data_6HN7 # _entry.id 6HN7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6HN7 pdb_00006hn7 10.2210/pdb6hn7/pdb WWPDB D_1200011943 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-31 2 'Structure model' 1 1 2019-08-07 3 'Structure model' 1 2 2019-09-18 4 'Structure model' 1 3 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Source and taxonomy' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' entity_src_gen 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_initial_refinement_model 9 4 'Structure model' software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' 6 3 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' 9 4 'Structure model' '_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6HN7 _pdbx_database_status.recvd_initial_deposition_date 2018-09-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Penades, J.R.' 1 0000-0002-6439-5262 'Bacarizo, J.' 2 0000-0002-5253-5520 'Marina, A.' 3 0000-0002-1334-5273 'Alqasmi, M.' 4 0000-0001-7391-3626 'Fillol-Salom, A.' 5 0000-0002-6464-285X 'Roszak, A.W.' 6 0000-0002-9463-9694 'Ciges-Tomas, J.R.' 7 0000-0003-2647-3052 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mol.Cell _citation.journal_id_ASTM MOCEFL _citation.journal_id_CSD 2168 _citation.journal_id_ISSN 1097-2765 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 75 _citation.language ? _citation.page_first 1020 _citation.page_last 1030.e4 _citation.title 'Hijacking the Hijackers: Escherichia coli Pathogenicity Islands Redirect Helper Phage Packaging for Their Own Benefit.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.molcel.2019.06.017 _citation.pdbx_database_id_PubMed 31350119 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fillol-Salom, A.' 1 ? primary 'Bacarizo, J.' 2 ? primary 'Alqasmi, M.' 3 ? primary 'Ciges-Tomas, J.R.' 4 ? primary 'Martinez-Rubio, R.' 5 ? primary 'Roszak, A.W.' 6 ? primary 'Cogdell, R.J.' 7 ? primary 'Chen, J.' 8 ? primary 'Marina, A.' 9 ? primary 'Penades, J.R.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Redirecting phage packaging protein C (RppC)' 17828.396 1 ? ? ? ? 2 polymer man 'Terminase small subunit' 11472.711 1 ? ? ? ;All alpha proteins, Putative DNA-binding domain, Hetero-dimer complex, Terminase gpNU1 subunit domain, Bacteriophage lambda The first three Ala residues at the beginning of the sequence from coordinates come from the purification tag. ; 3 water nat water 18.015 20 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name 'DNA-packaging protein Nu1,Gene product Nu1,gpNu1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MSEKEFFLSQQEIADQFGVDRTTVRAWTKRGLPFIEGDKGKPGRYQLGHVLFWVRGQEGLKELGMTGELHPLDCIMHSRE IMLSMVGEEEDKQEYEKKFNKGLEIYGYSPDEIAQARGRAQGIEIGRELTLKRLKKHTNENKKKRKLIRQNDT ; ;MSEKEFFLSQQEIADQFGVDRTTVRAWTKRGLPFIEGDKGKPGRYQLGHVLFWVRGQEGLKELGMTGELHPLDCIMHSRE IMLSMVGEEEDKQEYEKKFNKGLEIYGYSPDEIAQARGRAQGIEIGRELTLKRLKKHTNENKKKRKLIRQNDT ; A ? 2 'polypeptide(L)' no no ;AAAMEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENEKLRREVEELRQASEADL QPGTIEYERHRLTRAQADAQE ; ;AAAMEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENEKLRREVEELRQASEADL QPGTIEYERHRLTRAQADAQE ; B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLU n 1 4 LYS n 1 5 GLU n 1 6 PHE n 1 7 PHE n 1 8 LEU n 1 9 SER n 1 10 GLN n 1 11 GLN n 1 12 GLU n 1 13 ILE n 1 14 ALA n 1 15 ASP n 1 16 GLN n 1 17 PHE n 1 18 GLY n 1 19 VAL n 1 20 ASP n 1 21 ARG n 1 22 THR n 1 23 THR n 1 24 VAL n 1 25 ARG n 1 26 ALA n 1 27 TRP n 1 28 THR n 1 29 LYS n 1 30 ARG n 1 31 GLY n 1 32 LEU n 1 33 PRO n 1 34 PHE n 1 35 ILE n 1 36 GLU n 1 37 GLY n 1 38 ASP n 1 39 LYS n 1 40 GLY n 1 41 LYS n 1 42 PRO n 1 43 GLY n 1 44 ARG n 1 45 TYR n 1 46 GLN n 1 47 LEU n 1 48 GLY n 1 49 HIS n 1 50 VAL n 1 51 LEU n 1 52 PHE n 1 53 TRP n 1 54 VAL n 1 55 ARG n 1 56 GLY n 1 57 GLN n 1 58 GLU n 1 59 GLY n 1 60 LEU n 1 61 LYS n 1 62 GLU n 1 63 LEU n 1 64 GLY n 1 65 MET n 1 66 THR n 1 67 GLY n 1 68 GLU n 1 69 LEU n 1 70 HIS n 1 71 PRO n 1 72 LEU n 1 73 ASP n 1 74 CYS n 1 75 ILE n 1 76 MET n 1 77 HIS n 1 78 SER n 1 79 ARG n 1 80 GLU n 1 81 ILE n 1 82 MET n 1 83 LEU n 1 84 SER n 1 85 MET n 1 86 VAL n 1 87 GLY n 1 88 GLU n 1 89 GLU n 1 90 GLU n 1 91 ASP n 1 92 LYS n 1 93 GLN n 1 94 GLU n 1 95 TYR n 1 96 GLU n 1 97 LYS n 1 98 LYS n 1 99 PHE n 1 100 ASN n 1 101 LYS n 1 102 GLY n 1 103 LEU n 1 104 GLU n 1 105 ILE n 1 106 TYR n 1 107 GLY n 1 108 TYR n 1 109 SER n 1 110 PRO n 1 111 ASP n 1 112 GLU n 1 113 ILE n 1 114 ALA n 1 115 GLN n 1 116 ALA n 1 117 ARG n 1 118 GLY n 1 119 ARG n 1 120 ALA n 1 121 GLN n 1 122 GLY n 1 123 ILE n 1 124 GLU n 1 125 ILE n 1 126 GLY n 1 127 ARG n 1 128 GLU n 1 129 LEU n 1 130 THR n 1 131 LEU n 1 132 LYS n 1 133 ARG n 1 134 LEU n 1 135 LYS n 1 136 LYS n 1 137 HIS n 1 138 THR n 1 139 ASN n 1 140 GLU n 1 141 ASN n 1 142 LYS n 1 143 LYS n 1 144 LYS n 1 145 ARG n 1 146 LYS n 1 147 LEU n 1 148 ILE n 1 149 ARG n 1 150 GLN n 1 151 ASN n 1 152 ASP n 1 153 THR n 2 1 ALA n 2 2 ALA n 2 3 ALA n 2 4 MET n 2 5 GLU n 2 6 VAL n 2 7 ASN n 2 8 LYS n 2 9 LYS n 2 10 GLN n 2 11 LEU n 2 12 ALA n 2 13 ASP n 2 14 ILE n 2 15 PHE n 2 16 GLY n 2 17 ALA n 2 18 SER n 2 19 ILE n 2 20 ARG n 2 21 THR n 2 22 ILE n 2 23 GLN n 2 24 ASN n 2 25 TRP n 2 26 GLN n 2 27 GLU n 2 28 GLN n 2 29 GLY n 2 30 MET n 2 31 PRO n 2 32 VAL n 2 33 LEU n 2 34 ARG n 2 35 GLY n 2 36 GLY n 2 37 GLY n 2 38 LYS n 2 39 GLY n 2 40 ASN n 2 41 GLU n 2 42 VAL n 2 43 LEU n 2 44 TYR n 2 45 ASP n 2 46 SER n 2 47 ALA n 2 48 ALA n 2 49 VAL n 2 50 ILE n 2 51 LYS n 2 52 TRP n 2 53 TYR n 2 54 ALA n 2 55 GLU n 2 56 ARG n 2 57 ASP n 2 58 ALA n 2 59 GLU n 2 60 ILE n 2 61 GLU n 2 62 ASN n 2 63 GLU n 2 64 LYS n 2 65 LEU n 2 66 ARG n 2 67 ARG n 2 68 GLU n 2 69 VAL n 2 70 GLU n 2 71 GLU n 2 72 LEU n 2 73 ARG n 2 74 GLN n 2 75 ALA n 2 76 SER n 2 77 GLU n 2 78 ALA n 2 79 ASP n 2 80 LEU n 2 81 GLN n 2 82 PRO n 2 83 GLY n 2 84 THR n 2 85 ILE n 2 86 GLU n 2 87 TYR n 2 88 GLU n 2 89 ARG n 2 90 HIS n 2 91 ARG n 2 92 LEU n 2 93 THR n 2 94 ARG n 2 95 ALA n 2 96 GLN n 2 97 ALA n 2 98 ASP n 2 99 ALA n 2 100 GLN n 2 101 GLU n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 153 ? ? CXXR01000010.1 ? ? ? ? ? ? 'Escherichia coli' 562 EC2733.1 ? ? ? ? ? ? ? ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; 866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 101 ? ? 'Nu1, lambdap01' ? ? ? ? ? ? 'Escherichia virus Lambda' 10710 ? ? ? ? ? ? ? ? ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; 866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 LYS 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 MET 65 65 65 MET MET A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 THR 138 138 ? ? ? A . n A 1 139 ASN 139 139 ? ? ? A . n A 1 140 GLU 140 140 ? ? ? A . n A 1 141 ASN 141 141 ? ? ? A . n A 1 142 LYS 142 142 ? ? ? A . n A 1 143 LYS 143 143 ? ? ? A . n A 1 144 LYS 144 144 ? ? ? A . n A 1 145 ARG 145 145 ? ? ? A . n A 1 146 LYS 146 146 ? ? ? A . n A 1 147 LEU 147 147 ? ? ? A . n A 1 148 ILE 148 148 ? ? ? A . n A 1 149 ARG 149 149 ? ? ? A . n A 1 150 GLN 150 150 ? ? ? A . n A 1 151 ASN 151 151 ? ? ? A . n A 1 152 ASP 152 152 ? ? ? A . n A 1 153 THR 153 153 ? ? ? A . n B 2 1 ALA 1 -2 -2 ALA ALA B . n B 2 2 ALA 2 -1 -1 ALA ALA B . n B 2 3 ALA 3 0 0 ALA ALA B . n B 2 4 MET 4 1 1 MET MET B . n B 2 5 GLU 5 2 2 GLU GLU B . n B 2 6 VAL 6 3 3 VAL VAL B . n B 2 7 ASN 7 4 4 ASN ASN B . n B 2 8 LYS 8 5 5 LYS LYS B . n B 2 9 LYS 9 6 6 LYS LYS B . n B 2 10 GLN 10 7 7 GLN GLN B . n B 2 11 LEU 11 8 8 LEU LEU B . n B 2 12 ALA 12 9 9 ALA ALA B . n B 2 13 ASP 13 10 10 ASP ASP B . n B 2 14 ILE 14 11 11 ILE ILE B . n B 2 15 PHE 15 12 12 PHE PHE B . n B 2 16 GLY 16 13 13 GLY GLY B . n B 2 17 ALA 17 14 14 ALA ALA B . n B 2 18 SER 18 15 15 SER SER B . n B 2 19 ILE 19 16 16 ILE ILE B . n B 2 20 ARG 20 17 17 ARG ARG B . n B 2 21 THR 21 18 18 THR THR B . n B 2 22 ILE 22 19 19 ILE ILE B . n B 2 23 GLN 23 20 20 GLN GLN B . n B 2 24 ASN 24 21 21 ASN ASN B . n B 2 25 TRP 25 22 22 TRP TRP B . n B 2 26 GLN 26 23 23 GLN GLN B . n B 2 27 GLU 27 24 24 GLU GLU B . n B 2 28 GLN 28 25 25 GLN GLN B . n B 2 29 GLY 29 26 26 GLY GLY B . n B 2 30 MET 30 27 27 MET MET B . n B 2 31 PRO 31 28 28 PRO PRO B . n B 2 32 VAL 32 29 29 VAL VAL B . n B 2 33 LEU 33 30 30 LEU LEU B . n B 2 34 ARG 34 31 31 ARG ARG B . n B 2 35 GLY 35 32 32 GLY GLY B . n B 2 36 GLY 36 33 33 GLY GLY B . n B 2 37 GLY 37 34 34 GLY GLY B . n B 2 38 LYS 38 35 35 LYS LYS B . n B 2 39 GLY 39 36 36 GLY GLY B . n B 2 40 ASN 40 37 37 ASN ASN B . n B 2 41 GLU 41 38 38 GLU GLU B . n B 2 42 VAL 42 39 39 VAL VAL B . n B 2 43 LEU 43 40 40 LEU LEU B . n B 2 44 TYR 44 41 41 TYR TYR B . n B 2 45 ASP 45 42 42 ASP ASP B . n B 2 46 SER 46 43 43 SER SER B . n B 2 47 ALA 47 44 44 ALA ALA B . n B 2 48 ALA 48 45 45 ALA ALA B . n B 2 49 VAL 49 46 46 VAL VAL B . n B 2 50 ILE 50 47 47 ILE ILE B . n B 2 51 LYS 51 48 48 LYS LYS B . n B 2 52 TRP 52 49 49 TRP TRP B . n B 2 53 TYR 53 50 50 TYR TYR B . n B 2 54 ALA 54 51 51 ALA ALA B . n B 2 55 GLU 55 52 52 GLU GLU B . n B 2 56 ARG 56 53 53 ARG ARG B . n B 2 57 ASP 57 54 54 ASP ASP B . n B 2 58 ALA 58 55 55 ALA ALA B . n B 2 59 GLU 59 56 56 GLU GLU B . n B 2 60 ILE 60 57 57 ILE ILE B . n B 2 61 GLU 61 58 58 GLU GLU B . n B 2 62 ASN 62 59 59 ASN ASN B . n B 2 63 GLU 63 60 60 GLU GLU B . n B 2 64 LYS 64 61 61 LYS LYS B . n B 2 65 LEU 65 62 62 LEU LEU B . n B 2 66 ARG 66 63 63 ARG ARG B . n B 2 67 ARG 67 64 64 ARG ARG B . n B 2 68 GLU 68 65 65 GLU GLU B . n B 2 69 VAL 69 66 66 VAL VAL B . n B 2 70 GLU 70 67 67 GLU GLU B . n B 2 71 GLU 71 68 68 GLU GLU B . n B 2 72 LEU 72 69 69 LEU LEU B . n B 2 73 ARG 73 70 ? ? ? B . n B 2 74 GLN 74 71 ? ? ? B . n B 2 75 ALA 75 72 ? ? ? B . n B 2 76 SER 76 73 ? ? ? B . n B 2 77 GLU 77 74 ? ? ? B . n B 2 78 ALA 78 75 ? ? ? B . n B 2 79 ASP 79 76 ? ? ? B . n B 2 80 LEU 80 77 ? ? ? B . n B 2 81 GLN 81 78 ? ? ? B . n B 2 82 PRO 82 79 ? ? ? B . n B 2 83 GLY 83 80 ? ? ? B . n B 2 84 THR 84 81 ? ? ? B . n B 2 85 ILE 85 82 ? ? ? B . n B 2 86 GLU 86 83 ? ? ? B . n B 2 87 TYR 87 84 ? ? ? B . n B 2 88 GLU 88 85 ? ? ? B . n B 2 89 ARG 89 86 ? ? ? B . n B 2 90 HIS 90 87 ? ? ? B . n B 2 91 ARG 91 88 ? ? ? B . n B 2 92 LEU 92 89 ? ? ? B . n B 2 93 THR 93 90 ? ? ? B . n B 2 94 ARG 94 91 ? ? ? B . n B 2 95 ALA 95 92 ? ? ? B . n B 2 96 GLN 96 93 ? ? ? B . n B 2 97 ALA 97 94 ? ? ? B . n B 2 98 ASP 98 95 ? ? ? B . n B 2 99 ALA 99 96 ? ? ? B . n B 2 100 GLN 100 97 ? ? ? B . n B 2 101 GLU 101 98 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 201 3 HOH HOH A . C 3 HOH 2 202 9 HOH HOH A . C 3 HOH 3 203 16 HOH HOH A . C 3 HOH 4 204 12 HOH HOH A . C 3 HOH 5 205 15 HOH HOH A . C 3 HOH 6 206 10 HOH HOH A . C 3 HOH 7 207 2 HOH HOH A . C 3 HOH 8 208 26 HOH HOH A . C 3 HOH 9 209 1 HOH HOH A . C 3 HOH 10 210 13 HOH HOH A . C 3 HOH 11 211 8 HOH HOH A . C 3 HOH 12 212 21 HOH HOH A . C 3 HOH 13 213 19 HOH HOH A . C 3 HOH 14 214 18 HOH HOH A . C 3 HOH 15 215 24 HOH HOH A . C 3 HOH 16 216 6 HOH HOH A . C 3 HOH 17 217 22 HOH HOH A . D 3 HOH 1 101 20 HOH HOH B . D 3 HOH 2 102 23 HOH HOH B . D 3 HOH 3 103 5 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 36 ? CG ? A GLU 36 CG 2 1 Y 1 A GLU 36 ? CD ? A GLU 36 CD 3 1 Y 1 A GLU 36 ? OE1 ? A GLU 36 OE1 4 1 Y 1 A GLU 36 ? OE2 ? A GLU 36 OE2 5 1 Y 1 A LYS 39 ? CG ? A LYS 39 CG 6 1 Y 1 A LYS 39 ? CD ? A LYS 39 CD 7 1 Y 1 A LYS 39 ? CE ? A LYS 39 CE 8 1 Y 1 A LYS 39 ? NZ ? A LYS 39 NZ 9 1 Y 1 A LYS 41 ? CG ? A LYS 41 CG 10 1 Y 1 A LYS 41 ? CD ? A LYS 41 CD 11 1 Y 1 A LYS 41 ? CE ? A LYS 41 CE 12 1 Y 1 A LYS 41 ? NZ ? A LYS 41 NZ 13 1 Y 1 A PRO 42 ? CG ? A PRO 42 CG 14 1 Y 1 A PRO 42 ? CD ? A PRO 42 CD 15 1 Y 1 A VAL 86 ? CG1 ? A VAL 86 CG1 16 1 Y 1 A VAL 86 ? CG2 ? A VAL 86 CG2 17 1 Y 1 A GLU 89 ? CG ? A GLU 89 CG 18 1 Y 1 A GLU 89 ? CD ? A GLU 89 CD 19 1 Y 1 A GLU 89 ? OE1 ? A GLU 89 OE1 20 1 Y 1 A GLU 89 ? OE2 ? A GLU 89 OE2 21 1 Y 1 A GLU 90 ? CG ? A GLU 90 CG 22 1 Y 1 A GLU 90 ? CD ? A GLU 90 CD 23 1 Y 1 A GLU 90 ? OE1 ? A GLU 90 OE1 24 1 Y 1 A GLU 90 ? OE2 ? A GLU 90 OE2 25 1 Y 1 A ASP 91 ? CG ? A ASP 91 CG 26 1 Y 1 A ASP 91 ? OD1 ? A ASP 91 OD1 27 1 Y 1 A ASP 91 ? OD2 ? A ASP 91 OD2 28 1 Y 1 A GLN 93 ? CG ? A GLN 93 CG 29 1 Y 1 A GLN 93 ? CD ? A GLN 93 CD 30 1 Y 1 A GLN 93 ? OE1 ? A GLN 93 OE1 31 1 Y 1 A GLN 93 ? NE2 ? A GLN 93 NE2 32 1 Y 1 A HIS 137 ? CG ? A HIS 137 CG 33 1 Y 1 A HIS 137 ? ND1 ? A HIS 137 ND1 34 1 Y 1 A HIS 137 ? CD2 ? A HIS 137 CD2 35 1 Y 1 A HIS 137 ? CE1 ? A HIS 137 CE1 36 1 Y 1 A HIS 137 ? NE2 ? A HIS 137 NE2 37 1 Y 1 B ASN 4 ? CG ? B ASN 7 CG 38 1 Y 1 B ASN 4 ? OD1 ? B ASN 7 OD1 39 1 Y 1 B ASN 4 ? ND2 ? B ASN 7 ND2 40 1 Y 1 B ARG 31 ? CG ? B ARG 34 CG 41 1 Y 1 B ARG 31 ? CD ? B ARG 34 CD 42 1 Y 1 B ARG 31 ? NE ? B ARG 34 NE 43 1 Y 1 B ARG 31 ? CZ ? B ARG 34 CZ 44 1 Y 1 B ARG 31 ? NH1 ? B ARG 34 NH1 45 1 Y 1 B ARG 31 ? NH2 ? B ARG 34 NH2 46 1 Y 1 B LYS 35 ? CG ? B LYS 38 CG 47 1 Y 1 B LYS 35 ? CD ? B LYS 38 CD 48 1 Y 1 B LYS 35 ? CE ? B LYS 38 CE 49 1 Y 1 B LYS 35 ? NZ ? B LYS 38 NZ 50 1 Y 1 B ASN 37 ? CG ? B ASN 40 CG 51 1 Y 1 B ASN 37 ? OD1 ? B ASN 40 OD1 52 1 Y 1 B ASN 37 ? ND2 ? B ASN 40 ND2 53 1 Y 1 B ARG 63 ? CG ? B ARG 66 CG 54 1 Y 1 B ARG 63 ? CD ? B ARG 66 CD 55 1 Y 1 B ARG 63 ? NE ? B ARG 66 NE 56 1 Y 1 B ARG 63 ? CZ ? B ARG 66 CZ 57 1 Y 1 B ARG 63 ? NH1 ? B ARG 66 NH1 58 1 Y 1 B ARG 63 ? NH2 ? B ARG 66 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6HN7 _cell.details ? _cell.formula_units_Z ? _cell.length_a 60.523 _cell.length_a_esd ? _cell.length_b 101.004 _cell.length_b_esd ? _cell.length_c 82.627 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6HN7 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6HN7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.73 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.97 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 288 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2M Ammonium Sulfate, 0.1M AcONa pH 5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-03-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9762 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID30B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9762 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID30B _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6HN7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.000 _reflns.d_resolution_low 50.500 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5163 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.500 _reflns.pdbx_Rmerge_I_obs 0.064 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 3 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.076 _reflns.pdbx_Rpim_I_all 0.041 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 18007 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.992 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 3.000 3.180 ? ? 3017 ? ? ? 832 98.700 ? ? ? ? 0.105 ? ? ? ? ? ? ? ? 3.600 ? ? ? 6.700 0.125 0.066 ? 1 1 0.992 ? 9.000 50.500 ? ? 659 ? ? ? 218 95.300 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 3.000 ? ? ? 15.500 0.054 0.030 ? 2 1 0.991 ? # _refine.aniso_B[1][1] -9.5700 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 20.0200 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -10.4600 _refine.B_iso_max 167.100 _refine.B_iso_mean 67.1980 _refine.B_iso_min 20.000 _refine.correlation_coeff_Fo_to_Fc 0.8630 _refine.correlation_coeff_Fo_to_Fc_free 0.8410 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6HN7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.0000 _refine.ls_d_res_low 50.50 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4654 _refine.ls_number_reflns_R_free 509 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.9600 _refine.ls_percent_reflns_R_free 9.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.3143 _refine.ls_R_factor_R_free 0.3321 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.3124 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model '6HLK, 1J9I' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.5770 _refine.pdbx_overall_ESU_R_Free 0.6140 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 0.0100 _refine.overall_SU_ML 0.0000 _refine.overall_SU_R_Cruickshank_DPI 0.5774 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.0000 _refine_hist.d_res_low 50.50 _refine_hist.number_atoms_solvent 20 _refine_hist.number_atoms_total 1604 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 204 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 54.45 _refine_hist.pdbx_number_atoms_protein 1584 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.0000 _refine_ls_shell.d_res_low 3.0780 _refine_ls_shell.number_reflns_all 389 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 38 _refine_ls_shell.number_reflns_R_work 351 _refine_ls_shell.percent_reflns_obs 98.7300 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4310 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3870 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6HN7 _struct.title 'Hijacking the Hijackers: Escherichia coli Pathogenicity Islands Redirect Helper Phage Packaging for Their Own Benefit.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6HN7 _struct_keywords.text 'Redirecting packaging protein, DNA Binding protein, Hetero-dimer, phage interference, Protein complex' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 6HN7 6HN7 ? 1 ? 1 2 UNP TERS_LAMBD P03707 ? 2 ;MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENEKLRREVEELRQASEADLQPG TIEYERHRLTRAQADAQE ; 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6HN7 A 1 ? 153 ? 6HN7 1 ? 153 ? 1 153 2 2 6HN7 B 4 ? 101 ? P03707 1 ? 98 ? 1 98 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 6HN7 ALA B 1 ? UNP P03707 ? ? 'expression tag' -2 1 2 6HN7 ALA B 2 ? UNP P03707 ? ? 'expression tag' -1 2 2 6HN7 ALA B 3 ? UNP P03707 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7620 ? 1 MORE -48 ? 1 'SSA (A^2)' 20040 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'gel filtration' ? 2 1 homology ? 3 1 'light scattering' ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_555 -x,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 41.3135000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 10 ? GLY A 18 ? GLN A 10 GLY A 18 1 ? 9 HELX_P HELX_P2 AA2 ASP A 20 ? LYS A 29 ? ASP A 20 LYS A 29 1 ? 10 HELX_P HELX_P3 AA3 LEU A 47 ? LEU A 63 ? LEU A 47 LEU A 63 1 ? 17 HELX_P HELX_P4 AA4 HIS A 70 ? LEU A 83 ? HIS A 70 LEU A 83 1 ? 14 HELX_P HELX_P5 AA5 SER A 84 ? GLY A 87 ? SER A 84 GLY A 87 5 ? 4 HELX_P HELX_P6 AA6 ASP A 91 ? LEU A 103 ? ASP A 91 LEU A 103 1 ? 13 HELX_P HELX_P7 AA7 GLU A 104 ? GLY A 107 ? GLU A 104 GLY A 107 5 ? 4 HELX_P HELX_P8 AA8 ASP A 111 ? LYS A 135 ? ASP A 111 LYS A 135 1 ? 25 HELX_P HELX_P9 AA9 ASN B 7 ? PHE B 15 ? ASN B 4 PHE B 12 1 ? 9 HELX_P HELX_P10 AB1 ILE B 19 ? GLN B 28 ? ILE B 16 GLN B 25 1 ? 10 HELX_P HELX_P11 AB2 SER B 46 ? GLU B 70 ? SER B 43 GLU B 67 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 37 A . ? GLY 37 A ASP 38 A ? ASP 38 A 1 0.20 2 LYS 41 A . ? LYS 41 A PRO 42 A ? PRO 42 A 1 0.04 3 ARG 34 B . ? ARG 31 B GLY 35 B ? GLY 32 B 1 0.04 4 GLY 35 B . ? GLY 32 B GLY 36 B ? GLY 33 B 1 -0.02 5 GLY 36 B . ? GLY 33 B GLY 37 B ? GLY 34 B 1 0.06 6 ASN 40 B . ? ASN 37 B GLU 41 B ? GLU 38 B 1 -0.05 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 7 ? SER A 9 ? PHE A 7 SER A 9 AA1 2 ARG A 44 ? GLN A 46 ? ARG A 44 GLN A 46 AA2 1 GLU B 5 ? VAL B 6 ? GLU B 2 VAL B 3 AA2 2 TYR B 44 ? ASP B 45 ? TYR B 41 ASP B 42 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 8 ? N LEU A 8 O TYR A 45 ? O TYR A 45 AA2 1 2 N VAL B 6 ? N VAL B 3 O TYR B 44 ? O TYR B 41 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 19 ? ? -122.82 -160.44 2 1 ASP A 20 ? ? -122.41 -164.92 3 1 LYS A 39 ? ? -179.04 -174.93 4 1 PRO A 42 ? ? 137.54 114.76 5 1 MET A 85 ? ? -86.75 30.10 6 1 GLU A 89 ? ? -108.50 -155.83 7 1 GLU A 90 ? ? -82.32 -77.24 8 1 ILE A 105 ? ? -58.06 0.81 9 1 PRO A 110 ? ? -57.77 -5.66 10 1 ARG B 31 ? ? -175.94 130.98 11 1 LYS B 35 ? ? -143.23 -155.12 12 1 GLU B 67 ? ? -64.09 8.01 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 213 ? 6.79 . 2 1 O ? A HOH 214 ? 8.11 . 3 1 O ? A HOH 215 ? 9.40 . 4 1 O ? A HOH 216 ? 9.49 . 5 1 O ? A HOH 217 ? 11.66 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A LYS 4 ? A LYS 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A THR 138 ? A THR 138 7 1 Y 1 A ASN 139 ? A ASN 139 8 1 Y 1 A GLU 140 ? A GLU 140 9 1 Y 1 A ASN 141 ? A ASN 141 10 1 Y 1 A LYS 142 ? A LYS 142 11 1 Y 1 A LYS 143 ? A LYS 143 12 1 Y 1 A LYS 144 ? A LYS 144 13 1 Y 1 A ARG 145 ? A ARG 145 14 1 Y 1 A LYS 146 ? A LYS 146 15 1 Y 1 A LEU 147 ? A LEU 147 16 1 Y 1 A ILE 148 ? A ILE 148 17 1 Y 1 A ARG 149 ? A ARG 149 18 1 Y 1 A GLN 150 ? A GLN 150 19 1 Y 1 A ASN 151 ? A ASN 151 20 1 Y 1 A ASP 152 ? A ASP 152 21 1 Y 1 A THR 153 ? A THR 153 22 1 Y 1 B ARG 70 ? B ARG 73 23 1 Y 1 B GLN 71 ? B GLN 74 24 1 Y 1 B ALA 72 ? B ALA 75 25 1 Y 1 B SER 73 ? B SER 76 26 1 Y 1 B GLU 74 ? B GLU 77 27 1 Y 1 B ALA 75 ? B ALA 78 28 1 Y 1 B ASP 76 ? B ASP 79 29 1 Y 1 B LEU 77 ? B LEU 80 30 1 Y 1 B GLN 78 ? B GLN 81 31 1 Y 1 B PRO 79 ? B PRO 82 32 1 Y 1 B GLY 80 ? B GLY 83 33 1 Y 1 B THR 81 ? B THR 84 34 1 Y 1 B ILE 82 ? B ILE 85 35 1 Y 1 B GLU 83 ? B GLU 86 36 1 Y 1 B TYR 84 ? B TYR 87 37 1 Y 1 B GLU 85 ? B GLU 88 38 1 Y 1 B ARG 86 ? B ARG 89 39 1 Y 1 B HIS 87 ? B HIS 90 40 1 Y 1 B ARG 88 ? B ARG 91 41 1 Y 1 B LEU 89 ? B LEU 92 42 1 Y 1 B THR 90 ? B THR 93 43 1 Y 1 B ARG 91 ? B ARG 94 44 1 Y 1 B ALA 92 ? B ALA 95 45 1 Y 1 B GLN 93 ? B GLN 96 46 1 Y 1 B ALA 94 ? B ALA 97 47 1 Y 1 B ASP 95 ? B ASP 98 48 1 Y 1 B ALA 96 ? B ALA 99 49 1 Y 1 B GLN 97 ? B GLN 100 50 1 Y 1 B GLU 98 ? B GLU 101 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'European Research Council' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 670932 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_initial_refinement_model.id _pdbx_initial_refinement_model.entity_id_list _pdbx_initial_refinement_model.type _pdbx_initial_refinement_model.source_name _pdbx_initial_refinement_model.accession_code _pdbx_initial_refinement_model.details 1 ? 'experimental model' PDB 6HLK '6HLK, 1J9I' 2 ? 'experimental model' PDB 1J9I '6HLK, 1J9I' # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 6HN7 _atom_sites.fract_transf_matrix[1][1] 0.016523 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009901 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012103 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.pdbx_scat_Cromer_Mann_a5 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.pdbx_scat_Cromer_Mann_b5 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 2.65751 1.07808 1.49091 -4.24107 0.71379 14.78076 0.77678 42.08684 -0.00029 0.23954 4.29798316956 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 11.89378 3.27748 1.85809 0.85893 0.91299 0.00016 10.23272 30.34469 0.65606 0.21729 -11.8049020767 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 2.96043 2.50882 0.63785 0.72284 1.14276 14.18226 5.93686 0.11273 34.95848 0.39024 0.0270140003413 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 6.37216 5.15457 1.47373 1.63507 1.20937 1.51435 22.09253 0.06137 55.44518 0.64692 0.154722005129 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_