data_6HN6 # _entry.id 6HN6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.366 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6HN6 pdb_00006hn6 10.2210/pdb6hn6/pdb WWPDB D_1200011670 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2019-02-20 _pdbx_database_PDB_obs_spr.pdb_id 6HN6 _pdbx_database_PDB_obs_spr.replace_pdb_id 1LBD _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6HN6 _pdbx_database_status.recvd_initial_deposition_date 2018-09-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Eberhardt, J.' 1 0000-0002-2974-7541 'McEwen, A.G.' 2 0000-0003-4484-3512 'Bourguet, W.' 3 0000-0002-0643-7719 'Moras, D.' 4 0000-0001-7028-2320 'Dejaegere, A.' 5 0000-0002-3569-7771 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary 'Acta Crystallogr F Struct Biol Commun' ACSFEN ? 2053-230X ? ? 75 ? 98 104 'A revisited version of the apo structure of the ligand-binding domain of the human nuclear receptor retinoic X receptor alpha.' 2019 ? 10.1107/S2053230X18018022 30713160 ? ? ? ? ? ? ? ? UK ? ? 1 Nature NATUAS 0006 0028-0836 ? ? 375 ? 377 382 'Crystal structure of the ligand-binding domain of the human nuclear receptor RXR-alpha.' 1995 ? 10.1038/375377a0 7760929 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Eberhardt, J.' 1 ? primary 'McEwen, A.G.' 2 ? primary 'Bourguet, W.' 3 ? primary 'Moras, D.' 4 0000-0001-7028-2320 primary 'Dejaegere, A.' 5 ? 1 'Bourguet, W.' 6 0000-0002-0643-7719 1 'Ruff, M.' 7 ? 1 'Chambon, P.' 8 ? 1 'Gronemeyer, H.' 9 ? 1 'Moras, D.' 10 0000-0001-7028-2320 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6HN6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 110.800 _cell.length_a_esd ? _cell.length_b 110.800 _cell.length_b_esd ? _cell.length_c 109.900 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6HN6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Retinoic acid receptor RXR-alpha' 31702.221 1 ? ? ? 'HISTIDINE TAG PLUS DOMAIN D PLUS LIGAND-BINDING DOMAIN E' 2 non-polymer syn '3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE' 614.877 4 ? ? ? ? 3 water nat water 18.015 40 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Nuclear receptor subfamily 2 group B member 1,Retinoid X receptor alpha' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSS PNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSA GVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSS PNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSA GVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 LYS n 1 22 ARG n 1 23 GLU n 1 24 ALA n 1 25 VAL n 1 26 GLN n 1 27 GLU n 1 28 GLU n 1 29 ARG n 1 30 GLN n 1 31 ARG n 1 32 GLY n 1 33 LYS n 1 34 ASP n 1 35 ARG n 1 36 ASN n 1 37 GLU n 1 38 ASN n 1 39 GLU n 1 40 VAL n 1 41 GLU n 1 42 SER n 1 43 THR n 1 44 SER n 1 45 SER n 1 46 ALA n 1 47 ASN n 1 48 GLU n 1 49 ASP n 1 50 MET n 1 51 PRO n 1 52 VAL n 1 53 GLU n 1 54 ARG n 1 55 ILE n 1 56 LEU n 1 57 GLU n 1 58 ALA n 1 59 GLU n 1 60 LEU n 1 61 ALA n 1 62 VAL n 1 63 GLU n 1 64 PRO n 1 65 LYS n 1 66 THR n 1 67 GLU n 1 68 THR n 1 69 TYR n 1 70 VAL n 1 71 GLU n 1 72 ALA n 1 73 ASN n 1 74 MET n 1 75 GLY n 1 76 LEU n 1 77 ASN n 1 78 PRO n 1 79 SER n 1 80 SER n 1 81 PRO n 1 82 ASN n 1 83 ASP n 1 84 PRO n 1 85 VAL n 1 86 THR n 1 87 ASN n 1 88 ILE n 1 89 CYS n 1 90 GLN n 1 91 ALA n 1 92 ALA n 1 93 ASP n 1 94 LYS n 1 95 GLN n 1 96 LEU n 1 97 PHE n 1 98 THR n 1 99 LEU n 1 100 VAL n 1 101 GLU n 1 102 TRP n 1 103 ALA n 1 104 LYS n 1 105 ARG n 1 106 ILE n 1 107 PRO n 1 108 HIS n 1 109 PHE n 1 110 SER n 1 111 GLU n 1 112 LEU n 1 113 PRO n 1 114 LEU n 1 115 ASP n 1 116 ASP n 1 117 GLN n 1 118 VAL n 1 119 ILE n 1 120 LEU n 1 121 LEU n 1 122 ARG n 1 123 ALA n 1 124 GLY n 1 125 TRP n 1 126 ASN n 1 127 GLU n 1 128 LEU n 1 129 LEU n 1 130 ILE n 1 131 ALA n 1 132 SER n 1 133 PHE n 1 134 SER n 1 135 HIS n 1 136 ARG n 1 137 SER n 1 138 ILE n 1 139 ALA n 1 140 VAL n 1 141 LYS n 1 142 ASP n 1 143 GLY n 1 144 ILE n 1 145 LEU n 1 146 