 GLN 252 370 370 GLN GLN A . n A 1 253 ARG 253 371 371 ARG ARG A . n A 1 254 PRO 254 372 372 PRO PRO A . n A 1 255 MET 255 373 373 MET MET A . n A 1 256 LEU 256 374 374 LEU LEU A . n A 1 257 ARG 257 375 375 ARG ARG A . n A 1 258 GLU 258 376 376 GLU GLU A . n A 1 259 VAL 259 377 377 VAL VAL A . n A 1 260 LEU 260 378 378 LEU LEU A . n A 1 261 GLU 261 379 379 GLU GLU A . n A 1 262 HIS 262 380 380 HIS HIS A . n A 1 263 PRO 263 381 381 PRO PRO A . n A 1 264 TRP 264 382 382 TRP TRP A . n A 1 265 ILE 265 383 383 ILE ILE A . n A 1 266 THR 266 384 384 THR THR A . n A 1 267 ALA 267 385 385 ALA ALA A . n A 1 268 ASN 268 386 386 ASN ASN A . n A 1 269 SER 269 387 387 SER SER A . n A 1 270 SER 270 388 388 SER SER A . n A 1 271 LYS 271 389 389 LYS LYS A . n A 1 272 PRO 272 390 390 PRO PRO A . n A 1 273 SER 273 391 391 SER SER A . n A 1 274 ASN 274 392 ? ? ? A . n A 1 275 ALA 275 393 ? ? ? A . n A 1 276 GLN 276 394 ? ? ? A . n A 1 277 ASN 277 395 ? ? ? A . n A 1 278 LYS 278 396 ? ? ? A . n A 1 279 GLU 279 397 ? ? ? A . n A 1 280 SER 280 398 ? ? ? A . n A 1 281 ALA 281 399 ? ? ? A . n A 1 282 SER 282 400 ? ? ? A . n A 1 283 LYS 283 401 ? ? ? A . n A 1 284 GLN 284 402 ? ? ? A . n A 1 285 SER 285 403 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 G7W 1 501 1 G7W LIG A . C 3 SO4 1 502 1 SO4 SO4 A . D 4 CL 1 503 1 CL CL A . E 5 HOH 1 601 4 HOH HOH A . E 5 HOH 2 602 1 HOH HOH A . E 5 HOH 3 603 27 HOH HOH A . E 5 HOH 4 604 5 HOH HOH A . E 5 HOH 5 605 24 HOH HOH A . E 5 HOH 6 606 3 HOH HOH A . E 5 HOH 7 607 9 HOH HOH A . E 5 HOH 8 608 14 HOH HOH A . E 5 HOH 9 609 21 HOH HOH A . E 5 HOH 10 610 28 HOH HOH A . E 5 HOH 11 611 2 HOH HOH A . E 5 HOH 12 612 6 HOH HOH A . E 5 HOH 13 613 20 HOH HOH A . E 5 HOH 14 614 25 HOH HOH A . E 5 HOH 15 615 29 HOH HOH A . E 5 HOH 16 616 26 HOH HOH A . E 5 HOH 17 617 15 HOH HOH A . E 5 HOH 18 618 30 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 190 ? 1 MORE -12 ? 1 'SSA (A^2)' 12590 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-10-03 2 'Structure model' 1 1 2018-10-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 302 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 601 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 203 ? ? 81.18 3.66 2 1 THR A 204 ? ? -141.74 -12.85 3 1 SER A 226 ? ? 73.99 -56.95 4 1 ARG A 251 ? ? 55.76 70.28 5 1 HIS A 254 ? ? -101.06 -164.07 6 1 ARG A 255 ? ? 153.73 -179.93 7 1 ILE A 257 ? ? 38.60 30.07 8 1 PHE A 275 ? ? -26.46 122.09 9 1 ASP A 307 ? ? -132.80 -149.51 10 1 PRO A 372 ? ? -57.50 177.18 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 141 ? CG ? A LYS 23 CG 2 1 Y 1 A LYS 141 ? CD ? A LYS 23 CD 3 1 Y 1 A LYS 141 ? CE ? A LYS 23 CE 4 1 Y 1 A LYS 141 ? NZ ? A LYS 23 NZ 5 1 Y 1 A LYS 143 ? CG ? A LYS 25 CG 6 1 Y 1 A LYS 143 ? CD ? A LYS 25 CD 7 1 Y 1 A LYS 143 ? CE ? A LYS 25 CE 8 1 Y 1 A LYS 143 ? NZ ? A LYS 25 NZ 9 1 Y 1 A GLN 154 ? CG ? A GLN 36 CG 10 1 Y 1 A GLN 154 ? CD ? A GLN 36 CD 11 1 Y 1 A GLN 154 ? OE1 ? A GLN 36 OE1 12 1 Y 1 A GLN 154 ? NE2 ? A GLN 36 NE2 13 1 Y 1 A LYS 156 ? CG ? A LYS 38 CG 14 1 Y 1 A LYS 156 ? CD ? A LYS 38 CD 15 1 Y 1 A LYS 156 ? CE ? A LYS 38 CE 16 1 Y 1 A LYS 156 ? NZ ? A LYS 38 NZ 17 1 Y 1 A LYS 162 ? CE ? A LYS 44 CE 18 1 Y 1 A LYS 162 ? NZ ? A LYS 44 NZ 19 1 Y 1 A LYS 166 ? CG ? A LYS 48 CG 20 1 Y 1 A LYS 166 ? CD ? A LYS 48 CD 21 1 Y 1 A LYS 166 ? CE ? A LYS 48 CE 22 1 Y 1 A LYS 166 ? NZ ? A LYS 48 NZ 23 1 Y 1 A GLU 170 ? CG ? A GLU 52 CG 24 1 Y 1 A GLU 170 ? CD ? A GLU 52 CD 25 1 Y 1 A GLU 170 ? OE1 ? A GLU 52 OE1 26 1 Y 1 A GLU 170 ? OE2 ? A GLU 52 OE2 27 1 Y 1 A LYS 171 ? CG ? A LYS 53 CG 28 1 Y 1 A LYS 171 ? CD ? A LYS 53 CD 29 1 Y 1 A LYS 171 ? CE ? A LYS 53 CE 30 1 Y 1 A LYS 171 ? NZ ? A LYS 53 NZ 31 1 Y 1 A GLU 175 ? CG ? A GLU 57 CG 32 1 Y 1 A GLU 175 ? CD ? A GLU 57 CD 33 1 Y 1 A GLU 175 ? OE1 ? A GLU 57 OE1 34 1 Y 1 A GLU 175 ? OE2 ? A GLU 57 OE2 35 1 Y 1 A HIS 176 ? CG ? A HIS 58 CG 36 1 Y 1 A HIS 176 ? ND1 ? A HIS 58 ND1 37 1 Y 1 A HIS 176 ? CD2 ? A HIS 58 CD2 38 1 Y 1 A HIS 176 ? CE1 ? A HIS 58 CE1 39 1 Y 1 A HIS 176 ? NE2 ? A HIS 58 NE2 40 1 Y 1 A GLN 177 ? CD ? A GLN 59 CD 41 1 Y 1 A GLN 177 ? OE1 ? A GLN 59 OE1 42 1 Y 1 A GLN 177 ? NE2 ? A GLN 59 NE2 43 1 Y 1 A ARG 179 ? CG ? A ARG 61 CG 44 1 Y 1 A ARG 179 ? CD ? A ARG 61 CD 45 1 Y 1 A ARG 179 ? NE ? A ARG 61 NE 46 1 Y 1 A ARG 179 ? CZ ? A ARG 61 CZ 47 1 Y 1 A ARG 179 ? NH1 ? A ARG 61 NH1 48 1 Y 1 A ARG 179 ? NH2 ? A ARG 61 NH2 49 1 Y 1 A ARG 180 ? CG ? A ARG 62 CG 50 1 Y 1 A ARG 180 ? CD ? A ARG 62 CD 51 1 Y 1 A ARG 180 ? NE ? A ARG 62 NE 52 1 Y 1 A ARG 180 ? CZ ? A ARG 62 CZ 53 1 Y 1 A ARG 180 ? NH1 ? A ARG 62 NH1 54 1 Y 1 A ARG 180 ? NH2 ? A ARG 62 NH2 55 1 Y 1 A GLU 181 ? CG ? A GLU 63 CG 56 1 Y 1 A GLU 181 ? CD ? A GLU 63 CD 57 1 Y 1 A GLU 181 ? OE1 ? A GLU 63 OE1 58 1 Y 1 A GLU 181 ? OE2 ? A GLU 63 OE2 59 1 Y 1 A GLU 183 ? CG ? A GLU 65 CG 60 1 Y 1 A GLU 183 ? CD ? A GLU 65 CD 61 1 Y 1 A GLU 183 ? OE1 ? A GLU 65 OE1 62 1 Y 1 A GLU 183 ? OE2 ? A GLU 65 OE2 63 1 Y 1 A HIS 187 ? CG ? A HIS 69 CG 64 1 Y 1 A HIS 187 ? ND1 ? A HIS 69 ND1 65 1 Y 1 A HIS 187 ? CD2 ? A HIS 69 CD2 66 1 Y 1 A HIS 187 ? CE1 ? A HIS 69 CE1 67 1 Y 1 A HIS 187 ? NE2 ? A HIS 69 NE2 68 1 Y 1 A ARG 189 ? CG ? A ARG 71 CG 69 1 Y 1 A ARG 189 ? CD ? A ARG 71 CD 70 1 Y 1 A ARG 189 ? NE ? A ARG 71 NE 71 1 Y 1 A ARG 189 ? CZ ? A ARG 71 CZ 72 1 Y 1 A ARG 189 ? NH1 ? A ARG 71 NH1 73 1 Y 1 A ARG 189 ? NH2 ? A ARG 71 NH2 74 1 Y 1 A LYS 250 ? CG ? A LYS 132 CG 75 1 Y 1 A LYS 250 ? CD ? A LYS 132 CD 76 1 Y 1 A LYS 250 ? CE ? A LYS 132 CE 77 1 Y 1 A LYS 250 ? NZ ? A LYS 132 NZ 78 1 Y 1 A ARG 251 ? CG ? A ARG 133 CG 79 1 Y 1 A ARG 251 ? CD ? A ARG 133 CD 80 1 Y 1 A ARG 251 ? NE ? A ARG 133 NE 81 1 Y 1 A ARG 251 ? CZ ? A ARG 133 CZ 82 1 Y 1 A ARG 251 ? NH1 ? A ARG 133 NH1 83 1 Y 1 A ARG 251 ? NH2 ? A ARG 133 NH2 84 1 Y 1 A ARG 255 ? CG ? A ARG 137 CG 85 1 Y 1 A ARG 255 ? CD ? A ARG 137 CD 86 1 Y 1 A ARG 255 ? NE ? A ARG 137 NE 87 1 Y 1 A ARG 255 ? CZ ? A ARG 137 CZ 88 1 Y 1 A ARG 255 ? NH1 ? A ARG 137 NH1 89 1 Y 1 A ARG 255 ? NH2 ? A ARG 137 NH2 90 1 Y 1 A GLU 354 ? CG ? A GLU 236 CG 91 1 Y 1 A GLU 354 ? CD ? A GLU 236 CD 92 1 Y 1 A GLU 354 ? OE1 ? A GLU 236 OE1 93 1 Y 1 A GLU 354 ? OE2 ? A GLU 236 OE2 94 1 Y 1 A LYS 389 ? CD ? A LYS 271 CD 95 1 Y 1 A LYS 389 ? CE ? A LYS 271 CE 96 1 Y 1 A LYS 389 ? NZ ? A LYS 271 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 119 ? A GLY 1 2 1 Y 1 A ALA 120 ? A ALA 2 3 1 Y 1 A MET 121 ? A MET 3 4 1 Y 1 A GLU 122 ? A GLU 4 5 1 Y 1 A SER 123 ? A SER 5 6 1 Y 1 A LYS 124 ? A LYS 6 7 1 Y 1 A LYS 125 ? A LYS 7 8 1 Y 1 A ARG 126 ? A ARG 8 9 1 Y 1 A HIS 280 ? A HIS 162 10 1 Y 1 A ALA 281 ? A ALA 163 11 1 Y 1 A PRO 282 ? A PRO 164 12 1 Y 1 A SER 283 ? A SER 165 13 1 Y 1 A SER 284 ? A SER 166 14 1 Y 1 A ARG 285 ? A ARG 167 15 1 Y 1 A ARG 286 ? A ARG 168 16 1 Y 1 A THR 287 ? A THR 169 17 1 Y 1 A THR 288 ? A THR 170 18 1 Y 1 A LEU 289 ? A LEU 171 19 1 Y 1 A ASN 392 ? A ASN 274 20 1 Y 1 A ALA 393 ? A ALA 275 21 1 Y 1 A GLN 394 ? A GLN 276 22 1 Y 1 A ASN 395 ? A ASN 277 23 1 Y 1 A LYS 396 ? A LYS 278 24 1 Y 1 A GLU 397 ? A GLU 279 25 1 Y 1 A SER 398 ? A SER 280 26 1 Y 1 A ALA 399 ? A ALA 281 27 1 Y 1 A SER 400 ? A SER 282 28 1 Y 1 A LYS 401 ? A LYS 283 29 1 Y 1 A GLN 402 ? A GLN 284 30 1 Y 1 A SER 403 ? A SER 285 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Cancer Research UK' 'United Kingdom' C24461/A23302 1 'Medical Research Council (United Kingdom)' 'United Kingdom' MR/K016903 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id G7W _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id G7W _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(~{E})-~{N}-[4-(4-azanyl-1-propan-2-yl-pyrazolo[3,4-d]pyrimidin-3-yl)phenyl]-4-[4-fluoranyl-3-(trifluoromethyl)phenyl]-4-oxidanylidene-but-2-enamide ; G7W 3 'SULFATE ION' SO4 4 'CHLORIDE ION' CL 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #