data_6HR0 # _entry.id 6HR0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6HR0 pdb_00006hr0 10.2210/pdb6hr0/pdb WWPDB D_1200012102 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-10-16 2 'Structure model' 1 1 2024-01-24 3 'Structure model' 1 2 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' struct_conn 6 2 'Structure model' struct_conn_type 7 3 'Structure model' pdbx_entry_details 8 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_struct_conn.conn_type_id' 4 2 'Structure model' '_struct_conn.id' 5 2 'Structure model' '_struct_conn.pdbx_dist_value' 6 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 8 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 9 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 2 'Structure model' '_struct_conn_type.id' 16 3 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6HR0 _pdbx_database_status.recvd_initial_deposition_date 2018-09-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Trindade, I.B.' 1 ? 'Moe, E.' 2 ? 'Matias, P.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Frontiers in Energy Research' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2296-598X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Optimizing electroactive organisms: the effect of orthologous proteins' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3389/fenrg.2019.00002 _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fonseca, B.M.' 1 ? primary 'Silva, L.' 2 ? primary 'Trindade, I.B.' 3 ? primary 'Moe, E.' 4 ? primary 'Matias, P.M.' 5 ? primary 'Louro, R.O.' 6 ? primary 'Paquete, C.M.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cytochrome C' 9593.382 1 ? ? ? ? 2 non-polymer syn 'HEME C' 618.503 4 ? ? ? ? 3 non-polymer syn 'PHOSPHITE ION' 78.972 1 ? ? ? ? 4 water nat water 18.015 161 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EDQKLSDFHADMGGCESCHADGSPSADGAYEFEQCQSCHGSLAEMDAVHKPHDGALMCADCHAPHDMNVGQKPTCDSCHD DGRTSDSVLK ; _entity_poly.pdbx_seq_one_letter_code_can ;EDQKLSDFHADMGGCESCHADGSPSADGAYEFEQCQSCHGSLAEMDAVHKPHDGALMCADCHAPHDMNVGQKPTCDSCHD DGRTSDSVLK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'HEME C' HEC 3 'PHOSPHITE ION' PO3 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ASP n 1 3 GLN n 1 4 LYS n 1 5 LEU n 1 6 SER n 1 7 ASP n 1 8 PHE n 1 9 HIS n 1 10 ALA n 1 11 ASP n 1 12 MET n 1 13 GLY n 1 14 GLY n 1 15 CYS n 1 16 GLU n 1 17 SER n 1 18 CYS n 1 19 HIS n 1 20 ALA n 1 21 ASP n 1 22 GLY n 1 23 SER n 1 24 PRO n 1 25 SER n 1 26 ALA n 1 27 ASP n 1 28 GLY n 1 29 ALA n 1 30 TYR n 1 31 GLU n 1 32 PHE n 1 33 GLU n 1 34 GLN n 1 35 CYS n 1 36 GLN n 1 37 SER n 1 38 CYS n 1 39 HIS n 1 40 GLY n 1 41 SER n 1 42 LEU n 1 43 ALA n 1 44 GLU n 1 45 MET n 1 46 ASP n 1 47 ALA n 1 48 VAL n 1 49 HIS n 1 50 LYS n 1 51 PRO n 1 52 HIS n 1 53 ASP n 1 54 GLY n 1 55 ALA n 1 56 LEU n 1 57 MET n 1 58 CYS n 1 59 ALA n 1 60 ASP n 1 61 CYS n 1 62 HIS n 1 63 ALA n 1 64 PRO n 1 65 HIS n 1 66 ASP n 1 67 MET n 1 68 ASN n 1 69 VAL n 1 70 GLY n 1 71 GLN n 1 72 LYS n 1 73 PRO n 1 74 THR n 1 75 CYS n 1 76 ASP n 1 77 SER n 1 78 CYS n 1 79 HIS n 1 80 ASP n 1 81 ASP n 1 82 GLY n 1 83 ARG n 1 84 THR n 1 85 SER n 1 86 ASP n 1 87 SER n 1 88 VAL n 1 89 LEU n 1 90 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 90 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene EEY24_16120 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Shewanella algae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 38313 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 700550 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Shewanella algae' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 38313 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc 700550 _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO3 non-polymer . 'PHOSPHITE ION' ? 'O3 P -3' 78.972 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 MET 67 67 67 MET MET A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LYS 90 90 90 LYS LYS A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HEC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HEC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEC 1 101 101 HEC HE9 A . C 2 HEC 1 102 102 HEC HE9 A . D 2 HEC 1 103 103 HEC HE9 A . E 2 HEC 1 104 104 HEC HE9 A . F 3 PO3 1 105 1 PO3 PO3 A . G 4 HOH 1 201 171 HOH HOH A . G 4 HOH 2 202 27 HOH HOH A . G 4 HOH 3 203 106 HOH HOH A . G 4 HOH 4 204 100 HOH HOH A . G 4 HOH 5 205 127 HOH HOH A . G 4 HOH 6 206 162 HOH HOH A . G 4 HOH 7 207 103 HOH HOH A . G 4 HOH 8 208 73 HOH HOH A . G 4 HOH 9 209 173 HOH HOH A . G 4 HOH 10 210 66 HOH HOH A . G 4 HOH 11 211 116 HOH HOH A . G 4 HOH 12 212 47 HOH HOH A . G 4 HOH 13 213 113 HOH HOH A . G 4 HOH 14 214 19 HOH HOH A . G 4 HOH 15 215 155 HOH HOH A . G 4 HOH 16 216 97 HOH HOH A . G 4 HOH 17 217 140 HOH HOH A . G 4 HOH 18 218 36 HOH HOH A . G 4 HOH 19 219 33 HOH HOH A . G 4 HOH 20 220 69 HOH HOH A . G 4 HOH 21 221 28 HOH HOH A . G 4 HOH 22 222 95 HOH HOH A . G 4 HOH 23 223 149 HOH HOH A . G 4 HOH 24 224 59 HOH HOH A . G 4 HOH 25 225 107 HOH HOH A . G 4 HOH 26 226 131 HOH HOH A . G 4 HOH 27 227 15 HOH HOH A . G 4 HOH 28 228 30 HOH HOH A . G 4 HOH 29 229 4 HOH HOH A . G 4 HOH 30 230 99 HOH HOH A . G 4 HOH 31 231 136 HOH HOH A . G 4 HOH 32 232 37 HOH HOH A . G 4 HOH 33 233 80 HOH HOH A . G 4 HOH 34 234 88 HOH HOH A . G 4 HOH 35 235 39 HOH HOH A . G 4 HOH 36 236 81 HOH HOH A . G 4 HOH 37 237 8 HOH HOH A . G 4 HOH 38 238 67 HOH HOH A . G 4 HOH 39 239 18 HOH HOH A . G 4 HOH 40 240 82 HOH HOH A . G 4 HOH 41 241 115 HOH HOH A . G 4 HOH 42 242 29 HOH HOH A . G 4 HOH 43 243 43 HOH HOH A . G 4 HOH 44 244 10 HOH HOH A . G 4 HOH 45 245 151 HOH HOH A . G 4 HOH 46 246 14 HOH HOH A . G 4 HOH 47 247 42 HOH HOH A . G 4 HOH 48 248 87 HOH HOH A . G 4 HOH 49 249 35 HOH HOH A . G 4 HOH 50 250 145 HOH HOH A . G 4 HOH 51 251 6 HOH HOH A . G 4 HOH 52 252 63 HOH HOH A . G 4 HOH 53 253 21 HOH HOH A . G 4 HOH 54 254 2 HOH HOH A . G 4 HOH 55 255 111 HOH HOH A . G 4 HOH 56 256 3 HOH HOH A . G 4 HOH 57 257 38 HOH HOH A . G 4 HOH 58 258 75 HOH HOH A . G 4 HOH 59 259 77 HOH HOH A . G 4 HOH 60 260 144 HOH HOH A . G 4 HOH 61 261 13 HOH HOH A . G 4 HOH 62 262 40 HOH HOH A . G 4 HOH 63 263 74 HOH HOH A . G 4 HOH 64 264 101 HOH HOH A . G 4 HOH 65 265 46 HOH HOH A . G 4 HOH 66 266 161 HOH HOH A . G 4 HOH 67 267 52 HOH HOH A . G 4 HOH 68 268 108 HOH HOH A . G 4 HOH 69 269 34 HOH HOH A . G 4 HOH 70 270 78 HOH HOH A . G 4 HOH 71 271 61 HOH HOH A . G 4 HOH 72 272 135 HOH HOH A . G 4 HOH 73 273 165 HOH HOH A . G 4 HOH 74 274 17 HOH HOH A . G 4 HOH 75 275 7 HOH HOH A . G 4 HOH 76 276 22 HOH HOH A . G 4 HOH 77 277 96 HOH HOH A . G 4 HOH 78 278 79 HOH HOH A . G 4 HOH 79 279 83 HOH HOH A . G 4 HOH 80 280 50 HOH HOH A . G 4 HOH 81 281 133 HOH HOH A . G 4 HOH 82 282 72 HOH HOH A . G 4 HOH 83 283 31 HOH HOH A . G 4 HOH 84 284 26 HOH HOH A . G 4 HOH 85 285 16 HOH HOH A . G 4 HOH 86 286 48 HOH HOH A . G 4 HOH 87 287 1 HOH HOH A . G 4 HOH 88 288 24 HOH HOH A . G 4 HOH 89 289 54 HOH HOH A . G 4 HOH 90 290 119 HOH HOH A . G 4 HOH 91 291 12 HOH HOH A . G 4 HOH 92 292 112 HOH HOH A . G 4 HOH 93 293 142 HOH HOH A . G 4 HOH 94 294 92 HOH HOH A . G 4 HOH 95 295 41 HOH HOH A . G 4 HOH 96 296 60 HOH HOH A . G 4 HOH 97 297 86 HOH HOH A . G 4 HOH 98 298 53 HOH HOH A . G 4 HOH 99 299 9 HOH HOH A . G 4 HOH 100 300 45 HOH HOH A . G 4 HOH 101 301 71 HOH HOH A . G 4 HOH 102 302 120 HOH HOH A . G 4 HOH 103 303 146 HOH HOH A . G 4 HOH 104 304 5 HOH HOH A . G 4 HOH 105 305 62 HOH HOH A . G 4 HOH 106 306 64 HOH HOH A . G 4 HOH 107 307 91 HOH HOH A . G 4 HOH 108 308 44 HOH HOH A . G 4 HOH 109 309 25 HOH HOH A . G 4 HOH 110 310 89 HOH HOH A . G 4 HOH 111 311 105 HOH HOH A . G 4 HOH 112 312 11 HOH HOH A . G 4 HOH 113 313 148 HOH HOH A . G 4 HOH 114 314 94 HOH HOH A . G 4 HOH 115 315 23 HOH HOH A . G 4 HOH 116 316 152 HOH HOH A . G 4 HOH 117 317 51 HOH HOH A . G 4 HOH 118 318 137 HOH HOH A . G 4 HOH 119 319 128 HOH HOH A . G 4 HOH 120 320 150 HOH HOH A . G 4 HOH 121 321 109 HOH HOH A . G 4 HOH 122 322 104 HOH HOH A . G 4 HOH 123 323 85 HOH HOH A . G 4 HOH 124 324 139 HOH HOH A . G 4 HOH 125 325 49 HOH HOH A . G 4 HOH 126 326 172 HOH HOH A . G 4 HOH 127 327 147 HOH HOH A . G 4 HOH 128 328 98 HOH HOH A . G 4 HOH 129 329 102 HOH HOH A . G 4 HOH 130 330 55 HOH HOH A . G 4 HOH 131 331 124 HOH HOH A . G 4 HOH 132 332 126 HOH HOH A . G 4 HOH 133 333 154 HOH HOH A . G 4 HOH 134 334 129 HOH HOH A . G 4 HOH 135 335 159 HOH HOH A . G 4 HOH 136 336 167 HOH HOH A . G 4 HOH 137 337 125 HOH HOH A . G 4 HOH 138 338 57 HOH HOH A . G 4 HOH 139 339 164 HOH HOH A . G 4 HOH 140 340 58 HOH HOH A . G 4 HOH 141 341 93 HOH HOH A . G 4 HOH 142 342 68 HOH HOH A . G 4 HOH 143 343 56 HOH HOH A . G 4 HOH 144 344 157 HOH HOH A . G 4 HOH 145 345 84 HOH HOH A . G 4 HOH 146 346 76 HOH HOH A . G 4 HOH 147 347 132 HOH HOH A . G 4 HOH 148 348 65 HOH HOH A . G 4 HOH 149 349 143 HOH HOH A . G 4 HOH 150 350 32 HOH HOH A . G 4 HOH 151 351 134 HOH HOH A . G 4 HOH 152 352 153 HOH HOH A . G 4 HOH 153 353 138 HOH HOH A . G 4 HOH 154 354 141 HOH HOH A . G 4 HOH 155 355 170 HOH HOH A . G 4 HOH 156 356 110 HOH HOH A . G 4 HOH 157 357 114 HOH HOH A . G 4 HOH 158 358 20 HOH HOH A . G 4 HOH 159 359 117 HOH HOH A . G 4 HOH 160 360 121 HOH HOH A . G 4 HOH 161 361 118 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.14_3260: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6HR0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.171 _cell.length_a_esd ? _cell.length_b 66.171 _cell.length_b_esd ? _cell.length_c 43.236 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6HR0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6HR0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.47 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.5 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Bicine pH 8.5 and 3.7 M Ammonium Sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'PSI PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-30 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97950 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97950 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6HR0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.040 _reflns.d_resolution_low 26.27 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 44836 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.20 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.04 _reflns_shell.d_res_low 1.07 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2412 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.386 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6HR0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.04 _refine.ls_d_res_low 26.27 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 44915 _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.1778 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1525 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1M1P _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 661 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 176 _refine_hist.number_atoms_solvent 161 _refine_hist.number_atoms_total 998 _refine_hist.d_res_high 1.04 _refine_hist.d_res_low 26.27 # _struct.entry_id 6HR0 _struct.title 'Optimizing electroactive organisms: the effect of orthologous proteins' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6HR0 _struct_keywords.text ;extracellular electron transfer, Shewanella, small tetraheme cytochrome, microbial fuel cells, methyl orange, ortholog proteins, ELECTRON TRANSPORT ; _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? G N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A2T3H499_9GAMM _struct_ref.pdbx_db_accession A0A2T3H499 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EDQKLSDFHADMGGCESCHADGSPSADGAYEFEQCQSCHGSLAEMDAVHKPHDGALMCADCHAPHDMNVGQKPTCDSCHD DGRTSDSVLK ; _struct_ref.pdbx_align_begin 26 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6HR0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 90 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A2T3H499 _struct_ref_seq.db_align_beg 26 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 115 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 90 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4190 ? 1 MORE -77 ? 1 'SSA (A^2)' 5800 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 4 ? GLY A 14 ? LYS A 4 GLY A 14 1 ? 11 HELX_P HELX_P2 AA2 CYS A 15 ? CYS A 18 ? CYS A 15 CYS A 18 5 ? 4 HELX_P HELX_P3 AA3 HIS A 19 ? SER A 23 ? HIS A 19 SER A 23 5 ? 5 HELX_P HELX_P4 AA4 GLY A 28 ? GLY A 40 ? GLY A 28 GLY A 40 1 ? 13 HELX_P HELX_P5 AA5 SER A 41 ? MET A 45 ? SER A 41 MET A 45 5 ? 5 HELX_P HELX_P6 AA6 HIS A 49 ? ASP A 53 ? HIS A 49 ASP A 53 5 ? 5 HELX_P HELX_P7 AA7 MET A 57 ? HIS A 62 ? MET A 57 HIS A 62 1 ? 6 HELX_P HELX_P8 AA8 THR A 74 ? CYS A 78 ? THR A 74 CYS A 78 5 ? 5 HELX_P HELX_P9 AA9 THR A 84 ? LYS A 90 ? THR A 84 LYS A 90 5 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 15 SG ? ? ? 1_555 D HEC . CAB ? ? A CYS 15 A HEC 103 1_555 ? ? ? ? ? ? ? 1.738 ? ? covale2 covale none ? A CYS 18 SG ? ? ? 1_555 D HEC . CAC ? ? A CYS 18 A HEC 103 1_555 ? ? ? ? ? ? ? 1.838 ? ? covale3 covale none ? A CYS 35 SG ? ? ? 1_555 E HEC . CAB ? ? A CYS 35 A HEC 104 1_555 ? ? ? ? ? ? ? 1.845 ? ? covale4 covale none ? A CYS 38 SG ? ? ? 1_555 E HEC . CAC ? ? A CYS 38 A HEC 104 1_555 ? ? ? ? ? ? ? 1.858 ? ? covale5 covale none ? A CYS 58 SG ? ? ? 1_555 B HEC . CAB ? ? A CYS 58 A HEC 101 1_555 ? ? ? ? ? ? ? 1.751 ? ? covale6 covale none ? A CYS 61 SG ? ? ? 1_555 B HEC . CAC ? ? A CYS 61 A HEC 101 1_555 ? ? ? ? ? ? ? 1.864 ? ? covale7 covale none ? A CYS 75 SG ? ? ? 1_555 C HEC . CAB ? ? A CYS 75 A HEC 102 1_555 ? ? ? ? ? ? ? 1.832 ? ? covale8 covale none ? A CYS 78 SG ? ? ? 1_555 C HEC . CAC ? ? A CYS 78 A HEC 102 1_555 ? ? ? ? ? ? ? 1.838 ? ? metalc1 metalc ? ? A HIS 9 NE2 ? ? ? 1_555 E HEC . FE ? ? A HIS 9 A HEC 104 1_555 ? ? ? ? ? ? ? 2.011 ? ? metalc2 metalc ? ? A HIS 19 NE2 ? ? ? 1_555 D HEC . FE ? ? A HIS 19 A HEC 103 1_555 ? ? ? ? ? ? ? 1.996 ? ? metalc3 metalc ? ? A HIS 39 NE2 ? ? ? 1_555 E HEC . FE ? ? A HIS 39 A HEC 104 1_555 ? ? ? ? ? ? ? 1.984 ? ? metalc4 metalc ? ? A HIS 49 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 49 A HEC 101 1_555 ? ? ? ? ? ? ? 1.994 ? ? metalc5 metalc ? ? A HIS 52 NE2 ? ? ? 1_555 C HEC . FE ? ? A HIS 52 A HEC 102 1_555 ? ? ? ? ? ? ? 2.000 ? ? metalc6 metalc ? ? A HIS 62 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 62 A HEC 101 1_555 ? ? ? ? ? ? ? 1.991 ? ? metalc7 metalc ? ? A HIS 65 NE2 ? ? ? 1_555 D HEC . FE ? ? A HIS 65 A HEC 103 1_555 ? ? ? ? ? ? ? 2.012 ? ? metalc8 metalc ? ? A HIS 79 NE2 ? ? ? 1_555 C HEC . FE ? ? A HIS 79 A HEC 102 1_555 ? ? ? ? ? ? ? 2.002 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 9 ? A HIS 9 ? 1_555 FE ? E HEC . ? A HEC 104 ? 1_555 NA ? E HEC . ? A HEC 104 ? 1_555 90.7 ? 2 NE2 ? A HIS 9 ? A HIS 9 ? 1_555 FE ? E HEC . ? A HEC 104 ? 1_555 NB ? E HEC . ? A HEC 104 ? 1_555 88.4 ? 3 NA ? E HEC . ? A HEC 104 ? 1_555 FE ? E HEC . ? A HEC 104 ? 1_555 NB ? E HEC . ? A HEC 104 ? 1_555 90.3 ? 4 NE2 ? A HIS 9 ? A HIS 9 ? 1_555 FE ? E HEC . ? A HEC 104 ? 1_555 NC ? E HEC . ? A HEC 104 ? 1_555 88.6 ? 5 NA ? E HEC . ? A HEC 104 ? 1_555 FE ? E HEC . ? A HEC 104 ? 1_555 NC ? E HEC . ? A HEC 104 ? 1_555 179.2 ? 6 NB ? E HEC . ? A HEC 104 ? 1_555 FE ? E HEC . ? A HEC 104 ? 1_555 NC ? E HEC . ? A HEC 104 ? 1_555 89.8 ? 7 NE2 ? A HIS 9 ? A HIS 9 ? 1_555 FE ? E HEC . ? A HEC 104 ? 1_555 ND ? E HEC . ? A HEC 104 ? 1_555 92.0 ? 8 NA ? E HEC . ? A HEC 104 ? 1_555 FE ? E HEC . ? A HEC 104 ? 1_555 ND ? E HEC . ? A HEC 104 ? 1_555 89.6 ? 9 NB ? E HEC . ? A HEC 104 ? 1_555 FE ? E HEC . ? A HEC 104 ? 1_555 ND ? E HEC . ? A HEC 104 ? 1_555 179.5 ? 10 NC ? E HEC . ? A HEC 104 ? 1_555 FE ? E HEC . ? A HEC 104 ? 1_555 ND ? E HEC . ? A HEC 104 ? 1_555 90.3 ? 11 NE2 ? A HIS 9 ? A HIS 9 ? 1_555 FE ? E HEC . ? A HEC 104 ? 1_555 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 178.8 ? 12 NA ? E HEC . ? A HEC 104 ? 1_555 FE ? E HEC . ? A HEC 104 ? 1_555 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 89.7 ? 13 NB ? E HEC . ? A HEC 104 ? 1_555 FE ? E HEC . ? A HEC 104 ? 1_555 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 90.5 ? 14 NC ? E HEC . ? A HEC 104 ? 1_555 FE ? E HEC . ? A HEC 104 ? 1_555 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 91.0 ? 15 ND ? E HEC . ? A HEC 104 ? 1_555 FE ? E HEC . ? A HEC 104 ? 1_555 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 89.1 ? 16 NE2 ? A HIS 19 ? A HIS 19 ? 1_555 FE ? D HEC . ? A HEC 103 ? 1_555 NA ? D HEC . ? A HEC 103 ? 1_555 92.5 ? 17 NE2 ? A HIS 19 ? A HIS 19 ? 1_555 FE ? D HEC . ? A HEC 103 ? 1_555 NB ? D HEC . ? A HEC 103 ? 1_555 91.4 ? 18 NA ? D HEC . ? A HEC 103 ? 1_555 FE ? D HEC . ? A HEC 103 ? 1_555 NB ? D HEC . ? A HEC 103 ? 1_555 90.7 ? 19 NE2 ? A HIS 19 ? A HIS 19 ? 1_555 FE ? D HEC . ? A HEC 103 ? 1_555 NC ? D HEC . ? A HEC 103 ? 1_555 86.7 ? 20 NA ? D HEC . ? A HEC 103 ? 1_555 FE ? D HEC . ? A HEC 103 ? 1_555 NC ? D HEC . ? A HEC 103 ? 1_555 179.0 ? 21 NB ? D HEC . ? A HEC 103 ? 1_555 FE ? D HEC . ? A HEC 103 ? 1_555 NC ? D HEC . ? A HEC 103 ? 1_555 89.9 ? 22 NE2 ? A HIS 19 ? A HIS 19 ? 1_555 FE ? D HEC . ? A HEC 103 ? 1_555 ND ? D HEC . ? A HEC 103 ? 1_555 86.5 ? 23 NA ? D HEC . ? A HEC 103 ? 1_555 FE ? D HEC . ? A HEC 103 ? 1_555 ND ? D HEC . ? A HEC 103 ? 1_555 88.8 ? 24 NB ? D HEC . ? A HEC 103 ? 1_555 FE ? D HEC . ? A HEC 103 ? 1_555 ND ? D HEC . ? A HEC 103 ? 1_555 177.8 ? 25 NC ? D HEC . ? A HEC 103 ? 1_555 FE ? D HEC . ? A HEC 103 ? 1_555 ND ? D HEC . ? A HEC 103 ? 1_555 90.6 ? 26 NE2 ? A HIS 19 ? A HIS 19 ? 1_555 FE ? D HEC . ? A HEC 103 ? 1_555 NE2 ? A HIS 65 ? A HIS 65 ? 1_555 178.4 ? 27 NA ? D HEC . ? A HEC 103 ? 1_555 FE ? D HEC . ? A HEC 103 ? 1_555 NE2 ? A HIS 65 ? A HIS 65 ? 1_555 86.3 ? 28 NB ? D HEC . ? A HEC 103 ? 1_555 FE ? D HEC . ? A HEC 103 ? 1_555 NE2 ? A HIS 65 ? A HIS 65 ? 1_555 89.6 ? 29 NC ? D HEC . ? A HEC 103 ? 1_555 FE ? D HEC . ? A HEC 103 ? 1_555 NE2 ? A HIS 65 ? A HIS 65 ? 1_555 94.6 ? 30 ND ? D HEC . ? A HEC 103 ? 1_555 FE ? D HEC . ? A HEC 103 ? 1_555 NE2 ? A HIS 65 ? A HIS 65 ? 1_555 92.5 ? 31 NE2 ? A HIS 49 ? A HIS 49 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NA ? B HEC . ? A HEC 101 ? 1_555 94.0 ? 32 NE2 ? A HIS 49 ? A HIS 49 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NB ? B HEC . ? A HEC 101 ? 1_555 92.0 ? 33 NA ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NB ? B HEC . ? A HEC 101 ? 1_555 90.4 ? 34 NE2 ? A HIS 49 ? A HIS 49 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NC ? B HEC . ? A HEC 101 ? 1_555 87.2 ? 35 NA ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NC ? B HEC . ? A HEC 101 ? 1_555 178.6 ? 36 NB ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NC ? B HEC . ? A HEC 101 ? 1_555 88.8 ? 37 NE2 ? A HIS 49 ? A HIS 49 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 ND ? B HEC . ? A HEC 101 ? 1_555 88.7 ? 38 NA ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 ND ? B HEC . ? A HEC 101 ? 1_555 89.6 ? 39 NB ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 ND ? B HEC . ? A HEC 101 ? 1_555 179.3 ? 40 NC ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 ND ? B HEC . ? A HEC 101 ? 1_555 91.2 ? 41 NE2 ? A HIS 49 ? A HIS 49 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NE2 ? A HIS 62 ? A HIS 62 ? 1_555 175.7 ? 42 NA ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NE2 ? A HIS 62 ? A HIS 62 ? 1_555 90.0 ? 43 NB ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NE2 ? A HIS 62 ? A HIS 62 ? 1_555 89.5 ? 44 NC ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NE2 ? A HIS 62 ? A HIS 62 ? 1_555 88.8 ? 45 ND ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NE2 ? A HIS 62 ? A HIS 62 ? 1_555 89.8 ? 46 NE2 ? A HIS 52 ? A HIS 52 ? 1_555 FE ? C HEC . ? A HEC 102 ? 1_555 NA ? C HEC . ? A HEC 102 ? 1_555 86.2 ? 47 NE2 ? A HIS 52 ? A HIS 52 ? 1_555 FE ? C HEC . ? A HEC 102 ? 1_555 NB ? C HEC . ? A HEC 102 ? 1_555 90.2 ? 48 NA ? C HEC . ? A HEC 102 ? 1_555 FE ? C HEC . ? A HEC 102 ? 1_555 NB ? C HEC . ? A HEC 102 ? 1_555 90.2 ? 49 NE2 ? A HIS 52 ? A HIS 52 ? 1_555 FE ? C HEC . ? A HEC 102 ? 1_555 NC ? C HEC . ? A HEC 102 ? 1_555 92.1 ? 50 NA ? C HEC . ? A HEC 102 ? 1_555 FE ? C HEC . ? A HEC 102 ? 1_555 NC ? C HEC . ? A HEC 102 ? 1_555 178.3 ? 51 NB ? C HEC . ? A HEC 102 ? 1_555 FE ? C HEC . ? A HEC 102 ? 1_555 NC ? C HEC . ? A HEC 102 ? 1_555 90.4 ? 52 NE2 ? A HIS 52 ? A HIS 52 ? 1_555 FE ? C HEC . ? A HEC 102 ? 1_555 ND ? C HEC . ? A HEC 102 ? 1_555 90.7 ? 53 NA ? C HEC . ? A HEC 102 ? 1_555 FE ? C HEC . ? A HEC 102 ? 1_555 ND ? C HEC . ? A HEC 102 ? 1_555 89.6 ? 54 NB ? C HEC . ? A HEC 102 ? 1_555 FE ? C HEC . ? A HEC 102 ? 1_555 ND ? C HEC . ? A HEC 102 ? 1_555 179.1 ? 55 NC ? C HEC . ? A HEC 102 ? 1_555 FE ? C HEC . ? A HEC 102 ? 1_555 ND ? C HEC . ? A HEC 102 ? 1_555 89.9 ? 56 NE2 ? A HIS 52 ? A HIS 52 ? 1_555 FE ? C HEC . ? A HEC 102 ? 1_555 NE2 ? A HIS 79 ? A HIS 79 ? 1_555 178.7 ? 57 NA ? C HEC . ? A HEC 102 ? 1_555 FE ? C HEC . ? A HEC 102 ? 1_555 NE2 ? A HIS 79 ? A HIS 79 ? 1_555 92.7 ? 58 NB ? C HEC . ? A HEC 102 ? 1_555 FE ? C HEC . ? A HEC 102 ? 1_555 NE2 ? A HIS 79 ? A HIS 79 ? 1_555 89.0 ? 59 NC ? C HEC . ? A HEC 102 ? 1_555 FE ? C HEC . ? A HEC 102 ? 1_555 NE2 ? A HIS 79 ? A HIS 79 ? 1_555 88.9 ? 60 ND ? C HEC . ? A HEC 102 ? 1_555 FE ? C HEC . ? A HEC 102 ? 1_555 NE2 ? A HIS 79 ? A HIS 79 ? 1_555 90.1 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 HEC B . ? CYS A 58 ? HEC A 101 ? 1_555 CYS A 58 ? 1_555 CAB SG CYS 2 HEC None Heme/heme-like 2 HEC B . ? CYS A 61 ? HEC A 101 ? 1_555 CYS A 61 ? 1_555 CAC SG CYS 3 HEC None Heme/heme-like 3 HEC C . ? CYS A 75 ? HEC A 102 ? 1_555 CYS A 75 ? 1_555 CAB SG CYS 2 HEC None Heme/heme-like 4 HEC C . ? CYS A 78 ? HEC A 102 ? 1_555 CYS A 78 ? 1_555 CAC SG CYS 3 HEC None Heme/heme-like 5 HEC D . ? CYS A 15 ? HEC A 103 ? 1_555 CYS A 15 ? 1_555 CAB SG CYS 2 HEC None Heme/heme-like 6 HEC D . ? CYS A 18 ? HEC A 103 ? 1_555 CYS A 18 ? 1_555 CAC SG CYS 3 HEC None Heme/heme-like 7 HEC E . ? CYS A 35 ? HEC A 104 ? 1_555 CYS A 35 ? 1_555 CAB SG CYS 2 HEC None Heme/heme-like 8 HEC E . ? CYS A 38 ? HEC A 104 ? 1_555 CYS A 38 ? 1_555 CAC SG CYS 3 HEC None Heme/heme-like # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A HEC 101 ? 16 'binding site for residue HEC A 101' AC2 Software A HEC 102 ? 20 'binding site for residue HEC A 102' AC3 Software A HEC 103 ? 15 'binding site for residue HEC A 103' AC4 Software A HEC 104 ? 24 'binding site for residue HEC A 104' AC5 Software A PO3 105 ? 4 'binding site for residue PO3 A 105' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 HIS A 39 ? HIS A 39 . ? 1_555 ? 2 AC1 16 LEU A 42 ? LEU A 42 . ? 1_555 ? 3 AC1 16 HIS A 49 ? HIS A 49 . ? 1_555 ? 4 AC1 16 HIS A 52 ? HIS A 52 . ? 1_555 ? 5 AC1 16 CYS A 58 ? CYS A 58 . ? 1_555 ? 6 AC1 16 CYS A 61 ? CYS A 61 . ? 1_555 ? 7 AC1 16 HIS A 62 ? HIS A 62 . ? 1_555 ? 8 AC1 16 PRO A 73 ? PRO A 73 . ? 1_555 ? 9 AC1 16 HEC C . ? HEC A 102 . ? 1_555 ? 10 AC1 16 HEC E . ? HEC A 104 . ? 7_556 ? 11 AC1 16 HEC E . ? HEC A 104 . ? 1_555 ? 12 AC1 16 HOH G . ? HOH A 201 . ? 1_555 ? 13 AC1 16 HOH G . ? HOH A 212 . ? 1_555 ? 14 AC1 16 HOH G . ? HOH A 220 . ? 1_555 ? 15 AC1 16 HOH G . ? HOH A 238 . ? 7_556 ? 16 AC1 16 HOH G . ? HOH A 316 . ? 1_555 ? 17 AC2 20 VAL A 48 ? VAL A 48 . ? 1_555 ? 18 AC2 20 HIS A 52 ? HIS A 52 . ? 1_555 ? 19 AC2 20 ASP A 60 ? ASP A 60 . ? 1_555 ? 20 AC2 20 CYS A 75 ? CYS A 75 . ? 1_555 ? 21 AC2 20 CYS A 78 ? CYS A 78 . ? 1_555 ? 22 AC2 20 HIS A 79 ? HIS A 79 . ? 1_555 ? 23 AC2 20 ARG A 83 ? ARG A 83 . ? 1_555 ? 24 AC2 20 THR A 84 ? THR A 84 . ? 3_544 ? 25 AC2 20 THR A 84 ? THR A 84 . ? 1_555 ? 26 AC2 20 SER A 85 ? SER A 85 . ? 3_544 ? 27 AC2 20 SER A 87 ? SER A 87 . ? 1_555 ? 28 AC2 20 HEC B . ? HEC A 101 . ? 1_555 ? 29 AC2 20 HOH G . ? HOH A 244 . ? 1_555 ? 30 AC2 20 HOH G . ? HOH A 248 . ? 1_555 ? 31 AC2 20 HOH G . ? HOH A 254 . ? 1_555 ? 32 AC2 20 HOH G . ? HOH A 263 . ? 1_555 ? 33 AC2 20 HOH G . ? HOH A 269 . ? 3_544 ? 34 AC2 20 HOH G . ? HOH A 274 . ? 3_544 ? 35 AC2 20 HOH G . ? HOH A 286 . ? 1_555 ? 36 AC2 20 HOH G . ? HOH A 287 . ? 1_555 ? 37 AC3 15 GLU A 1 ? GLU A 1 . ? 3_544 ? 38 AC3 15 SER A 6 ? SER A 6 . ? 1_555 ? 39 AC3 15 HIS A 9 ? HIS A 9 . ? 1_555 ? 40 AC3 15 CYS A 15 ? CYS A 15 . ? 1_555 ? 41 AC3 15 CYS A 18 ? CYS A 18 . ? 1_555 ? 42 AC3 15 HIS A 19 ? HIS A 19 . ? 1_555 ? 43 AC3 15 ASP A 21 ? ASP A 21 . ? 8_556 ? 44 AC3 15 PRO A 24 ? PRO A 24 . ? 1_555 ? 45 AC3 15 ALA A 59 ? ALA A 59 . ? 1_555 ? 46 AC3 15 HIS A 65 ? HIS A 65 . ? 1_555 ? 47 AC3 15 LEU A 89 ? LEU A 89 . ? 3_545 ? 48 AC3 15 HOH G . ? HOH A 214 . ? 1_555 ? 49 AC3 15 HOH G . ? HOH A 223 . ? 3_544 ? 50 AC3 15 HOH G . ? HOH A 255 . ? 1_555 ? 51 AC3 15 HOH G . ? HOH A 265 . ? 1_555 ? 52 AC4 24 PHE A 8 ? PHE A 8 . ? 1_555 ? 53 AC4 24 HIS A 9 ? HIS A 9 . ? 1_555 ? 54 AC4 24 SER A 17 ? SER A 17 . ? 1_555 ? 55 AC4 24 GLN A 34 ? GLN A 34 . ? 1_555 ? 56 AC4 24 CYS A 35 ? CYS A 35 . ? 1_555 ? 57 AC4 24 CYS A 38 ? CYS A 38 . ? 1_555 ? 58 AC4 24 CYS A 38 ? CYS A 38 . ? 7_556 ? 59 AC4 24 HIS A 39 ? HIS A 39 . ? 1_555 ? 60 AC4 24 HIS A 39 ? HIS A 39 . ? 7_556 ? 61 AC4 24 CYS A 58 ? CYS A 58 . ? 1_555 ? 62 AC4 24 HIS A 62 ? HIS A 62 . ? 1_555 ? 63 AC4 24 VAL A 69 ? VAL A 69 . ? 1_555 ? 64 AC4 24 GLY A 70 ? GLY A 70 . ? 1_555 ? 65 AC4 24 HEC B . ? HEC A 101 . ? 1_555 ? 66 AC4 24 HEC B . ? HEC A 101 . ? 7_556 ? 67 AC4 24 HOH G . ? HOH A 221 . ? 1_555 ? 68 AC4 24 HOH G . ? HOH A 227 . ? 1_555 ? 69 AC4 24 HOH G . ? HOH A 236 . ? 1_555 ? 70 AC4 24 HOH G . ? HOH A 237 . ? 1_555 ? 71 AC4 24 HOH G . ? HOH A 238 . ? 1_555 ? 72 AC4 24 HOH G . ? HOH A 252 . ? 1_555 ? 73 AC4 24 HOH G . ? HOH A 271 . ? 1_555 ? 74 AC4 24 HOH G . ? HOH A 294 . ? 1_555 ? 75 AC4 24 HOH G . ? HOH A 301 . ? 1_555 ? 76 AC5 4 GLN A 3 ? GLN A 3 . ? 1_555 ? 77 AC5 4 ASP A 7 ? ASP A 7 . ? 1_555 ? 78 AC5 4 HOH G . ? HOH A 246 . ? 1_555 ? 79 AC5 4 HOH G . ? HOH A 273 . ? 1_555 ? # _pdbx_entry_details.entry_id 6HR0 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 223 ? ? O A HOH 335 ? ? 1.99 2 1 O1D A HEC 101 ? ? O A HOH 201 ? ? 2.02 3 1 O A HOH 205 ? ? O A HOH 234 ? ? 2.07 4 1 O A HOH 319 ? ? O A HOH 339 ? ? 2.10 5 1 OG A SER 77 ? B O A HOH 202 ? ? 2.12 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 310 ? ? 1_555 O A HOH 310 ? ? 8_556 1.89 2 1 O A HOH 320 ? ? 1_555 O A HOH 320 ? ? 7_556 1.90 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 SER _pdbx_validate_rmsd_bond.auth_seq_id_1 17 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 SER _pdbx_validate_rmsd_bond.auth_seq_id_2 17 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.324 _pdbx_validate_rmsd_bond.bond_target_value 1.418 _pdbx_validate_rmsd_bond.bond_deviation -0.094 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.013 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 35 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 35 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 SG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 35 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 121.55 _pdbx_validate_rmsd_angle.angle_target_value 114.20 _pdbx_validate_rmsd_angle.angle_deviation 7.35 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.10 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 21 ? A 56.37 13.75 2 1 ASP A 21 ? B 56.00 -147.45 3 1 CYS A 78 ? ? -138.76 -38.95 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HEC FE FE N N 137 HEC CHA C N N 138 HEC CHB C N N 139 HEC CHC C N N 140 HEC CHD C N N 141 HEC NA N Y N 142 HEC C1A C Y N 143 HEC C2A C Y N 144 HEC C3A C Y N 145 HEC C4A C Y N 146 HEC CMA C N N 147 HEC CAA C N N 148 HEC CBA C N N 149 HEC CGA C N N 150 HEC O1A O N N 151 HEC O2A O N N 152 HEC NB N Y N 153 HEC C1B C Y N 154 HEC C2B C Y N 155 HEC C3B C Y N 156 HEC C4B C Y N 157 HEC CMB C N N 158 HEC CAB C N N 159 HEC CBB C N N 160 HEC NC N Y N 161 HEC C1C C Y N 162 HEC C2C C Y N 163 HEC C3C C Y N 164 HEC C4C C Y N 165 HEC CMC C N N 166 HEC CAC C N N 167 HEC CBC C N N 168 HEC ND N Y N 169 HEC C1D C Y N 170 HEC C2D C Y N 171 HEC C3D C Y N 172 HEC C4D C Y N 173 HEC CMD C N N 174 HEC CAD C N N 175 HEC CBD C N N 176 HEC CGD C N N 177 HEC O1D O N N 178 HEC O2D O N N 179 HEC HHA H N N 180 HEC HHB H N N 181 HEC HHC H N N 182 HEC HHD H N N 183 HEC HMA1 H N N 184 HEC HMA2 H N N 185 HEC HMA3 H N N 186 HEC HAA1 H N N 187 HEC HAA2 H N N 188 HEC HBA1 H N N 189 HEC HBA2 H N N 190 HEC H2A H N N 191 HEC HMB1 H N N 192 HEC HMB2 H N N 193 HEC HMB3 H N N 194 HEC HAB H N N 195 HEC HBB1 H N N 196 HEC HBB2 H N N 197 HEC HBB3 H N N 198 HEC HMC1 H N N 199 HEC HMC2 H N N 200 HEC HMC3 H N N 201 HEC HAC H N N 202 HEC HBC1 H N N 203 HEC HBC2 H N N 204 HEC HBC3 H N N 205 HEC HMD1 H N N 206 HEC HMD2 H N N 207 HEC HMD3 H N N 208 HEC HAD1 H N N 209 HEC HAD2 H N N 210 HEC HBD1 H N N 211 HEC HBD2 H N N 212 HEC H2D H N N 213 HIS N N N N 214 HIS CA C N S 215 HIS C C N N 216 HIS O O N N 217 HIS CB C N N 218 HIS CG C Y N 219 HIS ND1 N Y N 220 HIS CD2 C Y N 221 HIS CE1 C Y N 222 HIS NE2 N Y N 223 HIS OXT O N N 224 HIS H H N N 225 HIS H2 H N N 226 HIS HA H N N 227 HIS HB2 H N N 228 HIS HB3 H N N 229 HIS HD1 H N N 230 HIS HD2 H N N 231 HIS HE1 H N N 232 HIS HE2 H N N 233 HIS HXT H N N 234 HOH O O N N 235 HOH H1 H N N 236 HOH H2 H N N 237 LEU N N N N 238 LEU CA C N S 239 LEU C C N N 240 LEU O O N N 241 LEU CB C N N 242 LEU CG C N N 243 LEU CD1 C N N 244 LEU CD2 C N N 245 LEU OXT O N N 246 LEU H H N N 247 LEU H2 H N N 248 LEU HA H N N 249 LEU HB2 H N N 250 LEU HB3 H N N 251 LEU HG H N N 252 LEU HD11 H N N 253 LEU HD12 H N N 254 LEU HD13 H N N 255 LEU HD21 H N N 256 LEU HD22 H N N 257 LEU HD23 H N N 258 LEU HXT H N N 259 LYS N N N N 260 LYS CA C N S 261 LYS C C N N 262 LYS O O N N 263 LYS CB C N N 264 LYS CG C N N 265 LYS CD C N N 266 LYS CE C N N 267 LYS NZ N N N 268 LYS OXT O N N 269 LYS H H N N 270 LYS H2 H N N 271 LYS HA H N N 272 LYS HB2 H N N 273 LYS HB3 H N N 274 LYS HG2 H N N 275 LYS HG3 H N N 276 LYS HD2 H N N 277 LYS HD3 H N N 278 LYS HE2 H N N 279 LYS HE3 H N N 280 LYS HZ1 H N N 281 LYS HZ2 H N N 282 LYS HZ3 H N N 283 LYS HXT H N N 284 MET N N N N 285 MET CA C N S 286 MET C C N N 287 MET O O N N 288 MET CB C N N 289 MET CG C N N 290 MET SD S N N 291 MET CE C N N 292 MET OXT O N N 293 MET H H N N 294 MET H2 H N N 295 MET HA H N N 296 MET HB2 H N N 297 MET HB3 H N N 298 MET HG2 H N N 299 MET HG3 H N N 300 MET HE1 H N N 301 MET HE2 H N N 302 MET HE3 H N N 303 MET HXT H N N 304 PHE N N N N 305 PHE CA C N S 306 PHE C C N N 307 PHE O O N N 308 PHE CB C N N 309 PHE CG C Y N 310 PHE CD1 C Y N 311 PHE CD2 C Y N 312 PHE CE1 C Y N 313 PHE CE2 C Y N 314 PHE CZ C Y N 315 PHE OXT O N N 316 PHE H H N N 317 PHE H2 H N N 318 PHE HA H N N 319 PHE HB2 H N N 320 PHE HB3 H N N 321 PHE HD1 H N N 322 PHE HD2 H N N 323 PHE HE1 H N N 324 PHE HE2 H N N 325 PHE HZ H N N 326 PHE HXT H N N 327 PO3 P P N N 328 PO3 O1 O N N 329 PO3 O2 O N N 330 PO3 O3 O N N 331 PRO N N N N 332 PRO CA C N S 333 PRO C C N N 334 PRO O O N N 335 PRO CB C N N 336 PRO CG C N N 337 PRO CD C N N 338 PRO OXT O N N 339 PRO H H N N 340 PRO HA H N N 341 PRO HB2 H N N 342 PRO HB3 H N N 343 PRO HG2 H N N 344 PRO HG3 H N N 345 PRO HD2 H N N 346 PRO HD3 H N N 347 PRO HXT H N N 348 SER N N N N 349 SER CA C N S 350 SER C C N N 351 SER O O N N 352 SER CB C N N 353 SER OG O N N 354 SER OXT O N N 355 SER H H N N 356 SER H2 H N N 357 SER HA H N N 358 SER HB2 H N N 359 SER HB3 H N N 360 SER HG H N N 361 SER HXT H N N 362 THR N N N N 363 THR CA C N S 364 THR C C N N 365 THR O O N N 366 THR CB C N R 367 THR OG1 O N N 368 THR CG2 C N N 369 THR OXT O N N 370 THR H H N N 371 THR H2 H N N 372 THR HA H N N 373 THR HB H N N 374 THR HG1 H N N 375 THR HG21 H N N 376 THR HG22 H N N 377 THR HG23 H N N 378 THR HXT H N N 379 TYR N N N N 380 TYR CA C N S 381 TYR C C N N 382 TYR O O N N 383 TYR CB C N N 384 TYR CG C Y N 385 TYR CD1 C Y N 386 TYR CD2 C Y N 387 TYR CE1 C Y N 388 TYR CE2 C Y N 389 TYR CZ C Y N 390 TYR OH O N N 391 TYR OXT O N N 392 TYR H H N N 393 TYR H2 H N N 394 TYR HA H N N 395 TYR HB2 H N N 396 TYR HB3 H N N 397 TYR HD1 H N N 398 TYR HD2 H N N 399 TYR HE1 H N N 400 TYR HE2 H N N 401 TYR HH H N N 402 TYR HXT H N N 403 VAL N N N N 404 VAL CA C N S 405 VAL C C N N 406 VAL O O N N 407 VAL CB C N N 408 VAL CG1 C N N 409 VAL CG2 C N N 410 VAL OXT O N N 411 VAL H H N N 412 VAL H2 H N N 413 VAL HA H N N 414 VAL HB H N N 415 VAL HG11 H N N 416 VAL HG12 H N N 417 VAL HG13 H N N 418 VAL HG21 H N N 419 VAL HG22 H N N 420 VAL HG23 H N N 421 VAL HXT H N N 422 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HEC FE NA sing N N 129 HEC FE NB sing N N 130 HEC FE NC sing N N 131 HEC FE ND sing N N 132 HEC CHA C1A doub N N 133 HEC CHA C4D sing N N 134 HEC CHA HHA sing N N 135 HEC CHB C4A doub N N 136 HEC CHB C1B sing N N 137 HEC CHB HHB sing N N 138 HEC CHC C4B doub N N 139 HEC CHC C1C sing N N 140 HEC CHC HHC sing N N 141 HEC CHD C4C doub N N 142 HEC CHD C1D sing N N 143 HEC CHD HHD sing N N 144 HEC NA C1A sing Y N 145 HEC NA C4A sing Y N 146 HEC C1A C2A sing Y N 147 HEC C2A C3A doub Y N 148 HEC C2A CAA sing N N 149 HEC C3A C4A sing Y N 150 HEC C3A CMA sing N N 151 HEC CMA HMA1 sing N N 152 HEC CMA HMA2 sing N N 153 HEC CMA HMA3 sing N N 154 HEC CAA CBA sing N N 155 HEC CAA HAA1 sing N N 156 HEC CAA HAA2 sing N N 157 HEC CBA CGA sing N N 158 HEC CBA HBA1 sing N N 159 HEC CBA HBA2 sing N N 160 HEC CGA O1A doub N N 161 HEC CGA O2A sing N N 162 HEC O2A H2A sing N N 163 HEC NB C1B sing Y N 164 HEC NB C4B sing Y N 165 HEC C1B C2B doub Y N 166 HEC C2B C3B sing Y N 167 HEC C2B CMB sing N N 168 HEC C3B C4B sing Y N 169 HEC C3B CAB doub N E 170 HEC CMB HMB1 sing N N 171 HEC CMB HMB2 sing N N 172 HEC CMB HMB3 sing N N 173 HEC CAB CBB sing N N 174 HEC CAB HAB sing N N 175 HEC CBB HBB1 sing N N 176 HEC CBB HBB2 sing N N 177 HEC CBB HBB3 sing N N 178 HEC NC C1C sing Y N 179 HEC NC C4C sing Y N 180 HEC C1C C2C doub Y N 181 HEC C2C C3C sing Y N 182 HEC C2C CMC sing N N 183 HEC C3C C4C sing Y N 184 HEC C3C CAC doub N E 185 HEC CMC HMC1 sing N N 186 HEC CMC HMC2 sing N N 187 HEC CMC HMC3 sing N N 188 HEC CAC CBC sing N N 189 HEC CAC HAC sing N N 190 HEC CBC HBC1 sing N N 191 HEC CBC HBC2 sing N N 192 HEC CBC HBC3 sing N N 193 HEC ND C1D sing Y N 194 HEC ND C4D sing Y N 195 HEC C1D C2D doub Y N 196 HEC C2D C3D sing Y N 197 HEC C2D CMD sing N N 198 HEC C3D C4D doub Y N 199 HEC C3D CAD sing N N 200 HEC CMD HMD1 sing N N 201 HEC CMD HMD2 sing N N 202 HEC CMD HMD3 sing N N 203 HEC CAD CBD sing N N 204 HEC CAD HAD1 sing N N 205 HEC CAD HAD2 sing N N 206 HEC CBD CGD sing N N 207 HEC CBD HBD1 sing N N 208 HEC CBD HBD2 sing N N 209 HEC CGD O1D doub N N 210 HEC CGD O2D sing N N 211 HEC O2D H2D sing N N 212 HIS N CA sing N N 213 HIS N H sing N N 214 HIS N H2 sing N N 215 HIS CA C sing N N 216 HIS CA CB sing N N 217 HIS CA HA sing N N 218 HIS C O doub N N 219 HIS C OXT sing N N 220 HIS CB CG sing N N 221 HIS CB HB2 sing N N 222 HIS CB HB3 sing N N 223 HIS CG ND1 sing Y N 224 HIS CG CD2 doub Y N 225 HIS ND1 CE1 doub Y N 226 HIS ND1 HD1 sing N N 227 HIS CD2 NE2 sing Y N 228 HIS CD2 HD2 sing N N 229 HIS CE1 NE2 sing Y N 230 HIS CE1 HE1 sing N N 231 HIS NE2 HE2 sing N N 232 HIS OXT HXT sing N N 233 HOH O H1 sing N N 234 HOH O H2 sing N N 235 LEU N CA sing N N 236 LEU N H sing N N 237 LEU N H2 sing N N 238 LEU CA C sing N N 239 LEU CA CB sing N N 240 LEU CA HA sing N N 241 LEU C O doub N N 242 LEU C OXT sing N N 243 LEU CB CG sing N N 244 LEU CB HB2 sing N N 245 LEU CB HB3 sing N N 246 LEU CG CD1 sing N N 247 LEU CG CD2 sing N N 248 LEU CG HG sing N N 249 LEU CD1 HD11 sing N N 250 LEU CD1 HD12 sing N N 251 LEU CD1 HD13 sing N N 252 LEU CD2 HD21 sing N N 253 LEU CD2 HD22 sing N N 254 LEU CD2 HD23 sing N N 255 LEU OXT HXT sing N N 256 LYS N CA sing N N 257 LYS N H sing N N 258 LYS N H2 sing N N 259 LYS CA C sing N N 260 LYS CA CB sing N N 261 LYS CA HA sing N N 262 LYS C O doub N N 263 LYS C OXT sing N N 264 LYS CB CG sing N N 265 LYS CB HB2 sing N N 266 LYS CB HB3 sing N N 267 LYS CG CD sing N N 268 LYS CG HG2 sing N N 269 LYS CG HG3 sing N N 270 LYS CD CE sing N N 271 LYS CD HD2 sing N N 272 LYS CD HD3 sing N N 273 LYS CE NZ sing N N 274 LYS CE HE2 sing N N 275 LYS CE HE3 sing N N 276 LYS NZ HZ1 sing N N 277 LYS NZ HZ2 sing N N 278 LYS NZ HZ3 sing N N 279 LYS OXT HXT sing N N 280 MET N CA sing N N 281 MET N H sing N N 282 MET N H2 sing N N 283 MET CA C sing N N 284 MET CA CB sing N N 285 MET CA HA sing N N 286 MET C O doub N N 287 MET C OXT sing N N 288 MET CB CG sing N N 289 MET CB HB2 sing N N 290 MET CB HB3 sing N N 291 MET CG SD sing N N 292 MET CG HG2 sing N N 293 MET CG HG3 sing N N 294 MET SD CE sing N N 295 MET CE HE1 sing N N 296 MET CE HE2 sing N N 297 MET CE HE3 sing N N 298 MET OXT HXT sing N N 299 PHE N CA sing N N 300 PHE N H sing N N 301 PHE N H2 sing N N 302 PHE CA C sing N N 303 PHE CA CB sing N N 304 PHE CA HA sing N N 305 PHE C O doub N N 306 PHE C OXT sing N N 307 PHE CB CG sing N N 308 PHE CB HB2 sing N N 309 PHE CB HB3 sing N N 310 PHE CG CD1 doub Y N 311 PHE CG CD2 sing Y N 312 PHE CD1 CE1 sing Y N 313 PHE CD1 HD1 sing N N 314 PHE CD2 CE2 doub Y N 315 PHE CD2 HD2 sing N N 316 PHE CE1 CZ doub Y N 317 PHE CE1 HE1 sing N N 318 PHE CE2 CZ sing Y N 319 PHE CE2 HE2 sing N N 320 PHE CZ HZ sing N N 321 PHE OXT HXT sing N N 322 PO3 P O1 doub N N 323 PO3 P O2 sing N N 324 PO3 P O3 sing N N 325 PRO N CA sing N N 326 PRO N CD sing N N 327 PRO N H sing N N 328 PRO CA C sing N N 329 PRO CA CB sing N N 330 PRO CA HA sing N N 331 PRO C O doub N N 332 PRO C OXT sing N N 333 PRO CB CG sing N N 334 PRO CB HB2 sing N N 335 PRO CB HB3 sing N N 336 PRO CG CD sing N N 337 PRO CG HG2 sing N N 338 PRO CG HG3 sing N N 339 PRO CD HD2 sing N N 340 PRO CD HD3 sing N N 341 PRO OXT HXT sing N N 342 SER N CA sing N N 343 SER N H sing N N 344 SER N H2 sing N N 345 SER CA C sing N N 346 SER CA CB sing N N 347 SER CA HA sing N N 348 SER C O doub N N 349 SER C OXT sing N N 350 SER CB OG sing N N 351 SER CB HB2 sing N N 352 SER CB HB3 sing N N 353 SER OG HG sing N N 354 SER OXT HXT sing N N 355 THR N CA sing N N 356 THR N H sing N N 357 THR N H2 sing N N 358 THR CA C sing N N 359 THR CA CB sing N N 360 THR CA HA sing N N 361 THR C O doub N N 362 THR C OXT sing N N 363 THR CB OG1 sing N N 364 THR CB CG2 sing N N 365 THR CB HB sing N N 366 THR OG1 HG1 sing N N 367 THR CG2 HG21 sing N N 368 THR CG2 HG22 sing N N 369 THR CG2 HG23 sing N N 370 THR OXT HXT sing N N 371 TYR N CA sing N N 372 TYR N H sing N N 373 TYR N H2 sing N N 374 TYR CA C sing N N 375 TYR CA CB sing N N 376 TYR CA HA sing N N 377 TYR C O doub N N 378 TYR C OXT sing N N 379 TYR CB CG sing N N 380 TYR CB HB2 sing N N 381 TYR CB HB3 sing N N 382 TYR CG CD1 doub Y N 383 TYR CG CD2 sing Y N 384 TYR CD1 CE1 sing Y N 385 TYR CD1 HD1 sing N N 386 TYR CD2 CE2 doub Y N 387 TYR CD2 HD2 sing N N 388 TYR CE1 CZ doub Y N 389 TYR CE1 HE1 sing N N 390 TYR CE2 CZ sing Y N 391 TYR CE2 HE2 sing N N 392 TYR CZ OH sing N N 393 TYR OH HH sing N N 394 TYR OXT HXT sing N N 395 VAL N CA sing N N 396 VAL N H sing N N 397 VAL N H2 sing N N 398 VAL CA C sing N N 399 VAL CA CB sing N N 400 VAL CA HA sing N N 401 VAL C O doub N N 402 VAL C OXT sing N N 403 VAL CB CG1 sing N N 404 VAL CB CG2 sing N N 405 VAL CB HB sing N N 406 VAL CG1 HG11 sing N N 407 VAL CG1 HG12 sing N N 408 VAL CG1 HG13 sing N N 409 VAL CG2 HG21 sing N N 410 VAL CG2 HG22 sing N N 411 VAL CG2 HG23 sing N N 412 VAL OXT HXT sing N N 413 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Other government' Portugal PTDC/BBB-BQB/4178/2014 1 'Other government' Portugal PTDC/BBB-BQB/3554/2014 2 'Other government' Portugal ERA-MBT/0003/2014 3 'Other government' Portugal SFRH/BPD/96952/2013 4 'Other government' Portugal SFRH/BPD/93164/2013 5 'Other government' Portugal SFRH/BPD/93164/2013 6 'Other government' Portugal PD/BD/135187/2017 7 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1M1P _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6HR0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.015112 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015112 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023129 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE H N O P S # loop_