LEU n 1 147 ALA n 1 148 THR n 1 149 GLY n 1 150 LEU n 1 151 HIS n 1 152 VAL n 1 153 HIS n 1 154 ARG n 1 155 ASN n 1 156 SER n 1 157 ALA n 1 158 HIS n 1 159 SER n 1 160 ALA n 1 161 GLY n 1 162 VAL n 1 163 GLY n 1 164 ALA n 1 165 ILE n 1 166 PHE n 1 167 ASP n 1 168 ARG n 1 169 VAL n 1 170 LEU n 1 171 THR n 1 172 GLU n 1 173 LEU n 1 174 VAL n 1 175 SER n 1 176 LYS n 1 177 MET n 1 178 ARG n 1 179 ASP n 1 180 MET n 1 181 GLN n 1 182 MET n 1 183 ASP n 1 184 LYS n 1 185 THR n 1 186 GLU n 1 187 LEU n 1 188 GLY n 1 189 CYS n 1 190 LEU n 1 191 ARG n 1 192 ALA n 1 193 ILE n 1 194 VAL n 1 195 LEU n 1 196 PHE n 1 197 ASN n 1 198 PRO n 1 199 ASP n 1 200 SER n 1 201 LYS n 1 202 GLY n 1 203 LEU n 1 204 SER n 1 205 ASN n 1 206 PRO n 1 207 ALA n 1 208 GLU n 1 209 VAL n 1 210 GLU n 1 211 ALA n 1 212 LEU n 1 213 ARG n 1 214 GLU n 1 215 LYS n 1 216 VAL n 1 217 TYR n 1 218 ALA n 1 219 SER n 1 220 LEU n 1 221 GLU n 1 222 ALA n 1 223 TYR n 1 224 CYS n 1 225 LYS n 1 226 HIS n 1 227 LYS n 1 228 TYR n 1 229 PRO n 1 230 GLU n 1 231 GLN n 1 232 PRO n 1 233 GLY n 1 234 ARG n 1 235 PHE n 1 236 ALA n 1 237 LYS n 1 238 LEU n 1 239 LEU n 1 240 LEU n 1 241 ARG n 1 242 LEU n 1 243 PRO n 1 244 ALA n 1 245 LEU n 1 246 ARG n 1 247 SER n 1 248 ILE n 1 249 GLY n 1 250 LEU n 1 251 LYS n 1 252 CYS n 1 253 LEU n 1 254 GLU n 1 255 HIS n 1 256 LEU n 1 257 PHE n 1 258 PHE n 1 259 PHE n 1 260 LYS n 1 261 LEU n 1 262 ILE n 1 263 GLY n 1 264 ASP n 1 265 THR n 1 266 PRO n 1 267 ILE n 1 268 ASP n 1 269 THR n 1 270 PHE n 1 271 LEU n 1 272 MET n 1 273 GLU n 1 274 MET n 1 275 LEU n 1 276 GLU n 1 277 ALA n 1 278 PRO n 1 279 HIS n 1 280 GLN n 1 281 MET n 1 282 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 282 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RXRA, NR2B1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET15-B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RXRA_HUMAN _struct_ref.pdbx_db_accession P19793 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLV EWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFK LIGDTPIDTFLMEMLEAPHQMT ; _struct_ref.pdbx_align_begin 201 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6HN6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 282 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P19793 _struct_ref_seq.db_align_beg 201 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 462 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 201 _struct_ref_seq.pdbx_auth_seq_align_end 462 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6HN6 MET A 1 ? UNP P19793 ? ? 'initiating methionine' 181 1 1 6HN6 GLY A 2 ? UNP P19793 ? ? 'expression tag' 182 2 1 6HN6 SER A 3 ? UNP P19793 ? ? 'expression tag' 183 3 1 6HN6 SER A 4 ? UNP P19793 ? ? 'expression tag' 184 4 1 6HN6 HIS A 5 ? UNP P19793 ? ? 'expression tag' 185 5 1 6HN6 HIS A 6 ? UNP P19793 ? ? 'expression tag' 186 6 1 6HN6 HIS A 7 ? UNP P19793 ? ? 'expression tag' 187 7 1 6HN6 HIS A 8 ? UNP P19793 ? ? 'expression tag' 188 8 1 6HN6 HIS A 9 ? UNP P19793 ? ? 'expression tag' 189 9 1 6HN6 HIS A 10 ? UNP P19793 ? ? 'expression tag' 190 10 1 6HN6 SER A 11 ? UNP P19793 ? ? 'expression tag' 191 11 1 6HN6 SER A 12 ? UNP P19793 ? ? 'expression tag' 192 12 1 6HN6 GLY A 13 ? UNP P19793 ? ? 'expression tag' 193 13 1 6HN6 LEU A 14 ? UNP P19793 ? ? 'expression tag' 194 14 1 6HN6 VAL A 15 ? UNP P19793 ? ? 'expression tag' 195 15 1 6HN6 PRO A 16 ? UNP P19793 ? ? 'expression tag' 196 16 1 6HN6 ARG A 17 ? UNP P19793 ? ? 'expression tag' 197 17 1 6HN6 GLY A 18 ? UNP P19793 ? ? 'expression tag' 198 18 1 6HN6 SER A 19 ? UNP P19793 ? ? 'expression tag' 199 19 1 6HN6 HIS A 20 ? UNP P19793 ? ? 