data_6HMV # _entry.id 6HMV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6HMV pdb_00006hmv 10.2210/pdb6hmv/pdb WWPDB D_1200011907 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-24 2 'Structure model' 1 1 2019-08-14 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6HMV _pdbx_database_status.recvd_initial_deposition_date 2018-09-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Klima, M.' 1 ? 'Boura, E.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plos Pathog.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1553-7374 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 15 _citation.language ? _citation.page_first e1007962 _citation.page_last e1007962 _citation.title 'Convergent evolution in the mechanisms of ACBD3 recruitment to picornavirus replication sites.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.ppat.1007962 _citation.pdbx_database_id_PubMed 31381608 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Horova, V.' 1 ? primary 'Lyoo, H.' 2 0000-0001-5806-9463 primary 'Rozycki, B.' 3 0000-0001-5938-7308 primary 'Chalupska, D.' 4 ? primary 'Smola, M.' 5 ? primary 'Humpolickova, J.' 6 ? primary 'Strating, J.R.P.M.' 7 0000-0003-2509-5213 primary 'van Kuppeveld, F.J.M.' 8 ? primary 'Boura, E.' 9 ? primary 'Klima, M.' 10 0000-0002-9083-509X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Golgi resident protein GCP60' 19389.346 1 ? ? ? ? 2 polymer man 'Genome polyprotein' 5320.866 1 3.4.22.29,3.6.1.15,3.4.22.28,2.7.7.48 ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Acyl-CoA-binding domain-containing protein 3,Golgi complex-associated protein 1,GOCAP1,Golgi phosphoprotein 1,GOLPH1,PBR- and PKA-associated protein 7,Peripheral benzodiazepine receptor-associated protein PAP7 ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GAMESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPN TAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSV YYRVYYTR ; ;GAMESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPN TAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSV YYRVYYTR ; A ? 2 'polypeptide(L)' no no GSGSGTPAPDAINDALRSADSQEARDACQKKGWIVIHPSNELVVEKHISR GSGSGTPAPDAINDALRSADSQEARDACQKKGWIVIHPSNELVVEKHISR B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLU n 1 5 SER n 1 6 LEU n 1 7 PRO n 1 8 VAL n 1 9 ILE n 1 10 ALA n 1 11 ALA n 1 12 PRO n 1 13 SER n 1 14 MET n 1 15 TRP n 1 16 THR n 1 17 ARG n 1 18 PRO n 1 19 GLN n 1 20 ILE n 1 21 LYS n 1 22 ASP n 1 23 PHE n 1 24 LYS n 1 25 GLU n 1 26 LYS n 1 27 ILE n 1 28 GLN n 1 29 GLN n 1 30 ASP n 1 31 ALA n 1 32 ASP n 1 33 SER n 1 34 VAL n 1 35 ILE n 1 36 THR n 1 37 VAL n 1 38 GLY n 1 39 ARG n 1 40 GLY n 1 41 GLU n 1 42 VAL n 1 43 VAL n 1 44 THR n 1 45 VAL n 1 46 ARG n 1 47 VAL n 1 48 PRO n 1 49 THR n 1 50 HIS n 1 51 GLU n 1 52 GLU n 1 53 GLY n 1 54 SER n 1 55 TYR n 1 56 LEU n 1 57 PHE n 1 58 TRP n 1 59 GLU n 1 60 PHE n 1 61 ALA n 1 62 THR n 1 63 ASP n 1 64 ASN n 1 65 TYR n 1 66 ASP n 1 67 ILE n 1 68 GLY n 1 69 PHE n 1 70 GLY n 1 71 VAL n 1 72 TYR n 1 73 PHE n 1 74 GLU n 1 75 TRP n 1 76 THR n 1 77 ASP n 1 78 SER n 1 79 PRO n 1 80 ASN n 1 81 THR n 1 82 ALA n 1 83 VAL n 1 84 SER n 1 85 VAL n 1 86 HIS n 1 87 VAL n 1 88 SER n 1 89 GLU n 1 90 SER n 1 91 SER n 1 92 ASP n 1 93 ASP n 1 94 ASP n 1 95 GLU n 1 96 GLU n 1 97 GLU n 1 98 GLU n 1 99 GLU n 1 100 ASN n 1 101 ILE n 1 102 GLY n 1 103 CYS n 1 104 GLU n 1 105 GLU n 1 106 LYS n 1 107 ALA n 1 108 LYS n 1 109 LYS n 1 110 ASN n 1 111 ALA n 1 112 ASN n 1 113 LYS n 1 114 PRO n 1 115 LEU n 1 116 LEU n 1 117 ASP n 1 118 GLU n 1 119 ILE n 1 120 VAL n 1 121 PRO n 1 122 VAL n 1 123 TYR n 1 124 ARG n 1 125 ARG n 1 126 ASP n 1 127 CYS n 1 128 HIS n 1 129 GLU n 1 130 GLU n 1 131 VAL n 1 132 TYR n 1 133 ALA n 1 134 GLY n 1 135 SER n 1 136 HIS n 1 137 GLN n 1 138 TYR n 1 139 PRO n 1 140 GLY n 1 141 ARG n 1 142 GLY n 1 143 VAL n 1 144 TYR n 1 145 LEU n 1 146 LEU n 1 147 LYS n 1 148 PHE n 1 149 ASP n 1 150 ASN n 1 151 SER n 1 152 TYR n 1 153 SER n 1 154 LEU n 1 155 TRP n 1 156 ARG n 1 157 SER n 1 158 LYS n 1 159 SER n 1 160 VAL n 1 161 TYR n 1 162 TYR n 1 163 ARG n 1 164 VAL n 1 165 TYR n 1 166 TYR n 1 167 THR n 1 168 ARG n 2 1 GLY n 2 2 SER n 2 3 GLY n 2 4 SER n 2 5 GLY n 2 6 THR n 2 7 PRO n 2 8 ALA n 2 9 PRO n 2 10 ASP n 2 11 ALA n 2 12 ILE n 2 13 ASN n 2 14 ASP n 2 15 ALA n 2 16 LEU n 2 17 ARG n 2 18 SER n 2 19 ALA n 2 20 ASP n 2 21 SER n 2 22 GLN n 2 23 GLU n 2 24 ALA n 2 25 ARG n 2 26 ASP n 2 27 ALA n 2 28 CYS n 2 29 GLN n 2 30 LYS n 2 31 LYS n 2 32 GLY n 2 33 TRP n 2 34 ILE n 2 35 VAL n 2 36 ILE n 2 37 HIS n 2 38 PRO n 2 39 SER n 2 40 ASN n 2 41 GLU n 2 42 LEU n 2 43 VAL n 2 44 VAL n 2 45 GLU n 2 46 LYS n 2 47 HIS n 2 48 ILE n 2 49 SER n 2 50 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 168 Human ? 'ACBD3, GCP60, GOCAP1, GOLPH1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 50 ? ? ? ? ? ? ? ? ? 'Enterovirus D68' 42789 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 361 ? ? ? A . n A 1 2 ALA 2 362 ? ? ? A . n A 1 3 MET 3 363 ? ? ? A . n A 1 4 GLU 4 364 ? ? ? A . n A 1 5 SER 5 365 ? ? ? A . n A 1 6 LEU 6 366 ? ? ? A . n A 1 7 PRO 7 367 367 PRO PRO A . n A 1 8 VAL 8 368 368 VAL VAL A . n A 1 9 ILE 9 369 369 ILE ILE A . n A 1 10 ALA 10 370 370 ALA ALA A . n A 1 11 ALA 11 371 371 ALA ALA A . n A 1 12 PRO 12 372 372 PRO PRO A . n A 1 13 SER 13 373 373 SER SER A . n A 1 14 MET 14 374 374 MET MET A . n A 1 15 TRP 15 375 375 TRP TRP A . n A 1 16 THR 16 376 376 THR THR A . n A 1 17 ARG 17 377 377 ARG ARG A . n A 1 18 PRO 18 378 378 PRO PRO A . n A 1 19 GLN 19 379 379 GLN GLN A . n A 1 20 ILE 20 380 380 ILE ILE A . n A 1 21 LYS 21 381 381 LYS LYS A . n A 1 22 ASP 22 382 382 ASP ASP A . n A 1 23 PHE 23 383 383 PHE PHE A . n A 1 24 LYS 24 384 384 LYS LYS A . n A 1 25 GLU 25 385 385 GLU GLU A . n A 1 26 LYS 26 386 386 LYS LYS A . n A 1 27 ILE 27 387 387 ILE ILE A . n A 1 28 GLN 28 388 388 GLN GLN A . n A 1 29 GLN 29 389 389 GLN GLN A . n A 1 30 ASP 30 390 390 ASP ASP A . n A 1 31 ALA 31 391 391 ALA ALA A . n A 1 32 ASP 32 392 392 ASP ASP A . n A 1 33 SER 33 393 393 SER SER A . n A 1 34 VAL 34 394 394 VAL VAL A . n A 1 35 ILE 35 395 395 ILE ILE A . n A 1 36 THR 36 396 396 THR THR A . n A 1 37 VAL 37 397 397 VAL VAL A . n A 1 38 GLY 38 398 398 GLY GLY A . n A 1 39 ARG 39 399 399 ARG ARG A . n A 1 40 GLY 40 400 400 GLY GLY A . n A 1 41 GLU 41 401 401 GLU GLU A . n A 1 42 VAL 42 402 402 VAL VAL A . n A 1 43 VAL 43 403 403 VAL VAL A . n A 1 44 THR 44 404 404 THR THR A . n A 1 45 VAL 45 405 405 VAL VAL A . n A 1 46 ARG 46 406 406 ARG ARG A . n A 1 47 VAL 47 407 407 VAL VAL A . n A 1 48 PRO 48 408 408 PRO PRO A . n A 1 49 THR 49 409 409 THR THR A . n A 1 50 HIS 50 410 410 HIS HIS A . n A 1 51 GLU 51 411 411 GLU GLU A . n A 1 52 GLU 52 412 412 GLU GLU A . n A 1 53 GLY 53 413 413 GLY GLY A . n A 1 54 SER 54 414 414 SER SER A . n A 1 55 TYR 55 415 415 TYR TYR A . n A 1 56 LEU 56 416 416 LEU LEU A . n A 1 57 PHE 57 417 417 PHE PHE A . n A 1 58 TRP 58 418 418 TRP TRP A . n A 1 59 GLU 59 419 419 GLU GLU A . n A 1 60 PHE 60 420 420 PHE PHE A . n A 1 61 ALA 61 421 421 ALA ALA A . n A 1 62 THR 62 422 422 THR THR A . n A 1 63 ASP 63 423 423 ASP ASP A . n A 1 64 ASN 64 424 424 ASN ASN A . n A 1 65 TYR 65 425 425 TYR TYR A . n A 1 66 ASP 66 426 426 ASP ASP A . n A 1 67 ILE 67 427 427 ILE ILE A . n A 1 68 GLY 68 428 428 GLY GLY A . n A 1 69 PHE 69 429 429 PHE PHE A . n A 1 70 GLY 70 430 430 GLY GLY A . n A 1 71 VAL 71 431 431 VAL VAL A . n A 1 72 TYR 72 432 432 TYR TYR A . n A 1 73 PHE 73 433 433 PHE PHE A . n A 1 74 GLU 74 434 434 GLU GLU A . n A 1 75 TRP 75 435 435 TRP TRP A . n A 1 76 THR 76 436 436 THR THR A . n A 1 77 ASP 77 437 ? ? ? A . n A 1 78 SER 78 438 ? ? ? A . n A 1 79 PRO 79 439 ? ? ? A . n A 1 80 ASN 80 440 ? ? ? A . n A 1 81 THR 81 441 ? ? ? A . n A 1 82 ALA 82 442 ? ? ? A . n A 1 83 VAL 83 443 ? ? ? A . n A 1 84 SER 84 444 ? ? ? A . n A 1 85 VAL 85 445 ? ? ? A . n A 1 86 HIS 86 446 ? ? ? A . n A 1 87 VAL 87 447 ? ? ? A . n A 1 88 SER 88 448 ? ? ? A . n A 1 89 GLU 89 449 ? ? ? A . n A 1 90 SER 90 450 ? ? ? A . n A 1 91 SER 91 451 ? ? ? A . n A 1 92 ASP 92 452 ? ? ? A . n A 1 93 ASP 93 453 ? ? ? A . n A 1 94 ASP 94 454 ? ? ? A . n A 1 95 GLU 95 455 ? ? ? A . n A 1 96 GLU 96 456 ? ? ? A . n A 1 97 GLU 97 457 ? ? ? A . n A 1 98 GLU 98 458 ? ? ? A . n A 1 99 GLU 99 459 ? ? ? A . n A 1 100 ASN 100 460 ? ? ? A . n A 1 101 ILE 101 461 ? ? ? A . n A 1 102 GLY 102 462 ? ? ? A . n A 1 103 CYS 103 463 ? ? ? A . n A 1 104 GLU 104 464 ? ? ? A . n A 1 105 GLU 105 465 ? ? ? A . n A 1 106 LYS 106 466 ? ? ? A . n A 1 107 ALA 107 467 ? ? ? A . n A 1 108 LYS 108 468 ? ? ? A . n A 1 109 LYS 109 469 ? ? ? A . n A 1 110 ASN 110 470 ? ? ? A . n A 1 111 ALA 111 471 ? ? ? A . n A 1 112 ASN 112 472 ? ? ? A . n A 1 113 LYS 113 473 473 LYS LYS A . n A 1 114 PRO 114 474 474 PRO PRO A . n A 1 115 LEU 115 475 475 LEU LEU A . n A 1 116 LEU 116 476 476 LEU LEU A . n A 1 117 ASP 117 477 477 ASP ASP A . n A 1 118 GLU 118 478 478 GLU GLU A . n A 1 119 ILE 119 479 479 ILE ILE A . n A 1 120 VAL 120 480 480 VAL VAL A . n A 1 121 PRO 121 481 481 PRO PRO A . n A 1 122 VAL 122 482 482 VAL VAL A . n A 1 123 TYR 123 483 483 TYR TYR A . n A 1 124 ARG 124 484 484 ARG ARG A . n A 1 125 ARG 125 485 485 ARG ARG A . n A 1 126 ASP 126 486 486 ASP ASP A . n A 1 127 CYS 127 487 487 CYS CYS A . n A 1 128 HIS 128 488 488 HIS HIS A . n A 1 129 GLU 129 489 489 GLU GLU A . n A 1 130 GLU 130 490 490 GLU GLU A . n A 1 131 VAL 131 491 491 VAL VAL A . n A 1 132 TYR 132 492 492 TYR TYR A . n A 1 133 ALA 133 493 493 ALA ALA A . n A 1 134 GLY 134 494 494 GLY GLY A . n A 1 135 SER 135 495 495 SER SER A . n A 1 136 HIS 136 496 496 HIS HIS A . n A 1 137 GLN 137 497 497 GLN GLN A . n A 1 138 TYR 138 498 498 TYR TYR A . n A 1 139 PRO 139 499 499 PRO PRO A . n A 1 140 GLY 140 500 500 GLY GLY A . n A 1 141 ARG 141 501 501 ARG ARG A . n A 1 142 GLY 142 502 502 GLY GLY A . n A 1 143 VAL 143 503 503 VAL VAL A . n A 1 144 TYR 144 504 504 TYR TYR A . n A 1 145 LEU 145 505 505 LEU LEU A . n A 1 146 LEU 146 506 506 LEU LEU A . n A 1 147 LYS 147 507 507 LYS LYS A . n A 1 148 PHE 148 508 508 PHE PHE A . n A 1 149 ASP 149 509 509 ASP ASP A . n A 1 150 ASN 150 510 510 ASN ASN A . n A 1 151 SER 151 511 511 SER SER A . n A 1 152 TYR 152 512 512 TYR TYR A . n A 1 153 SER 153 513 513 SER SER A . n A 1 154 LEU 154 514 514 LEU LEU A . n A 1 155 TRP 155 515 515 TRP TRP A . n A 1 156 ARG 156 516 516 ARG ARG A . n A 1 157 SER 157 517 517 SER SER A . n A 1 158 LYS 158 518 518 LYS LYS A . n A 1 159 SER 159 519 519 SER SER A . n A 1 160 VAL 160 520 520 VAL VAL A . n A 1 161 TYR 161 521 521 TYR TYR A . n A 1 162 TYR 162 522 522 TYR TYR A . n A 1 163 ARG 163 523 523 ARG ARG A . n A 1 164 VAL 164 524 524 VAL VAL A . n A 1 165 TYR 165 525 525 TYR TYR A . n A 1 166 TYR 166 526 526 TYR TYR A . n A 1 167 THR 167 527 527 THR THR A . n A 1 168 ARG 168 528 528 ARG ARG A . n B 2 1 GLY 1 11 ? ? ? B . n B 2 2 SER 2 12 ? ? ? B . n B 2 3 GLY 3 13 ? ? ? B . n B 2 4 SER 4 14 ? ? ? B . n B 2 5 GLY 5 15 ? ? ? B . n B 2 6 THR 6 16 ? ? ? B . n B 2 7 PRO 7 17 17 PRO PRO B . n B 2 8 ALA 8 18 18 ALA ALA B . n B 2 9 PRO 9 19 19 PRO PRO B . n B 2 10 ASP 10 20 20 ASP ASP B . n B 2 11 ALA 11 21 21 ALA ALA B . n B 2 12 ILE 12 22 22 ILE ILE B . n B 2 13 ASN 13 23 23 ASN ASN B . n B 2 14 ASP 14 24 24 ASP ASP B . n B 2 15 ALA 15 25 25 ALA ALA B . n B 2 16 LEU 16 26 26 LEU LEU B . n B 2 17 ARG 17 27 27 ARG ARG B . n B 2 18 SER 18 28 28 SER SER B . n B 2 19 ALA 19 29 29 ALA ALA B . n B 2 20 ASP 20 30 30 ASP ASP B . n B 2 21 SER 21 31 31 SER SER B . n B 2 22 GLN 22 32 32 GLN GLN B . n B 2 23 GLU 23 33 33 GLU GLU B . n B 2 24 ALA 24 34 34 ALA ALA B . n B 2 25 ARG 25 35 35 ARG ARG B . n B 2 26 ASP 26 36 36 ASP ASP B . n B 2 27 ALA 27 37 37 ALA ALA B . n B 2 28 CYS 28 38 38 CYS CYS B . n B 2 29 GLN 29 39 39 GLN GLN B . n B 2 30 LYS 30 40 40 LYS LYS B . n B 2 31 LYS 31 41 41 LYS LYS B . n B 2 32 GLY 32 42 42 GLY GLY B . n B 2 33 TRP 33 43 43 TRP TRP B . n B 2 34 ILE 34 44 44 ILE ILE B . n B 2 35 VAL 35 45 45 VAL VAL B . n B 2 36 ILE 36 46 46 ILE ILE B . n B 2 37 HIS 37 47 47 HIS HIS B . n B 2 38 PRO 38 48 48 PRO PRO B . n B 2 39 SER 39 49 49 SER SER B . n B 2 40 ASN 40 50 50 ASN ASN B . n B 2 41 GLU 41 51 51 GLU GLU B . n B 2 42 LEU 42 52 52 LEU LEU B . n B 2 43 VAL 43 53 53 VAL VAL B . n B 2 44 VAL 44 54 54 VAL VAL B . n B 2 45 GLU 45 55 55 GLU GLU B . n B 2 46 LYS 46 56 56 LYS LYS B . n B 2 47 HIS 47 57 57 HIS HIS B . n B 2 48 ILE 48 58 58 ILE ILE B . n B 2 49 SER 49 59 59 SER SER B . n B 2 50 ARG 50 60 ? ? ? B . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 381 ? CG ? A LYS 21 CG 2 1 Y 1 A LYS 381 ? CD ? A LYS 21 CD 3 1 Y 1 A LYS 381 ? CE ? A LYS 21 CE 4 1 Y 1 A LYS 381 ? NZ ? A LYS 21 NZ 5 1 Y 1 A GLU 411 ? CG ? A GLU 51 CG 6 1 Y 1 A GLU 411 ? CD ? A GLU 51 CD 7 1 Y 1 A GLU 411 ? OE1 ? A GLU 51 OE1 8 1 Y 1 A GLU 411 ? OE2 ? A GLU 51 OE2 9 1 Y 1 A GLU 412 ? CG ? A GLU 52 CG 10 1 Y 1 A GLU 412 ? CD ? A GLU 52 CD 11 1 Y 1 A GLU 412 ? OE1 ? A GLU 52 OE1 12 1 Y 1 A GLU 412 ? OE2 ? A GLU 52 OE2 13 1 Y 1 A LYS 473 ? CG ? A LYS 113 CG 14 1 Y 1 A LYS 473 ? CD ? A LYS 113 CD 15 1 Y 1 A LYS 473 ? CE ? A LYS 113 CE 16 1 Y 1 A LYS 473 ? NZ ? A LYS 113 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 11-Sep-2018 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 11-Sep-2018 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.6 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6HMV _cell.details ? _cell.formula_units_Z ? _cell.length_a 55.432 _cell.length_a_esd ? _cell.length_b 59.165 _cell.length_b_esd ? _cell.length_c 85.902 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6HMV _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6HMV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.85 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.82 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '12.5% w/v PEG 1000, 12.5% w/v PEG 3350, 12.5% v/v MPD, 30 mM MgCl2, 30 mM CaCl2, 100 mM bicine/Tris pH 8.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-05-18 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 49.92 _reflns.entry_id 6HMV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.244 _reflns.d_resolution_low 40.45 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13960 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.24 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.1 _reflns.pdbx_Rmerge_I_obs 0.08654 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.81 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.09373 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.244 _reflns_shell.d_res_low 2.324 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.52 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1332 _reflns_shell.percent_possible_all 95.42 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.082 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.75 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6HMV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.244 _refine.ls_d_res_low 40.45 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13956 _refine.ls_number_reflns_R_free 698 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.23 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2323 _refine.ls_R_factor_R_free 0.2652 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2305 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5LZ1 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.49 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.35 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1371 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1371 _refine_hist.d_res_high 2.244 _refine_hist.d_res_low 40.45 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 1434 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.844 ? 1955 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.643 ? 514 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.034 ? 204 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 251 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2436 2.4169 . . 134 2558 98.00 . . . 0.3628 . 0.3151 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4169 2.6600 . . 138 2609 100.00 . . . 0.3667 . 0.2963 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6600 3.0448 . . 138 2634 99.00 . . . 0.2808 . 0.2867 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0448 3.8357 . . 140 2663 100.00 . . . 0.2833 . 0.2316 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8357 40.4583 . . 148 2794 100.00 . . . 0.2276 . 0.1958 . . . . . . . . . . # _struct.entry_id 6HMV _struct.title 'Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of enterovirus-D68 (fusion protein, LVVY mutant)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6HMV _struct_keywords.text 'complex, Golgi, enterovirus, picornavirus, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP GCP60_HUMAN Q9H3P7 ? 1 ;ESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAV SVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYR VYYTR ; 364 2 UNP A0A2K9Y515_9ENTO A0A2K9Y515 ? 2 TPAPDAINDLLRSVDSQEVRDYCQKKGWIVIHPSNELVVEKHISR 1454 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6HMV A 4 ? 168 ? Q9H3P7 364 ? 528 ? 364 528 2 2 6HMV B 6 ? 50 ? A0A2K9Y515 1454 ? 1498 ? 16 60 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6HMV GLY A 1 ? UNP Q9H3P7 ? ? 'expression tag' 361 1 1 6HMV ALA A 2 ? UNP Q9H3P7 ? ? 'expression tag' 362 2 1 6HMV MET A 3 ? UNP Q9H3P7 ? ? 'expression tag' 363 3 2 6HMV GLY B 1 ? UNP A0A2K9Y515 ? ? 'expression tag' 11 4 2 6HMV SER B 2 ? UNP A0A2K9Y515 ? ? 'expression tag' 12 5 2 6HMV GLY B 3 ? UNP A0A2K9Y515 ? ? 'expression tag' 13 6 2 6HMV SER B 4 ? UNP A0A2K9Y515 ? ? 'expression tag' 14 7 2 6HMV GLY B 5 ? UNP A0A2K9Y515 ? ? 'expression tag' 15 8 2 6HMV ALA B 15 ? UNP A0A2K9Y515 LEU 1463 'engineered mutation' 25 9 2 6HMV ALA B 19 ? UNP A0A2K9Y515 VAL 1467 'engineered mutation' 29 10 2 6HMV ALA B 24 ? UNP A0A2K9Y515 VAL 1472 'engineered mutation' 34 11 2 6HMV ALA B 27 ? UNP A0A2K9Y515 TYR 1475 'engineered mutation' 37 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2760 ? 1 MORE -10 ? 1 'SSA (A^2)' 8540 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 19 ? GLN A 28 ? GLN A 379 GLN A 388 1 ? 10 HELX_P HELX_P2 AA2 GLN A 29 ? ASP A 32 ? GLN A 389 ASP A 392 5 ? 4 HELX_P HELX_P3 AA3 ALA B 8 ? ALA B 19 ? ALA B 18 ALA B 29 1 ? 12 HELX_P HELX_P4 AA4 SER B 21 ? LYS B 31 ? SER B 31 LYS B 41 1 ? 11 HELX_P HELX_P5 AA5 PRO B 38 ? LEU B 42 ? PRO B 48 LEU B 52 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? AA3 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 13 ? ARG A 17 ? SER A 373 ARG A 377 AA1 2 VAL A 131 ? GLN A 137 ? VAL A 491 GLN A 497 AA1 3 TYR A 55 ? THR A 62 ? TYR A 415 THR A 422 AA1 4 LYS A 158 ? TYR A 166 ? LYS A 518 TYR A 526 AA1 5 VAL A 34 ? VAL A 37 ? VAL A 394 VAL A 397 AA2 1 SER A 13 ? ARG A 17 ? SER A 373 ARG A 377 AA2 2 VAL A 131 ? GLN A 137 ? VAL A 491 GLN A 497 AA2 3 TYR A 55 ? THR A 62 ? TYR A 415 THR A 422 AA2 4 LYS A 158 ? TYR A 166 ? LYS A 518 TYR A 526 AA2 5 VAL B 35 ? ILE B 36 ? VAL B 45 ILE B 46 AA3 1 LEU A 116 ? ARG A 125 ? LEU A 476 ARG A 485 AA3 2 ILE A 67 ? TRP A 75 ? ILE A 427 TRP A 435 AA3 3 GLY A 142 ? ASP A 149 ? GLY A 502 ASP A 509 AA3 4 GLU A 41 ? PRO A 48 ? GLU A 401 PRO A 408 AA3 5 VAL B 43 ? ILE B 48 ? VAL B 53 ILE B 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TRP A 15 ? N TRP A 375 O ALA A 133 ? O ALA A 493 AA1 2 3 O TYR A 132 ? O TYR A 492 N PHE A 60 ? N PHE A 420 AA1 3 4 N ALA A 61 ? N ALA A 421 O TYR A 161 ? O TYR A 521 AA1 4 5 O VAL A 160 ? O VAL A 520 N ILE A 35 ? N ILE A 395 AA2 1 2 N TRP A 15 ? N TRP A 375 O ALA A 133 ? O ALA A 493 AA2 2 3 O TYR A 132 ? O TYR A 492 N PHE A 60 ? N PHE A 420 AA2 3 4 N ALA A 61 ? N ALA A 421 O TYR A 161 ? O TYR A 521 AA2 4 5 N TYR A 166 ? N TYR A 526 O VAL B 35 ? O VAL B 45 AA3 1 2 O ASP A 117 ? O ASP A 477 N PHE A 73 ? N PHE A 433 AA3 2 3 N GLU A 74 ? N GLU A 434 O VAL A 143 ? O VAL A 503 AA3 3 4 O TYR A 144 ? O TYR A 504 N VAL A 47 ? N VAL A 407 AA3 4 5 N VAL A 42 ? N VAL A 402 O HIS B 47 ? O HIS B 57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 414 ? ? -132.15 -60.49 2 1 ASN A 424 ? ? -123.49 -59.54 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 361 ? A GLY 1 2 1 Y 1 A ALA 362 ? A ALA 2 3 1 Y 1 A MET 363 ? A MET 3 4 1 Y 1 A GLU 364 ? A GLU 4 5 1 Y 1 A SER 365 ? A SER 5 6 1 Y 1 A LEU 366 ? A LEU 6 7 1 Y 1 A ASP 437 ? A ASP 77 8 1 Y 1 A SER 438 ? A SER 78 9 1 Y 1 A PRO 439 ? A PRO 79 10 1 Y 1 A ASN 440 ? A ASN 80 11 1 Y 1 A THR 441 ? A THR 81 12 1 Y 1 A ALA 442 ? A ALA 82 13 1 Y 1 A VAL 443 ? A VAL 83 14 1 Y 1 A SER 444 ? A SER 84 15 1 Y 1 A VAL 445 ? A VAL 85 16 1 Y 1 A HIS 446 ? A HIS 86 17 1 Y 1 A VAL 447 ? A VAL 87 18 1 Y 1 A SER 448 ? A SER 88 19 1 Y 1 A GLU 449 ? A GLU 89 20 1 Y 1 A SER 450 ? A SER 90 21 1 Y 1 A SER 451 ? A SER 91 22 1 Y 1 A ASP 452 ? A ASP 92 23 1 Y 1 A ASP 453 ? A ASP 93 24 1 Y 1 A ASP 454 ? A ASP 94 25 1 Y 1 A GLU 455 ? A GLU 95 26 1 Y 1 A GLU 456 ? A GLU 96 27 1 Y 1 A GLU 457 ? A GLU 97 28 1 Y 1 A GLU 458 ? A GLU 98 29 1 Y 1 A GLU 459 ? A GLU 99 30 1 Y 1 A ASN 460 ? A ASN 100 31 1 Y 1 A ILE 461 ? A ILE 101 32 1 Y 1 A GLY 462 ? A GLY 102 33 1 Y 1 A CYS 463 ? A CYS 103 34 1 Y 1 A GLU 464 ? A GLU 104 35 1 Y 1 A GLU 465 ? A GLU 105 36 1 Y 1 A LYS 466 ? A LYS 106 37 1 Y 1 A ALA 467 ? A ALA 107 38 1 Y 1 A LYS 468 ? A LYS 108 39 1 Y 1 A LYS 469 ? A LYS 109 40 1 Y 1 A ASN 470 ? A ASN 110 41 1 Y 1 A ALA 471 ? A ALA 111 42 1 Y 1 A ASN 472 ? A ASN 112 43 1 Y 1 B GLY 11 ? B GLY 1 44 1 Y 1 B SER 12 ? B SER 2 45 1 Y 1 B GLY 13 ? B GLY 3 46 1 Y 1 B SER 14 ? B SER 4 47 1 Y 1 B GLY 15 ? B GLY 5 48 1 Y 1 B THR 16 ? B THR 6 49 1 Y 1 B ARG 60 ? B ARG 50 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Czech Science Foundation' _pdbx_audit_support.country 'Czech Republic' _pdbx_audit_support.grant_number 17-07058Y _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5LZ1 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6HMV _atom_sites.fract_transf_matrix[1][1] 0.018040 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016902 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011641 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_