'expression tag' 200 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CPS non-polymer . '3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE' CHAPS 'C32 H58 N2 O7 S' 614.877 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6HN6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.07 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.95 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.45 M AMMONIUM CITRATE, 30 mM KCl, 4% GLYCEROL, 5 mM CHAPS, pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 290 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details Mirrors _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type MARRESEARCH _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 1994-03-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator Mirrors _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'LURE BEAMLINE DW32' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline DW32 _diffrn_source.pdbx_synchrotron_site LURE # _reflns.B_iso_Wilson_estimate 66.28 _reflns.entry_id 6HN6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.71 _reflns.d_resolution_low 7.99 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9164 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 84.73 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.71 _reflns_shell.d_res_low 3.03 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2597 _reflns_shell.percent_possible_all 83.03 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -3.80370 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][2] -3.80370 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] 7.60730 _refine.B_iso_max ? _refine.B_iso_mean 64.96 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.954 _refine.correlation_coeff_Fo_to_Fc_free 0.931 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6HN6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.71 _refine.ls_d_res_low 7.99 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9164 _refine.ls_number_reflns_R_free 459 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 84.7 _refine.ls_percent_reflns_R_free 5.010 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.176 _refine.ls_R_factor_R_free 0.231 _refine.ls_R_factor_R_free_error 0.000 _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.173 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct MIR _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.315 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.311 _refine.pdbx_overall_SU_R_Blow_DPI 0.827 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.796 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 6HN6 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.00 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1870 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 168 _refine_hist.number_atoms_solvent 40 _refine_hist.number_atoms_total 2078 _refine_hist.d_res_high 2.71 _refine_hist.d_res_low 7.99 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 2103 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.09 ? 2887 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 829 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 48 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 281 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2103 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.67 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 17.44 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 295 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 2458 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.71 _refine_ls_shell.d_res_low 3.03 _refine_ls_shell.number_reflns_all 2597 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 130 _refine_ls_shell.number_reflns_R_work 2467 _refine_ls_shell.percent_reflns_obs 83.03 _refine_ls_shell.percent_reflns_R_free 5.01 _refine_ls_shell.R_factor_all 0.253 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.321 _refine_ls_shell.R_factor_R_free_error 0.000 _refine_ls_shell.R_factor_R_work 0.249 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6HN6 _struct.title 'A revisited version of the apo structure of the ligand-binding domain of the human nuclear receptor RXR-ALPHA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6HN6 _struct_keywords.text 'TRANSCRIPTION FACTOR, NUCLEAR RECEPTOR, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 51 ? VAL A 62 ? PRO A 231 VAL A 242 1 ? 12 HELX_P HELX_P2 AA2 LYS A 65 ? GLY A 75 ? LYS A 245 GLY A 255 1 ? 11 HELX_P HELX_P3 AA3 ASP A 83 ? ARG A 105 ? ASP A 263 ARG A 285 1 ? 23 HELX_P HELX_P4 AA4 HIS A 108 ? LEU A 112 ? HIS A 288 LEU A 292 5 ? 5 HELX_P HELX_P5 AA5 PRO A 113 ? ARG A 136 ? PRO A 293 ARG A 316 1 ? 24 HELX_P HELX_P6 AA6 ARG A 154 ? ALA A 160 ? ARG A 334 ALA A 340 1 ? 7 HELX_P HELX_P7 AA7 VAL A 162 ? LEU A 173 ? VAL A 342 LEU A 353 1 ? 12 HELX_P HELX_P8 AA8 LEU A 173 ? MET A 180 ? LEU A 353 MET A 360 1 ? 8 HELX_P HELX_P9 AA9 ASP A 183 ? PHE A 196 ? ASP A 363 PHE A 376 1 ? 14 HELX_P HELX_P10 AB1 ASN A 205 ? TYR A 228 ? ASN A 385 TYR A 408 1 ? 24 HELX_P HELX_P11 AB2 GLY A 233 ? LEU A 240 ? GLY A 413 LEU A 420 1 ? 8 HELX_P HELX_P12 AB3 ARG A 241 ? LEU A 256 ? ARG A 421 LEU A 436 1 ? 16 HELX_P HELX_P13 AB4 LEU A 256 ? ALA A 277 ? LEU A 436 ALA A 457 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 143 ? LEU A 145 ? GLY A 323 LEU A 325 AA1 2 HIS A 151 ? HIS A 153 ? HIS A 331 HIS A 333 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 144 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 324 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 152 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 332 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CPS 501 ? 8 'binding site for residue CPS A 501' AC2 Software A CPS 502 ? 6 'binding site for residue CPS A 502' AC3 Software A CPS 503 ? 8 'binding site for residue CPS A 503' AC4 Software A CPS 504 ? 3 'binding site for residue CPS A 504' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 ALA A 72 ? ALA A 252 . ? 1_555 ? 2 AC1 8 GLY A 75 ? GLY A 255 . ? 1_555 ? 3 AC1 8 PRO A 78 ? PRO A 258 . ? 1_555 ? 4 AC1 8 SER A 80 ? SER A 260 . ? 1_555 ? 5 AC1 8 PRO A 81 ? PRO A 261 . ? 1_555 ? 6 AC1 8 ASN A 82 ? ASN A 262 . ? 1_555 ? 7 AC1 8 ASN A 87 ? ASN A 267 . ? 1_555 ? 8 AC1 8 GLU A 273 ? GLU A 453 . ? 1_555 ? 9 AC2 6 PRO A 113 ? PRO A 293 . ? 2_665 ? 10 AC2 6 LEU A 114 ? LEU A 294 . ? 2_665 ? 11 AC2 6 GLU A 273 ? GLU A 453 . ? 1_555 ? 12 AC2 6 GLU A 276 ? GLU A 456 . ? 1_555 ? 13 AC2 6 CPS D . ? CPS A 503 . ? 1_555 ? 14 AC2 6 CPS D . ? CPS A 503 . ? 8_676 ? 15 AC3 8 ALA A 72 ? ALA A 252 . ? 1_555 ? 16 AC3 8 ASN A 73 ? ASN A 253 . ? 1_555 ? 17 AC3 8 MET A 74 ? MET A 254 . ? 8_676 ? 18 AC3 8 GLY A 75 ? GLY A 255 . ? 8_676 ? 19 AC3 8 PRO A 78 ? PRO A 258 . ? 8_676 ? 20 AC3 8 LEU A 150 ? LEU A 330 . ? 1_555 ? 21 AC3 8 CPS C . ? CPS A 502 . ? 8_676 ? 22 AC3 8 CPS C . ? CPS A 502 . ? 1_555 ? 23 AC4 3 TYR A 69 ? TYR A 249 . ? 8_676 ? 24 AC4 3 ASN A 73 ? ASN A 253 . ? 8_676 ? 25 AC4 3 LEU A 76 ? LEU A 256 . ? 1_555 ? # _atom_sites.entry_id 6HN6 _atom_sites.fract_transf_matrix[1][1] 0.009025 _atom_sites.fract_transf_matrix[1][2] 0.005211 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010421 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009099 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 181 ? ? ? A . n A 1 2 GLY 2 182 ? ? ? A . n A 1 3 SER 3 183 ? ? ? A . n A 1 4 SER 4 184 ? ? ? A . n A 1 5 HIS 5 185 ? ? ? A . n A 1 6 HIS 6 186 ? ? ? A . n A 1 7 HIS 7 187 ? ? ? A . n A 1 8 HIS 8 188 ? ? ? A . n A 1 9 HIS 9 189 ? ? ? A . n A 1 10 HIS 10 190 ? ? ? A . n A 1 11 SER 11 191 ? ? ? A . n A 1 12 SER 12 192 ? ? ? A . n A 1 13 GLY 13 193 ? ? ? A . n A 1 14 LEU 14 194 ? ? ? A . n A 1 15 VAL 15 195 ? ? ? A . n A 1 16 PRO 16 196 ? ? ? A . n A 1 17 ARG 17 197 ? ? ? A . n A 1 18 GLY 18 198 ? ? ? A . n A 1 19 SER 19 199 ? ? ? A . n A 1 20 HIS 20 200 ? ? ? A . n A 1 21 LYS 21 201 ? ? ? A . n A 1 22 ARG 22 202 ? ? ? A . n A 1 23 GLU 23 203 ? ? ? A . n A 1 24 ALA 24 204 ? ? ? A . n A 1 25 VAL 25 205 ? ? ? A . n A 1 26 GLN 26 206 ? ? ? A . n A 1 27 GLU 27 207 ? ? ? A . n A 1 28 GLU 28 208 ? ? ? A . n A 1 29 ARG 29 209 ? ? ? A . n A 1 30 GLN 30 210 ? ? ? A . n A 1 31 ARG 31 211 ? ? ? A . n A 1 32 GLY 32 212 ? ? ? A . n A 1 33 LYS 33 213 ? ? ? A . n A 1 34 ASP 34 214 ? ? ? A . n A 1 35 ARG 35 215 ? ? ? A . n A 1 36 ASN 36 216 ? ? ? A . n A 1 37 GLU 37 217 ? ? ? A . n A 1 38 ASN 38 218 ? ? ? A . n A 1 39 GLU 39 219 ? ? ? A . n A 1 40 VAL 40 220 ? ? ? A . n A 1 41 GLU 41 221 ? ? ? A . n A 1 42 SER 42 222 ? ? ? A . n A 1 43 THR 43 223 ? ? ? A . n A 1 44 SER 44 224 ? ? ? A . n A 1 45 SER 45 225 225 SER SER A . n A 1 46 ALA 46 226 226 ALA ALA A . n A 1 47 ASN 47 227 227 ASN ASN A . n A 1 48 GLU 48 228 228 GLU GLU A . n A 1 49 ASP 49 229 229 ASP ASP A . n A 1 50 MET 50 230 230 MET MET A . n A 1 51 PRO 51 231 231 PRO PRO A . n A 1 52 VAL 52 232 232 VAL VAL A . n A 1 53 GLU 53 233 233 GLU GLU A . n A 1 54 ARG 54 234 234 ARG ARG A . n A 1 55 ILE 55 235 235 ILE ILE A . n A 1 56 LEU 56 236 236 LEU LEU A . n A 1 57 GLU 57 237 237 GLU GLU A . n A 1 58 ALA 58 238 238 ALA ALA A . n A 1 59 GLU 59 239 239 GLU GLU A . n A 1 60 LEU 60 240 240 LEU LEU A . n A 1 61 ALA 61 241 241 ALA ALA A . n A 1 62 VAL 62 242 242 VAL VAL A . n A 1 63 GLU 63 243 243 GLU GLU A . n A 1 64 PRO 64 244 244 PRO PRO A . n A 1 65 LYS 65 245 245 LYS LYS A . n A 1 66 THR 66 246 246 THR THR A . n A 1 67 GLU 67 247 247 GLU GLU A . n A 1 68 THR 68 248 248 THR THR A . n A 1 69 TYR 69 249 249 TYR TYR A . n A 1 70 VAL 70 250 250 VAL VAL A . n A 1 71 GLU 71 251 251 GLU GLU A . n A 1 72 ALA 72 252 252 ALA ALA A . n A 1 73 ASN 73 253 253 ASN ASN A . n A 1 74 MET 74 254 254 MET MET A . n A 1 75 GLY 75 255 255 GLY GLY A . n A 1 76 LEU 76 256 256 LEU LEU A . n A 1 77 ASN 77 257 257 ASN ASN A . n A 1 78 PRO 78 258 258 PRO PRO A . n A 1 79 SER 79 259 259 SER SER A . n A 1 80 SER 80 260 260 SER SER A . n A 1 81 PRO 81 261 261 PRO PRO A . n A 1 82 ASN 82 262 262 ASN ASN A . n A 1 83 ASP 83 263 263 ASP ASP A . n A 1 84 PRO 84 264 264 PRO PRO A . n A 1 85 VAL 85 265 265 VAL VAL A . n A 1 86 THR 86 266 266 THR THR A . n A 1 87 ASN 87 267 267 ASN ASN A . n A 1 88 ILE 88 268 268 ILE ILE A . n A 1 89 CYS 89 269 269 CYS CYS A . n A 1 90 GLN 90 270 270 GLN GLN A . n A 1 91 ALA 91 271 271 ALA ALA A . n A 1 92 ALA 92 272 272 ALA ALA A . n A 1 93 ASP 93 273 273 ASP ASP A . n A 1 94 LYS 94 274 274 LYS LYS A . n A 1 95 GLN 95 275 275 GLN GLN A . n A 1 96 LEU 96 276 276 LEU LEU A . n A 1 97 PHE 97 277 277 PHE PHE A . n A 1 98 THR 98 278 278 THR THR A . n A 1 99 LEU 99 279 279 LEU LEU A . n A 1 100 VAL 100 280 280 VAL VAL A . n A 1 101 GLU 101 281 281 GLU GLU A . n A 1 102 TRP 102 282 282 TRP TRP A . n A 1 103 ALA 103 283 283 ALA ALA A . n A 1 104 LYS 104 284 284 LYS LYS A . n A 1 105 ARG 105 285 285 ARG ARG A . n A 1 106 ILE 106 286 286 ILE ILE A . n A 1 107 PRO 107 287 287 PRO PRO A . n A 1 108 HIS 108 288 288 HIS HIS A . n A 1 109 PHE 109 289 289 PHE PHE A . n A 1 110 SER 110 290 290 SER SER A . n A 1 111 GLU 111 291 291 GLU GLU A . n A 1 112 LEU 112 292 292 LEU LEU A . n A 1 113 PRO 113 293 293 PRO PRO A . n A 1 114 LEU 114 294 294 LEU LEU A . n A 1 115 ASP 115 295 295 ASP ASP A . n A 1 116 ASP 116 296 296 ASP ASP A . n A 1 117 GLN 117 297 297 GLN GLN A . n A 1 118 VAL 118 298 298 VAL VAL A . n A 1 119 ILE 119 299 299 ILE ILE A . n A 1 120 LEU 120 300 300 LEU LEU A . n A 1 121 LEU 121 301 301 LEU LEU A . n A 1 122 ARG 122 302 302 ARG ARG A . n A 1 123 ALA 123 303 303 ALA ALA A . n A 1 124 GLY 124 304 304 GLY GLY A . n A 1 125 TRP 125 305 305 TRP TRP A . n A 1 126 ASN 126 306 306 ASN ASN A . n A 1 127 GLU 127 307 307 GLU GLU A . n A 1 128 LEU 128 308 308 LEU LEU A . n A 1 129 LEU 129 309 309 LEU LEU A . n A 1 130 ILE 130 310 310 ILE ILE A . n A 1 131 ALA 131 311 311 ALA ALA A . n A 1 132 SER 132 312 312 SER SER A . n A 1 133 PHE 133 313 313 PHE PHE A . n A 1 134 SER 134 314 314 SER SER A . n A 1 135 HIS 135 315 315 HIS HIS A . n A 1 136 ARG 136 316 316 ARG ARG A . n A 1 137 SER 137 317 317 SER SER A . n A 1 138 ILE 138 318 318 ILE ILE A . n A 1 139 ALA 139 319 319 ALA ALA A . n A 1 140 VAL 140 320 320 VAL VAL A . n A 1 141 LYS 141 321 321 LYS LYS A . n A 1 142 ASP 142 322 322 ASP ASP A . n A 1 143 GLY 143 323 323 GLY GLY A . n A 1 144 ILE 144 324 324 ILE ILE A . n A 1 145 LEU 145 325 325 LEU LEU A . n A 1 146 LEU 146 326 326 LEU LEU A . n A 1 147 ALA 147 327 327 ALA ALA A . n A 1 148 THR 148 328 328 THR THR A . n A 1 149 GLY 149 329 329 GLY GLY A . n A 1 150 LEU 150 330 330 LEU LEU A . n A 1 151 HIS 151 331 331 HIS HIS A . n A 1 152 VAL 152 332 332 VAL VAL A . n A 1 153 HIS 153 333 333 HIS HIS A . n A 1 154 ARG 154 334 334 ARG ARG A . n A 1 155 ASN 155 335 335 ASN ASN A . n A 1 156 SER 156 336 336 SER SER A . n A 1 157 ALA 157 337 337 ALA ALA A . n A 1 158 HIS 158 338 338 HIS HIS A . n A 1 159 SER 159 339 339 SER SER A . n A 1 160 ALA 160 340 340 ALA ALA A . n A 1 161 GLY 161 341 341 GLY GLY A . n A 1 162 VAL 162 342 342 VAL VAL A . n A 1 163 GLY 163 343 343 GLY GLY A . n A 1 164 ALA 164 344 344 ALA ALA A . n A 1 165 ILE 165 345 345 ILE ILE A . n A 1 166 PHE 166 346 346 PHE PHE A . n A 1 167 ASP 167 347 347 ASP ASP A . n A 1 168 ARG 168 348 348 ARG ARG A . n A 1 169 VAL 169 349 349 VAL VAL A . n A 1 170 LEU 170 350 350 LEU LEU A . n A 1 171 THR 171 351 351 THR THR A . n A 1 172 GLU 172 352 352 GLU GLU A . n A 1 173 LEU 173 353 353 LEU LEU A . n A 1 174 VAL 174 354 354 VAL VAL A . n A 1 175 SER 175 355 355 SER SER A . n A 1 176 LYS 176 356 356 LYS LYS A . n A 1 177 MET 177 357 357 MET MET A . n A 1 178 ARG 178 358 358 ARG ARG A . n A 1 179 ASP 179 359 359 ASP ASP A . n A 1 180 MET 180 360 360 MET MET A . n A 1 181 GLN 181 361 361 GLN GLN A . n A 1 182 MET 182 362 362 MET MET A . n A 1 183 ASP 183 363 363 ASP ASP A . n A 1 184 LYS 184 364 364 LYS LYS A . n A 1 185 THR 185 365 365 THR THR A . n A 1 186 GLU 186 366 366 GLU GLU A . n A 1 187 LEU 187 367 367 LEU LEU A . n A 1 188 GLY 188 368 368 GLY GLY A . n A 1 189 CYS 189 369 369 CYS CYS A . n A 1 190 LEU 190 370 370 LEU LEU A . n A 1 191 ARG 191 371 371 ARG ARG A . n A 1 192 ALA 192 372 372 ALA ALA A . n A 1 193 ILE 193 373 373 ILE ILE A . n A 1 194 VAL 194 374 374 VAL VAL A . n A 1 195 LEU 195 375 375 LEU LEU A . n A 1 196 PHE 196 376 376 PHE PHE A . n A 1 197 ASN 197 377 377 ASN ASN A . n A 1 198 PRO 198 378 378 PRO PRO A . n A 1 199 ASP 199 379 379 ASP ASP A . n A 1 200 SER 200 380 380 SER SER A . n A 1 201 LYS 201 381 381 LYS LYS A . n A 1 202 GLY 202 382 382 GLY GLY A . n A 1 203 LEU 203 383 383 LEU LEU A . n A 1 204 SER 204 384 384 SER SER A . n A 1 205 ASN 205 385 385 ASN ASN A . n A 1 206 PRO 206 386 386 PRO PRO A . n A 1 207 ALA 207 387 387 ALA ALA A . n A 1 208 GLU 208 388 388 GLU GLU A . n A 1 209 VAL 209 389 389 VAL VAL A . n A 1 210 GLU 210 390 390 GLU GLU A . n A 1 211 ALA 211 391 391 ALA ALA A . n A 1 212 LEU 212 392 392 LEU LEU A . n A 1 213 ARG 213 393 393 ARG ARG A . n A 1 214 GLU 214 394 394 GLU GLU A . n A 1 215 LYS 215 395 395 LYS LYS A . n A 1 216 VAL 216 396 396 VAL VAL A . n A 1 217 TYR 217 397 397 TYR TYR A . n A 1 218 ALA 218 398 398 ALA ALA A . n A 1 219 SER 219 399 399 SER SER A . n A 1 220 LEU 220 400 400 LEU LEU A . n A 1 221 GLU 221 401 401 GLU GLU A . n A 1 222 ALA 222 402 402 ALA ALA A . n A 1 223 TYR 223 403 403 TYR TYR A . n A 1 224 CYS 224 404 404 CYS CYS A . n A 1 225 LYS 225 405 405 LYS LYS A . n A 1 226 HIS 226 406 406 HIS HIS A . n A 1 227 LYS 227 407 407 LYS LYS A . n A 1 228 TYR 228 408 408 TYR TYR A . n A 1 229 PRO 229 409 409 PRO PRO A . n A 1 230 GLU 230 410 410 GLU GLU A . n A 1 231 GLN 231 411 411 GLN GLN A . n A 1 232 PRO 232 412 412 PRO PRO A . n A 1 233 GLY 233 413 413 GLY GLY A . n A 1 234 ARG 234 414 414 ARG ARG A . n A 1 235 PHE 235 415 415 PHE PHE A . n A 1 236 ALA 236 416 416 ALA ALA A . n A 1 237 LYS 237 417 417 LYS LYS A . n A 1 238 LEU 238 418 418 LEU LEU A . n A 1 239 LEU 239 419 419 LEU LEU A . n A 1 240 LEU 240 420 420 LEU LEU A . n A 1 241 ARG 241 421 421 ARG ARG A . n A 1 242 LEU 242 422 422 LEU LEU A . n A 1 243 PRO 243 423 423 PRO PRO A . n A 1 244 ALA 244 424 424 ALA ALA A . n A 1 245 LEU 245 425 425 LEU LEU A . n A 1 246 ARG 246 426 426 ARG ARG A . n A 1 247 SER 247 427 427 SER SER A . n A 1 248 ILE 248 428 428 ILE ILE A . n A 1 249 GLY 249 429 429 GLY GLY A . n A 1 250 LEU 250 430 430 LEU LEU A . n A 1 251 LYS 251 431 431 LYS LYS A . n A 1 252 CYS 252 432 432 CYS CYS A . n A 1 253 LEU 253 433 433 LEU LEU A . n A 1 254 GLU 254 434 434 GLU GLU A . n A 1 255 HIS 255 435 435 HIS HIS A . n A 1 256 LEU 256 436 436 LEU LEU A . n A 1 257 PHE 257 437 437 PHE PHE A . n A 1 258 PHE 258 438 438 PHE PHE A . n A 1 259 PHE 259 439 439 PHE PHE A . n A 1 260 LYS 260 440 440 LYS LYS A . n A 1 261 LEU 261 441 441 LEU LEU A . n A 1 262 ILE 262 442 442 ILE ILE A . n A 1 263 GLY 263 443 443 GLY GLY A . n A 1 264 ASP 264 444 444 ASP ASP A . n A 1 265 THR 265 445 445 THR THR A . n A 1 266 PRO 266 446 446 PRO PRO A . n A 1 267 ILE 267 447 447 ILE ILE A . n A 1 268 ASP 268 448 448 ASP ASP A . n A 1 269 THR 269 449 449 THR THR A . n A 1 270 PHE 270 450 450 PHE PHE A . n A 1 271 LEU 271 451 451 LEU LEU A . n A 1 272 MET 272 452 452 MET MET A . n A 1 273 GLU 273 453 453 GLU GLU A . n A 1 274 MET 274 454 454 MET MET A . n A 1 275 LEU 275 455 455 LEU LEU A . n A 1 276 GLU 276 456 456 GLU GLU A . n A 1 277 ALA 277 457 457 ALA ALA A . n A 1 278 PRO 278 458 458 PRO PRO A . n A 1 279 HIS 279 459 459 HIS HIS A . n A 1 280 GLN 280 460 460 GLN GLN A . n A 1 281 MET 281 461 461 MET MET A . n A 1 282 THR 282 462 462 THR THR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CPS 1 501 1 CPS CPS A . C 2 CPS 1 502 2 CPS CPS A . D 2 CPS 1 503 3 CPS CPS A . E 2 CPS 1 504 4 CPS CPS A . F 3 HOH 1 601 17 HOH HOH A . F 3 HOH 2 602 19 HOH HOH A . F 3 HOH 3 603 20 HOH HOH A . F 3 HOH 4 604 18 HOH HOH A . F 3 HOH 5 605 34 HOH HOH A . F 3 HOH 6 606 2 HOH HOH A . F 3 HOH 7 607 11 HOH HOH A . F 3 HOH 8 608 14 HOH HOH A . F 3 HOH 9 609 1 HOH HOH A . F 3 HOH 10 610 23 HOH HOH A . F 3 HOH 11 611 28 HOH HOH A . F 3 HOH 12 612 22 HOH HOH A . F 3 HOH 13 613 6 HOH HOH A . F 3 HOH 14 614 16 HOH HOH A . F 3 HOH 15 615 4 HOH HOH A . F 3 HOH 16 616 24 HOH HOH A . F 3 HOH 17 617 3 HOH HOH A . F 3 HOH 18 618 10 HOH HOH A . F 3 HOH 19 619 39 HOH HOH A . F 3 HOH 20 620 12 HOH HOH A . F 3 HOH 21 621 26 HOH HOH A . F 3 HOH 22 622 9 HOH HOH A . F 3 HOH 23 623 8 HOH HOH A . F 3 HOH 24 624 29 HOH HOH A . F 3 HOH 25 625 21 HOH HOH A . F 3 HOH 26 626 15 HOH HOH A . F 3 HOH 27 627 25 HOH HOH A . F 3 HOH 28 628 5 HOH HOH A . F 3 HOH 29 629 31 HOH HOH A . F 3 HOH 30 630 7 HOH HOH A . F 3 HOH 31 631 36 HOH HOH A . F 3 HOH 32 632 40 HOH HOH A . F 3 HOH 33 633 27 HOH HOH A . F 3 HOH 34 634 37 HOH HOH A . F 3 HOH 35 635 35 HOH HOH A . F 3 HOH 36 636 38 HOH HOH A . F 3 HOH 37 637 30 HOH HOH A . F 3 HOH 38 638 13 HOH HOH A . F 3 HOH 39 639 32 HOH HOH A . F 3 HOH 40 640 33 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F 1 2 A,B,C,D,E,F # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_566 x,x-y+1,-z+3/2 0.5000000000 0.8660254038 0.0000000000 -55.4000000000 0.8660254038 -0.5000000000 0.0000000000 95.9556147393 0.0000000000 0.0000000000 -1.0000000000 164.8500000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-02-20 2 'Structure model' 1 1 2022-08-10 3 'Structure model' 1 2 2023-03-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_struct_assembly 3 2 'Structure model' pdbx_struct_assembly_gen 4 2 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' pdbx_struct_assembly 6 3 'Structure model' pdbx_struct_assembly_gen 7 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_struct_assembly.oligomeric_count' 4 2 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 5 3 'Structure model' '_pdbx_struct_assembly.oligomeric_count' 6 3 'Structure model' '_pdbx_struct_assembly.oligomeric_details' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 33.8138 82.1871 63.7381 -0.1406 0.0927 -0.0122 -0.1281 0.1311 0.0747 0.4435 2.4085 0.8713 1.7777 -1.5201 -3.1120 -0.0545 0.0307 0.1136 -0.0409 0.1304 -0.2181 -0.0375 0.1160 -0.0759 'X-RAY DIFFRACTION' 2 ? refined 13.8031 79.4507 62.1177 0.0321 -0.0295 -0.1144 -0.0522 0.0645 0.1151 3.3595 2.0394 1.5507 -1.1691 0.7154 -0.2052 0.0141 0.5650 0.1829 -0.3119 -0.1845 -0.3085 -0.2947 0.3353 0.1704 'X-RAY DIFFRACTION' 3 ? refined 17.9125 85.5440 73.9333 0.0305 -0.1113 0.0251 -0.0904 -0.0093 0.0987 1.5393 -0.5032 3.2183 -0.1099 -0.1696 0.1632 -0.1887 0.2900 0.4252 -0.0722 0.0301 -0.3438 -0.6035 0.2713 0.1586 'X-RAY DIFFRACTION' 4 ? refined 33.2716 74.6131 73.8238 -0.1998 0.1278 0.0722 -0.0550 0.0473 0.1030 2.4714 1.2866 2.5847 1.6486 0.4152 -0.3190 0.0243 -0.0538 0.0902 -0.0283 0.0818 -0.2481 0.0808 0.6751 -0.1061 'X-RAY DIFFRACTION' 5 ? refined 21.7436 82.8344 79.0425 -0.0485 -0.0472 -0.0005 -0.0561 -0.0221 0.0730 0.9539 0.4465 4.2155 -0.9550 1.1213 1.0844 -0.0195 -0.0582 0.2704 0.0117 0.1416 -0.2569 -0.2088 0.2010 -0.1220 'X-RAY DIFFRACTION' 6 ? refined -7.3112 79.2604 59.8918 0.0259 0.0357 -0.0539 0.0015 -0.0772 0.1303 4.8938 0.9723 0.5964 -0.6169 1.8378 -0.0040 0.0406 0.2340 0.0595 -0.3165 0.0494 0.2200 -0.0914 -0.1065 -0.0900 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '{ A|225 - A|242 }' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '{ A|243 - A|340 }' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '{ A|341 - A|375 }' 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '{ A|376 - A|407 }' 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? '{ A|408 - A|435 }' 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? '{ A|436 - A|462 }' # _phasing.method MIR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.2 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? MLPHARE ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? MARXDS 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? MARSCALE 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 257 ? ? 38.62 63.13 2 1 ASN A 262 ? ? -86.53 49.23 3 1 HIS A 288 ? ? 71.84 -12.10 4 1 GLN A 460 ? ? -106.04 -113.48 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 181 ? A MET 1 2 1 Y 1 A GLY 182 ? A GLY 2 3 1 Y 1 A SER 183 ? A SER 3 4 1 Y 1 A SER 184 ? A SER 4 5 1 Y 1 A HIS 185 ? A HIS 5 6 1 Y 1 A HIS 186 ? A HIS 6 7 1 Y 1 A HIS 187 ? A HIS 7 8 1 Y 1 A HIS 188 ? A HIS 8 9 1 Y 1 A HIS 189 ? A HIS 9 10 1 Y 1 A HIS 190 ? A HIS 10 11 1 Y 1 A SER 191 ? A SER 11 12 1 Y 1 A SER 192 ? A SER 12 13 1 Y 1 A GLY 193 ? A GLY 13 14 1 Y 1 A LEU 194 ? A LEU 14 15 1 Y 1 A VAL 195 ? A VAL 15 16 1 Y 1 A PRO 196 ? A PRO 16 17 1 Y 1 A ARG 197 ? A ARG 17 18 1 Y 1 A GLY 198 ? A GLY 18 19 1 Y 1 A SER 199 ? A SER 19 20 1 Y 1 A HIS 200 ? A HIS 20 21 1 Y 1 A LYS 201 ? A LYS 21 22 1 Y 1 A ARG 202 ? A ARG 22 23 1 Y 1 A GLU 203 ? A GLU 23 24 1 Y 1 A ALA 204 ? A ALA 24 25 1 Y 1 A VAL 205 ? A VAL 25 26 1 Y 1 A GLN 206 ? A GLN 26 27 1 Y 1 A GLU 207 ? A GLU 27 28 1 Y 1 A GLU 208 ? A GLU 28 29 1 Y 1 A ARG 209 ? A ARG 29 30 1 Y 1 A GLN 210 ? A GLN 30 31 1 Y 1 A ARG 211 ? A ARG 31 32 1 Y 1 A GLY 212 ? A GLY 32 33 1 Y 1 A LYS 213 ? A LYS 33 34 1 Y 1 A ASP 214 ? A ASP 34 35 1 Y 1 A ARG 215 ? A ARG 35 36 1 Y 1 A ASN 216 ? A ASN 36 37 1 Y 1 A GLU 217 ? A GLU 37 38 1 Y 1 A ASN 218 ? A ASN 38 39 1 Y 1 A GLU 219 ? A GLU 39 40 1 Y 1 A VAL 220 ? A VAL 40 41 1 Y 1 A GLU 221 ? A GLU 41 42 1 Y 1 A SER 222 ? A SER 42 43 1 Y 1 A THR 223 ? A THR 43 44 1 Y 1 A SER 224 ? A SER 44 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'French National Research Agency' France ANR-10-BINF-003 1 'French National Research Agency' France ANR-10-IDEX-0002-02 2 'French National Research Agency' France ANR-10-INBS-05 3 'French National Research Agency' France ANR-10-LABX-0030-INRT 4 'French National Research Agency' France ANR-IAB-2011-BIP:BIP 5 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE' CPS 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #