data_6I03 # _entry.id 6I03 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6I03 pdb_00006i03 10.2210/pdb6i03/pdb WWPDB D_1200012599 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-11-20 2 'Structure model' 1 1 2020-07-29 3 'Structure model' 1 2 2024-01-24 4 'Structure model' 1 3 2024-11-20 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Structure summary' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Refinement description' 7 3 'Structure model' 'Structure summary' 8 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp 2 2 'Structure model' entity 3 2 'Structure model' pdbx_chem_comp_identifier 4 2 'Structure model' pdbx_entity_nonpoly 5 2 'Structure model' pdbx_struct_conn_angle 6 2 'Structure model' struct_conn 7 2 'Structure model' struct_site 8 2 'Structure model' struct_site_gen 9 3 'Structure model' chem_comp 10 3 'Structure model' chem_comp_atom 11 3 'Structure model' chem_comp_bond 12 3 'Structure model' database_2 13 3 'Structure model' pdbx_initial_refinement_model 14 4 'Structure model' pdbx_entry_details 15 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_chem_comp.mon_nstd_flag' 2 2 'Structure model' '_chem_comp.name' 3 2 'Structure model' '_chem_comp.type' 4 2 'Structure model' '_entity.pdbx_description' 5 2 'Structure model' '_pdbx_entity_nonpoly.name' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.value' 9 2 'Structure model' '_struct_conn.pdbx_dist_value' 10 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 11 3 'Structure model' '_chem_comp.pdbx_synonyms' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6I03 _pdbx_database_status.recvd_initial_deposition_date 2018-10-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Robertson, A.J.' 1 0000-0002-3762-3450 'Waltho, J.P.' 2 0000-0002-7402-5492 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Proton transfer modulates the electrostatic environment in a general acid-base catalyzed phosphoryl transfer reaction' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Robertson, A.J.' 1 0000-0002-3762-3450 primary 'Bisson, C.' 2 0000-0002-9430-6822 primary 'Waltho, J.P.' 3 0000-0002-7402-5492 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Beta-phosphoglucomutase 24264.646 1 5.4.2.6 'D10N, K125R, Y206H' ? ? 2 non-polymer syn 'TETRAFLUOROALUMINATE ION' 102.975 1 ? ? ? ? 3 non-polymer man 6-O-phosphono-beta-D-glucopyranose 260.136 1 ? ? ? ? 4 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 5 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 6 water nat water 18.015 231 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Beta-PGM # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(ACE)MFKAVLFDLNGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKR KNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAA HAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK ; _entity_poly.pdbx_seq_one_letter_code_can ;XMFKAVLFDLNGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDN YVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVG VAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'TETRAFLUOROALUMINATE ION' ALF 3 6-O-phosphono-beta-D-glucopyranose BG6 4 'SODIUM ION' NA 5 'MAGNESIUM ION' MG 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 MET n 1 3 PHE n 1 4 LYS n 1 5 ALA n 1 6 VAL n 1 7 LEU n 1 8 PHE n 1 9 ASP n 1 10 LEU n 1 11 ASN n 1 12 GLY n 1 13 VAL n 1 14 ILE n 1 15 THR n 1 16 ASP n 1 17 THR n 1 18 ALA n 1 19 GLU n 1 20 TYR n 1 21 HIS n 1 22 PHE n 1 23 ARG n 1 24 ALA n 1 25 TRP n 1 26 LYS n 1 27 ALA n 1 28 LEU n 1 29 ALA n 1 30 GLU n 1 31 GLU n 1 32 ILE n 1 33 GLY n 1 34 ILE n 1 35 ASN n 1 36 GLY n 1 37 VAL n 1 38 ASP n 1 39 ARG n 1 40 GLN n 1 41 PHE n 1 42 ASN n 1 43 GLU n 1 44 GLN n 1 45 LEU n 1 46 LYS n 1 47 GLY n 1 48 VAL n 1 49 SER n 1 50 ARG n 1 51 GLU n 1 52 ASP n 1 53 SER n 1 54 LEU n 1 55 GLN n 1 56 LYS n 1 57 ILE n 1 58 LEU n 1 59 ASP n 1 60 LEU n 1 61 ALA n 1 62 ASP n 1 63 LYS n 1 64 LYS n 1 65 VAL n 1 66 SER n 1 67 ALA n 1 68 GLU n 1 69 GLU n 1 70 PHE n 1 71 LYS n 1 72 GLU n 1 73 LEU n 1 74 ALA n 1 75 LYS n 1 76 ARG n 1 77 LYS n 1 78 ASN n 1 79 ASP n 1 80 ASN n 1 81 TYR n 1 82 VAL n 1 83 LYS n 1 84 MET n 1 85 ILE n 1 86 GLN n 1 87 ASP n 1 88 VAL n 1 89 SER n 1 90 PRO n 1 91 ALA n 1 92 ASP n 1 93 VAL n 1 94 TYR n 1 95 PRO n 1 96 GLY n 1 97 ILE n 1 98 LEU n 1 99 GLN n 1 100 LEU n 1 101 LEU n 1 102 LYS n 1 103 ASP n 1 104 LEU n 1 105 ARG n 1 106 SER n 1 107 ASN n 1 108 LYS n 1 109 ILE n 1 110 LYS n 1 111 ILE n 1 112 ALA n 1 113 LEU n 1 114 ALA n 1 115 SER n 1 116 ALA n 1 117 SER n 1 118 LYS n 1 119 ASN n 1 120 GLY n 1 121 PRO n 1 122 PHE n 1 123 LEU n 1 124 LEU n 1 125 GLU n 1 126 ARG n 1 127 MET n 1 128 ASN n 1 129 LEU n 1 130 THR n 1 131 GLY n 1 132 TYR n 1 133 PHE n 1 134 ASP n 1 135 ALA n 1 136 ILE n 1 137 ALA n 1 138 ASP n 1 139 PRO n 1 140 ALA n 1 141 GLU n 1 142 VAL n 1 143 ALA n 1 144 ALA n 1 145 SER n 1 146 LYS n 1 147 PRO n 1 148 ALA n 1 149 PRO n 1 150 ASP n 1 151 ILE n 1 152 PHE n 1 153 ILE n 1 154 ALA n 1 155 ALA n 1 156 ALA n 1 157 HIS n 1 158 ALA n 1 159 VAL n 1 160 GLY n 1 161 VAL n 1 162 ALA n 1 163 PRO n 1 164 SER n 1 165 GLU n 1 166 SER n 1 167 ILE n 1 168 GLY n 1 169 LEU n 1 170 GLU n 1 171 ASP n 1 172 SER n 1 173 GLN n 1 174 ALA n 1 175 GLY n 1 176 ILE n 1 177 GLN n 1 178 ALA n 1 179 ILE n 1 180 LYS n 1 181 ASP n 1 182 SER n 1 183 GLY n 1 184 ALA n 1 185 LEU n 1 186 PRO n 1 187 ILE n 1 188 GLY n 1 189 VAL n 1 190 GLY n 1 191 ARG n 1 192 PRO n 1 193 GLU n 1 194 ASP n 1 195 LEU n 1 196 GLY n 1 197 ASP n 1 198 ASP n 1 199 ILE n 1 200 VAL n 1 201 ILE n 1 202 VAL n 1 203 PRO n 1 204 ASP n 1 205 THR n 1 206 SER n 1 207 HIS n 1 208 TYR n 1 209 THR n 1 210 LEU n 1 211 GLU n 1 212 PHE n 1 213 LEU n 1 214 LYS n 1 215 GLU n 1 216 VAL n 1 217 TRP n 1 218 LEU n 1 219 GLN n 1 220 LYS n 1 221 GLN n 1 222 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 222 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pgmB, LL0429, L0001' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactococcus lactis subsp. lactis Il1403' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272623 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALF non-polymer . 'TETRAFLUOROALUMINATE ION' ? 'Al F4 -1' 102.975 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BG6 'D-saccharide, beta linking' n 6-O-phosphono-beta-D-glucopyranose 'BETA-D-GLUCOSE-6-PHOSPHATE; 6-O-phosphono-beta-D-glucose; 6-O-phosphono-D-glucose; 6-O-phosphono-glucose' 'C6 H13 O9 P' 260.136 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_chem_comp_identifier.comp_id BG6 _pdbx_chem_comp_identifier.type 'IUPAC CARBOHYDRATE SYMBOL' _pdbx_chem_comp_identifier.program PDB-CARE _pdbx_chem_comp_identifier.program_version 1.0 _pdbx_chem_comp_identifier.identifier b-D-Glcp6PO3 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 0 0 ACE ACE A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 PHE 3 2 2 PHE PHE A . n A 1 4 LYS 4 3 3 LYS LYS A . n A 1 5 ALA 5 4 4 ALA ALA A . n A 1 6 VAL 6 5 5 VAL VAL A . n A 1 7 LEU 7 6 6 LEU LEU A . n A 1 8 PHE 8 7 7 PHE PHE A . n A 1 9 ASP 9 8 8 ASP ASP A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 ASN 11 10 10 ASN ASN A . n A 1 12 GLY 12 11 11 GLY GLY A . n A 1 13 VAL 13 12 12 VAL VAL A . n A 1 14 ILE 14 13 13 ILE ILE A . n A 1 15 THR 15 14 14 THR THR A . n A 1 16 ASP 16 15 15 ASP ASP A . n A 1 17 THR 17 16 16 THR THR A . n A 1 18 ALA 18 17 17 ALA ALA A . n A 1 19 GLU 19 18 18 GLU GLU A . n A 1 20 TYR 20 19 19 TYR TYR A . n A 1 21 HIS 21 20 20 HIS HIS A . n A 1 22 PHE 22 21 21 PHE PHE A . n A 1 23 ARG 23 22 22 ARG ARG A . n A 1 24 ALA 24 23 23 ALA ALA A . n A 1 25 TRP 25 24 24 TRP TRP A . n A 1 26 LYS 26 25 25 LYS LYS A . n A 1 27 ALA 27 26 26 ALA ALA A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 ALA 29 28 28 ALA ALA A . n A 1 30 GLU 30 29 29 GLU GLU A . n A 1 31 GLU 31 30 30 GLU GLU A . n A 1 32 ILE 32 31 31 ILE ILE A . n A 1 33 GLY 33 32 32 GLY GLY A . n A 1 34 ILE 34 33 33 ILE ILE A . n A 1 35 ASN 35 34 34 ASN ASN A . n A 1 36 GLY 36 35 35 GLY GLY A . n A 1 37 VAL 37 36 36 VAL VAL A . n A 1 38 ASP 38 37 37 ASP ASP A . n A 1 39 ARG 39 38 38 ARG ARG A . n A 1 40 GLN 40 39 39 GLN GLN A . n A 1 41 PHE 41 40 40 PHE PHE A . n A 1 42 ASN 42 41 41 ASN ASN A . n A 1 43 GLU 43 42 42 GLU GLU A . n A 1 44 GLN 44 43 43 GLN GLN A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 LYS 46 45 45 LYS LYS A . n A 1 47 GLY 47 46 46 GLY GLY A . n A 1 48 VAL 48 47 47 VAL VAL A . n A 1 49 SER 49 48 48 SER SER A . n A 1 50 ARG 50 49 49 ARG ARG A . n A 1 51 GLU 51 50 50 GLU GLU A . n A 1 52 ASP 52 51 51 ASP ASP A . n A 1 53 SER 53 52 52 SER SER A . n A 1 54 LEU 54 53 53 LEU LEU A . n A 1 55 GLN 55 54 54 GLN GLN A . n A 1 56 LYS 56 55 55 LYS LYS A . n A 1 57 ILE 57 56 56 ILE ILE A . n A 1 58 LEU 58 57 57 LEU LEU A . n A 1 59 ASP 59 58 58 ASP ASP A . n A 1 60 LEU 60 59 59 LEU LEU A . n A 1 61 ALA 61 60 60 ALA ALA A . n A 1 62 ASP 62 61 61 ASP ASP A . n A 1 63 LYS 63 62 62 LYS LYS A . n A 1 64 LYS 64 63 63 LYS LYS A . n A 1 65 VAL 65 64 64 VAL VAL A . n A 1 66 SER 66 65 65 SER SER A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 GLU 68 67 67 GLU GLU A . n A 1 69 GLU 69 68 68 GLU GLU A . n A 1 70 PHE 70 69 69 PHE PHE A . n A 1 71 LYS 71 70 70 LYS LYS A . n A 1 72 GLU 72 71 71 GLU GLU A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 ALA 74 73 73 ALA ALA A . n A 1 75 LYS 75 74 74 LYS LYS A . n A 1 76 ARG 76 75 75 ARG ARG A . n A 1 77 LYS 77 76 76 LYS LYS A . n A 1 78 ASN 78 77 77 ASN ASN A . n A 1 79 ASP 79 78 78 ASP ASP A . n A 1 80 ASN 80 79 79 ASN ASN A . n A 1 81 TYR 81 80 80 TYR TYR A . n A 1 82 VAL 82 81 81 VAL VAL A . n A 1 83 LYS 83 82 82 LYS LYS A . n A 1 84 MET 84 83 83 MET MET A . n A 1 85 ILE 85 84 84 ILE ILE A . n A 1 86 GLN 86 85 85 GLN GLN A . n A 1 87 ASP 87 86 86 ASP ASP A . n A 1 88 VAL 88 87 87 VAL VAL A . n A 1 89 SER 89 88 88 SER SER A . n A 1 90 PRO 90 89 89 PRO PRO A . n A 1 91 ALA 91 90 90 ALA ALA A . n A 1 92 ASP 92 91 91 ASP ASP A . n A 1 93 VAL 93 92 92 VAL VAL A . n A 1 94 TYR 94 93 93 TYR TYR A . n A 1 95 PRO 95 94 94 PRO PRO A . n A 1 96 GLY 96 95 95 GLY GLY A . n A 1 97 ILE 97 96 96 ILE ILE A . n A 1 98 LEU 98 97 97 LEU LEU A . n A 1 99 GLN 99 98 98 GLN GLN A . n A 1 100 LEU 100 99 99 LEU LEU A . n A 1 101 LEU 101 100 100 LEU LEU A . n A 1 102 LYS 102 101 101 LYS LYS A . n A 1 103 ASP 103 102 102 ASP ASP A . n A 1 104 LEU 104 103 103 LEU LEU A . n A 1 105 ARG 105 104 104 ARG ARG A . n A 1 106 SER 106 105 105 SER SER A . n A 1 107 ASN 107 106 106 ASN ASN A . n A 1 108 LYS 108 107 107 LYS LYS A . n A 1 109 ILE 109 108 108 ILE ILE A . n A 1 110 LYS 110 109 109 LYS LYS A . n A 1 111 ILE 111 110 110 ILE ILE A . n A 1 112 ALA 112 111 111 ALA ALA A . n A 1 113 LEU 113 112 112 LEU LEU A . n A 1 114 ALA 114 113 113 ALA ALA A . n A 1 115 SER 115 114 114 SER SER A . n A 1 116 ALA 116 115 115 ALA ALA A . n A 1 117 SER 117 116 116 SER SER A . n A 1 118 LYS 118 117 117 LYS LYS A . n A 1 119 ASN 119 118 118 ASN ASN A . n A 1 120 GLY 120 119 119 GLY GLY A . n A 1 121 PRO 121 120 120 PRO PRO A . n A 1 122 PHE 122 121 121 PHE PHE A . n A 1 123 LEU 123 122 122 LEU LEU A . n A 1 124 LEU 124 123 123 LEU LEU A . n A 1 125 GLU 125 124 124 GLU GLU A . n A 1 126 ARG 126 125 125 ARG ARG A . n A 1 127 MET 127 126 126 MET MET A . n A 1 128 ASN 128 127 127 ASN ASN A . n A 1 129 LEU 129 128 128 LEU LEU A . n A 1 130 THR 130 129 129 THR THR A . n A 1 131 GLY 131 130 130 GLY GLY A . n A 1 132 TYR 132 131 131 TYR TYR A . n A 1 133 PHE 133 132 132 PHE PHE A . n A 1 134 ASP 134 133 133 ASP ASP A . n A 1 135 ALA 135 134 134 ALA ALA A . n A 1 136 ILE 136 135 135 ILE ILE A . n A 1 137 ALA 137 136 136 ALA ALA A . n A 1 138 ASP 138 137 137 ASP ASP A . n A 1 139 PRO 139 138 138 PRO PRO A . n A 1 140 ALA 140 139 139 ALA ALA A . n A 1 141 GLU 141 140 140 GLU GLU A . n A 1 142 VAL 142 141 141 VAL VAL A . n A 1 143 ALA 143 142 142 ALA ALA A . n A 1 144 ALA 144 143 143 ALA ALA A . n A 1 145 SER 145 144 144 SER SER A . n A 1 146 LYS 146 145 145 LYS LYS A . n A 1 147 PRO 147 146 146 PRO PRO A . n A 1 148 ALA 148 147 147 ALA ALA A . n A 1 149 PRO 149 148 148 PRO PRO A . n A 1 150 ASP 150 149 149 ASP ASP A . n A 1 151 ILE 151 150 150 ILE ILE A . n A 1 152 PHE 152 151 151 PHE PHE A . n A 1 153 ILE 153 152 152 ILE ILE A . n A 1 154 ALA 154 153 153 ALA ALA A . n A 1 155 ALA 155 154 154 ALA ALA A . n A 1 156 ALA 156 155 155 ALA ALA A . n A 1 157 HIS 157 156 156 HIS HIS A . n A 1 158 ALA 158 157 157 ALA ALA A . n A 1 159 VAL 159 158 158 VAL VAL A . n A 1 160 GLY 160 159 159 GLY GLY A . n A 1 161 VAL 161 160 160 VAL VAL A . n A 1 162 ALA 162 161 161 ALA ALA A . n A 1 163 PRO 163 162 162 PRO PRO A . n A 1 164 SER 164 163 163 SER SER A . n A 1 165 GLU 165 164 164 GLU GLU A . n A 1 166 SER 166 165 165 SER SER A . n A 1 167 ILE 167 166 166 ILE ILE A . n A 1 168 GLY 168 167 167 GLY GLY A . n A 1 169 LEU 169 168 168 LEU LEU A . n A 1 170 GLU 170 169 169 GLU GLU A . n A 1 171 ASP 171 170 170 ASP ASP A . n A 1 172 SER 172 171 171 SER SER A . n A 1 173 GLN 173 172 172 GLN GLN A . n A 1 174 ALA 174 173 173 ALA ALA A . n A 1 175 GLY 175 174 174 GLY GLY A . n A 1 176 ILE 176 175 175 ILE ILE A . n A 1 177 GLN 177 176 176 GLN GLN A . n A 1 178 ALA 178 177 177 ALA ALA A . n A 1 179 ILE 179 178 178 ILE ILE A . n A 1 180 LYS 180 179 179 LYS LYS A . n A 1 181 ASP 181 180 180 ASP ASP A . n A 1 182 SER 182 181 181 SER SER A . n A 1 183 GLY 183 182 182 GLY GLY A . n A 1 184 ALA 184 183 183 ALA ALA A . n A 1 185 LEU 185 184 184 LEU LEU A . n A 1 186 PRO 186 185 185 PRO PRO A . n A 1 187 ILE 187 186 186 ILE ILE A . n A 1 188 GLY 188 187 187 GLY GLY A . n A 1 189 VAL 189 188 188 VAL VAL A . n A 1 190 GLY 190 189 189 GLY GLY A . n A 1 191 ARG 191 190 190 ARG ARG A . n A 1 192 PRO 192 191 191 PRO PRO A . n A 1 193 GLU 193 192 192 GLU GLU A . n A 1 194 ASP 194 193 193 ASP ASP A . n A 1 195 LEU 195 194 194 LEU LEU A . n A 1 196 GLY 196 195 195 GLY GLY A . n A 1 197 ASP 197 196 196 ASP ASP A . n A 1 198 ASP 198 197 197 ASP ASP A . n A 1 199 ILE 199 198 198 ILE ILE A . n A 1 200 VAL 200 199 199 VAL VAL A . n A 1 201 ILE 201 200 200 ILE ILE A . n A 1 202 VAL 202 201 201 VAL VAL A . n A 1 203 PRO 203 202 202 PRO PRO A . n A 1 204 ASP 204 203 203 ASP ASP A . n A 1 205 THR 205 204 204 THR THR A . n A 1 206 SER 206 205 205 SER SER A . n A 1 207 HIS 207 206 206 HIS HIS A . n A 1 208 TYR 208 207 207 TYR TYR A . n A 1 209 THR 209 208 208 THR THR A . n A 1 210 LEU 210 209 209 LEU LEU A . n A 1 211 GLU 211 210 210 GLU GLU A . n A 1 212 PHE 212 211 211 PHE PHE A . n A 1 213 LEU 213 212 212 LEU LEU A . n A 1 214 LYS 214 213 213 LYS LYS A . n A 1 215 GLU 215 214 214 GLU GLU A . n A 1 216 VAL 216 215 215 VAL VAL A . n A 1 217 TRP 217 216 216 TRP TRP A . n A 1 218 LEU 218 217 217 LEU LEU A . n A 1 219 GLN 219 218 218 GLN GLN A . n A 1 220 LYS 220 219 219 LYS LYS A . n A 1 221 GLN 221 220 ? ? ? A . n A 1 222 LYS 222 221 ? ? ? A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 ALF ? ? ALF ? ? 'SUBJECT OF INVESTIGATION' ? 2 BG6 ? ? BG6 ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ALF 1 301 301 ALF ALF A . C 3 BG6 1 302 401 BG6 BG6 A . D 4 NA 1 303 1 NA NA A . E 5 MG 1 304 1 MG MG A . F 6 HOH 1 401 137 HOH HOH A . F 6 HOH 2 402 188 HOH HOH A . F 6 HOH 3 403 79 HOH HOH A . F 6 HOH 4 404 204 HOH HOH A . F 6 HOH 5 405 219 HOH HOH A . F 6 HOH 6 406 214 HOH HOH A . F 6 HOH 7 407 176 HOH HOH A . F 6 HOH 8 408 166 HOH HOH A . F 6 HOH 9 409 205 HOH HOH A . F 6 HOH 10 410 42 HOH HOH A . F 6 HOH 11 411 76 HOH HOH A . F 6 HOH 12 412 197 HOH HOH A . F 6 HOH 13 413 69 HOH HOH A . F 6 HOH 14 414 171 HOH HOH A . F 6 HOH 15 415 112 HOH HOH A . F 6 HOH 16 416 110 HOH HOH A . F 6 HOH 17 417 94 HOH HOH A . F 6 HOH 18 418 174 HOH HOH A . F 6 HOH 19 419 193 HOH HOH A . F 6 HOH 20 420 145 HOH HOH A . F 6 HOH 21 421 113 HOH HOH A . F 6 HOH 22 422 199 HOH HOH A . F 6 HOH 23 423 232 HOH HOH A . F 6 HOH 24 424 21 HOH HOH A . F 6 HOH 25 425 127 HOH HOH A . F 6 HOH 26 426 26 HOH HOH A . F 6 HOH 27 427 117 HOH HOH A . F 6 HOH 28 428 119 HOH HOH A . F 6 HOH 29 429 44 HOH HOH A . F 6 HOH 30 430 123 HOH HOH A . F 6 HOH 31 431 118 HOH HOH A . F 6 HOH 32 432 37 HOH HOH A . F 6 HOH 33 433 13 HOH HOH A . F 6 HOH 34 434 53 HOH HOH A . F 6 HOH 35 435 5 HOH HOH A . F 6 HOH 36 436 162 HOH HOH A . F 6 HOH 37 437 25 HOH HOH A . F 6 HOH 38 438 151 HOH HOH A . F 6 HOH 39 439 43 HOH HOH A . F 6 HOH 40 440 18 HOH HOH A . F 6 HOH 41 441 39 HOH HOH A . F 6 HOH 42 442 170 HOH HOH A . F 6 HOH 43 443 189 HOH HOH A . F 6 HOH 44 444 22 HOH HOH A . F 6 HOH 45 445 54 HOH HOH A . F 6 HOH 46 446 93 HOH HOH A . F 6 HOH 47 447 32 HOH HOH A . F 6 HOH 48 448 64 HOH HOH A . F 6 HOH 49 449 136 HOH HOH A . F 6 HOH 50 450 82 HOH HOH A . F 6 HOH 51 451 6 HOH HOH A . F 6 HOH 52 452 23 HOH HOH A . F 6 HOH 53 453 9 HOH HOH A . F 6 HOH 54 454 125 HOH HOH A . F 6 HOH 55 455 28 HOH HOH A . F 6 HOH 56 456 30 HOH HOH A . F 6 HOH 57 457 71 HOH HOH A . F 6 HOH 58 458 231 HOH HOH A . F 6 HOH 59 459 144 HOH HOH A . F 6 HOH 60 460 14 HOH HOH A . F 6 HOH 61 461 47 HOH HOH A . F 6 HOH 62 462 168 HOH HOH A . F 6 HOH 63 463 27 HOH HOH A . F 6 HOH 64 464 35 HOH HOH A . F 6 HOH 65 465 20 HOH HOH A . F 6 HOH 66 466 51 HOH HOH A . F 6 HOH 67 467 152 HOH HOH A . F 6 HOH 68 468 38 HOH HOH A . F 6 HOH 69 469 11 HOH HOH A . F 6 HOH 70 470 98 HOH HOH A . F 6 HOH 71 471 57 HOH HOH A . F 6 HOH 72 472 91 HOH HOH A . F 6 HOH 73 473 59 HOH HOH A . F 6 HOH 74 474 191 HOH HOH A . F 6 HOH 75 475 63 HOH HOH A . F 6 HOH 76 476 103 HOH HOH A . F 6 HOH 77 477 150 HOH HOH A . F 6 HOH 78 478 3 HOH HOH A . F 6 HOH 79 479 15 HOH HOH A . F 6 HOH 80 480 105 HOH HOH A . F 6 HOH 81 481 172 HOH HOH A . F 6 HOH 82 482 177 HOH HOH A . F 6 HOH 83 483 73 HOH HOH A . F 6 HOH 84 484 131 HOH HOH A . F 6 HOH 85 485 16 HOH HOH A . F 6 HOH 86 486 29 HOH HOH A . F 6 HOH 87 487 8 HOH HOH A . F 6 HOH 88 488 83 HOH HOH A . F 6 HOH 89 489 187 HOH HOH A . F 6 HOH 90 490 10 HOH HOH A . F 6 HOH 91 491 70 HOH HOH A . F 6 HOH 92 492 52 HOH HOH A . F 6 HOH 93 493 207 HOH HOH A . F 6 HOH 94 494 33 HOH HOH A . F 6 HOH 95 495 106 HOH HOH A . F 6 HOH 96 496 80 HOH HOH A . F 6 HOH 97 497 96 HOH HOH A . F 6 HOH 98 498 134 HOH HOH A . F 6 HOH 99 499 107 HOH HOH A . F 6 HOH 100 500 4 HOH HOH A . F 6 HOH 101 501 55 HOH HOH A . F 6 HOH 102 502 19 HOH HOH A . F 6 HOH 103 503 234 HOH HOH A . F 6 HOH 104 504 58 HOH HOH A . F 6 HOH 105 505 101 HOH HOH A . F 6 HOH 106 506 50 HOH HOH A . F 6 HOH 107 507 179 HOH HOH A . F 6 HOH 108 508 12 HOH HOH A . F 6 HOH 109 509 24 HOH HOH A . F 6 HOH 110 510 85 HOH HOH A . F 6 HOH 111 511 46 HOH HOH A . F 6 HOH 112 512 154 HOH HOH A . F 6 HOH 113 513 68 HOH HOH A . F 6 HOH 114 514 190 HOH HOH A . F 6 HOH 115 515 142 HOH HOH A . F 6 HOH 116 516 156 HOH HOH A . F 6 HOH 117 517 215 HOH HOH A . F 6 HOH 118 518 139 HOH HOH A . F 6 HOH 119 519 77 HOH HOH A . F 6 HOH 120 520 192 HOH HOH A . F 6 HOH 121 521 183 HOH HOH A . F 6 HOH 122 522 114 HOH HOH A . F 6 HOH 123 523 198 HOH HOH A . F 6 HOH 124 524 66 HOH HOH A . F 6 HOH 125 525 111 HOH HOH A . F 6 HOH 126 526 2 HOH HOH A . F 6 HOH 127 527 135 HOH HOH A . F 6 HOH 128 528 17 HOH HOH A . F 6 HOH 129 529 155 HOH HOH A . F 6 HOH 130 530 48 HOH HOH A . F 6 HOH 131 531 175 HOH HOH A . F 6 HOH 132 532 60 HOH HOH A . F 6 HOH 133 533 65 HOH HOH A . F 6 HOH 134 534 210 HOH HOH A . F 6 HOH 135 535 161 HOH HOH A . F 6 HOH 136 536 104 HOH HOH A . F 6 HOH 137 537 108 HOH HOH A . F 6 HOH 138 538 157 HOH HOH A . F 6 HOH 139 539 31 HOH HOH A . F 6 HOH 140 540 41 HOH HOH A . F 6 HOH 141 541 229 HOH HOH A . F 6 HOH 142 542 173 HOH HOH A . F 6 HOH 143 543 184 HOH HOH A . F 6 HOH 144 544 227 HOH HOH A . F 6 HOH 145 545 159 HOH HOH A . F 6 HOH 146 546 196 HOH HOH A . F 6 HOH 147 547 88 HOH HOH A . F 6 HOH 148 548 100 HOH HOH A . F 6 HOH 149 549 90 HOH HOH A . F 6 HOH 150 550 223 HOH HOH A . F 6 HOH 151 551 122 HOH HOH A . F 6 HOH 152 552 81 HOH HOH A . F 6 HOH 153 553 158 HOH HOH A . F 6 HOH 154 554 149 HOH HOH A . F 6 HOH 155 555 128 HOH HOH A . F 6 HOH 156 556 186 HOH HOH A . F 6 HOH 157 557 167 HOH HOH A . F 6 HOH 158 558 133 HOH HOH A . F 6 HOH 159 559 220 HOH HOH A . F 6 HOH 160 560 180 HOH HOH A . F 6 HOH 161 561 143 HOH HOH A . F 6 HOH 162 562 209 HOH HOH A . F 6 HOH 163 563 99 HOH HOH A . F 6 HOH 164 564 216 HOH HOH A . F 6 HOH 165 565 233 HOH HOH A . F 6 HOH 166 566 226 HOH HOH A . F 6 HOH 167 567 132 HOH HOH A . F 6 HOH 168 568 185 HOH HOH A . F 6 HOH 169 569 164 HOH HOH A . F 6 HOH 170 570 72 HOH HOH A . F 6 HOH 171 571 40 HOH HOH A . F 6 HOH 172 572 169 HOH HOH A . F 6 HOH 173 573 181 HOH HOH A . F 6 HOH 174 574 153 HOH HOH A . F 6 HOH 175 575 230 HOH HOH A . F 6 HOH 176 576 130 HOH HOH A . F 6 HOH 177 577 115 HOH HOH A . F 6 HOH 178 578 147 HOH HOH A . F 6 HOH 179 579 146 HOH HOH A . F 6 HOH 180 580 121 HOH HOH A . F 6 HOH 181 581 75 HOH HOH A . F 6 HOH 182 582 95 HOH HOH A . F 6 HOH 183 583 200 HOH HOH A . F 6 HOH 184 584 163 HOH HOH A . F 6 HOH 185 585 206 HOH HOH A . F 6 HOH 186 586 36 HOH HOH A . F 6 HOH 187 587 120 HOH HOH A . F 6 HOH 188 588 224 HOH HOH A . F 6 HOH 189 589 109 HOH HOH A . F 6 HOH 190 590 56 HOH HOH A . F 6 HOH 191 591 7 HOH HOH A . F 6 HOH 192 592 195 HOH HOH A . F 6 HOH 193 593 67 HOH HOH A . F 6 HOH 194 594 86 HOH HOH A . F 6 HOH 195 595 62 HOH HOH A . F 6 HOH 196 596 208 HOH HOH A . F 6 HOH 197 597 212 HOH HOH A . F 6 HOH 198 598 34 HOH HOH A . F 6 HOH 199 599 141 HOH HOH A . F 6 HOH 200 600 126 HOH HOH A . F 6 HOH 201 601 92 HOH HOH A . F 6 HOH 202 602 89 HOH HOH A . F 6 HOH 203 603 49 HOH HOH A . F 6 HOH 204 604 124 HOH HOH A . F 6 HOH 205 605 1 HOH HOH A . F 6 HOH 206 606 165 HOH HOH A . F 6 HOH 207 607 74 HOH HOH A . F 6 HOH 208 608 182 HOH HOH A . F 6 HOH 209 609 178 HOH HOH A . F 6 HOH 210 610 78 HOH HOH A . F 6 HOH 211 611 160 HOH HOH A . F 6 HOH 212 612 222 HOH HOH A . F 6 HOH 213 613 45 HOH HOH A . F 6 HOH 214 614 218 HOH HOH A . F 6 HOH 215 615 217 HOH HOH A . F 6 HOH 216 616 129 HOH HOH A . F 6 HOH 217 617 213 HOH HOH A . F 6 HOH 218 618 211 HOH HOH A . F 6 HOH 219 619 148 HOH HOH A . F 6 HOH 220 620 228 HOH HOH A . F 6 HOH 221 621 102 HOH HOH A . F 6 HOH 222 622 116 HOH HOH A . F 6 HOH 223 623 61 HOH HOH A . F 6 HOH 224 624 225 HOH HOH A . F 6 HOH 225 625 201 HOH HOH A . F 6 HOH 226 626 221 HOH HOH A . F 6 HOH 227 627 84 HOH HOH A . F 6 HOH 228 628 97 HOH HOH A . F 6 HOH 229 629 140 HOH HOH A . F 6 HOH 230 630 194 HOH HOH A . F 6 HOH 231 631 138 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0232 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6I03 _cell.details ? _cell.formula_units_Z ? _cell.length_a 37.520 _cell.length_a_esd ? _cell.length_b 54.280 _cell.length_b_esd ? _cell.length_c 104.420 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6I03 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6I03 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.19 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;24-34% PEG 4000 200 mM sodium acetate 50 mM TRIS, pH 7.5 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-10-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I02' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I02 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6I03 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.02 _reflns.d_resolution_low 37.52 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 106736 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.5 _reflns.pdbx_Rmerge_I_obs 0.045 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.054 _reflns.pdbx_Rpim_I_all 0.021 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.02 _reflns_shell.d_res_low 1.05 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 6606 _reflns_shell.percent_possible_all 82.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.917 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.209 _reflns_shell.pdbx_Rpim_I_all 0.589 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.542 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.51 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -0.97 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 0.46 _refine.B_iso_max ? _refine.B_iso_mean 16.192 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.977 _refine.correlation_coeff_Fo_to_Fc_free 0.972 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6I03 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.02 _refine.ls_d_res_low 35.33 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 101274 _refine.ls_number_reflns_R_free 5373 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.60 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.15265 _refine.ls_R_factor_R_free 0.17470 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.15147 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2WF6 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.026 _refine.pdbx_overall_ESU_R_Free 0.027 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.055 _refine.overall_SU_ML 0.023 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1692 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.number_atoms_solvent 231 _refine_hist.number_atoms_total 1946 _refine_hist.d_res_high 1.02 _refine_hist.d_res_low 35.33 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.013 2022 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.005 0.017 1909 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.507 1.645 2751 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.520 1.588 4452 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.957 5.000 262 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.317 24.219 96 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.849 15.000 346 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.779 15.000 8 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.069 0.200 271 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 2288 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 380 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.912 1.342 1035 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.856 1.339 1034 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.974 2.018 1302 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.065 2.024 1303 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.137 1.556 987 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.138 1.556 987 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 2.392 2.251 1450 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 2.631 16.483 2019 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 2.451 15.982 1962 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? 24.172 3.000 3930 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 19.127 5.000 140 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 24.744 5.000 3984 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.020 _refine_ls_shell.d_res_low 1.046 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 330 _refine_ls_shell.number_reflns_R_work 6273 _refine_ls_shell.percent_reflns_obs 82.30 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.313 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.330 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6I03 _struct.title 'D10N variant of beta-phosphoglucomutase from Lactococcus lactis complexed with tetrafluoroaluminate and beta-G6P to 1.02 A' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6I03 _struct_keywords.text 'phosphoglucomutase, isomerase, metal fluoride, transition state analog' _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PGMB_LACLA _struct_ref.pdbx_db_accession P71447 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNY VKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLEKMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGV APSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSYYTLEFLKEVWLQKQK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6I03 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 222 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P71447 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 221 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 221 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6I03 ACE A 1 ? UNP P71447 ? ? acetylation 0 1 1 6I03 ASN A 11 ? UNP P71447 ASP 10 'engineered mutation' 10 2 1 6I03 ARG A 126 ? UNP P71447 LYS 125 'engineered mutation' 125 3 1 6I03 HIS A 207 ? UNP P71447 TYR 206 'engineered mutation' 206 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1150 ? 1 MORE -17 ? 1 'SSA (A^2)' 10250 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details ;Homology to previously deposited PDB files 2WF6 and 5OK2. Furthermore, NMR spectroscopy was used to confirm the presence of the complex with tetrafluoroaluminate and glucose 6-phosphate. ; # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 16 ? ILE A 32 ? ASP A 15 ILE A 31 1 ? 17 HELX_P HELX_P2 AA2 ASP A 38 ? GLU A 43 ? ASP A 37 GLU A 42 1 ? 6 HELX_P HELX_P3 AA3 SER A 49 ? ALA A 61 ? SER A 48 ALA A 60 1 ? 13 HELX_P HELX_P4 AA4 SER A 66 ? ILE A 85 ? SER A 65 ILE A 84 1 ? 20 HELX_P HELX_P5 AA5 SER A 89 ? VAL A 93 ? SER A 88 VAL A 92 5 ? 5 HELX_P HELX_P6 AA6 GLY A 96 ? ASN A 107 ? GLY A 95 ASN A 106 1 ? 12 HELX_P HELX_P7 AA7 ASN A 119 ? MET A 127 ? ASN A 118 MET A 126 1 ? 9 HELX_P HELX_P8 AA8 LEU A 129 ? PHE A 133 ? LEU A 128 PHE A 132 5 ? 5 HELX_P HELX_P9 AA9 PRO A 149 ? VAL A 159 ? PRO A 148 VAL A 158 1 ? 11 HELX_P HELX_P10 AB1 ALA A 162 ? SER A 164 ? ALA A 161 SER A 163 5 ? 3 HELX_P HELX_P11 AB2 SER A 172 ? GLY A 183 ? SER A 171 GLY A 182 1 ? 12 HELX_P HELX_P12 AB3 ARG A 191 ? GLY A 196 ? ARG A 190 GLY A 195 1 ? 6 HELX_P HELX_P13 AB4 ASP A 204 ? TYR A 208 ? ASP A 203 TYR A 207 5 ? 5 HELX_P HELX_P14 AB5 THR A 209 ? GLN A 219 ? THR A 208 GLN A 218 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A MET 2 N ? ? A ACE 0 A MET 1 1_555 ? ? ? ? ? ? ? 1.329 ? ? metalc1 metalc ? ? A ASP 9 OD2 ? ? ? 1_555 E MG . MG ? ? A ASP 8 A MG 304 1_555 ? ? ? ? ? ? ? 2.020 ? ? metalc2 metalc ? ? A ASN 11 O ? ? ? 1_555 E MG . MG ? ? A ASN 10 A MG 304 1_555 ? ? ? ? ? ? ? 2.069 ? ? metalc3 metalc ? ? A GLU 125 O ? ? ? 1_555 D NA . NA ? ? A GLU 124 A NA 303 1_555 ? ? ? ? ? ? ? 2.283 ? ? metalc4 metalc ? ? A ASN 128 OD1 ? ? ? 1_555 D NA . NA ? ? A ASN 127 A NA 303 1_555 ? ? ? ? ? ? ? 2.440 ? ? metalc5 metalc ? ? A ASP 171 OD1 ? ? ? 1_555 E MG . MG ? ? A ASP 170 A MG 304 1_555 ? ? ? ? ? ? ? 2.069 ? ? metalc6 metalc ? ? D NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 303 A HOH 473 1_555 ? ? ? ? ? ? ? 2.440 ? ? metalc7 metalc ? ? D NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 303 A HOH 491 1_555 ? ? ? ? ? ? ? 2.119 ? ? metalc8 metalc ? ? D NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 303 A HOH 561 1_555 ? ? ? ? ? ? ? 2.762 ? ? metalc9 metalc ? ? D NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 303 A HOH 577 1_555 ? ? ? ? ? ? ? 2.332 ? ? metalc10 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 304 A HOH 440 1_555 ? ? ? ? ? ? ? 2.088 ? ? metalc11 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 304 A HOH 451 1_555 ? ? ? ? ? ? ? 2.099 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 9 ? A ASP 8 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? A ASN 11 ? A ASN 10 ? 1_555 89.9 ? 2 OD2 ? A ASP 9 ? A ASP 8 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 OD1 ? A ASP 171 ? A ASP 170 ? 1_555 89.6 ? 3 O ? A ASN 11 ? A ASN 10 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 OD1 ? A ASP 171 ? A ASP 170 ? 1_555 90.5 ? 4 OD2 ? A ASP 9 ? A ASP 8 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 440 ? 1_555 89.4 ? 5 O ? A ASN 11 ? A ASN 10 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 440 ? 1_555 179.3 ? 6 OD1 ? A ASP 171 ? A ASP 170 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 440 ? 1_555 89.3 ? 7 OD2 ? A ASP 9 ? A ASP 8 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 451 ? 1_555 176.2 ? 8 O ? A ASN 11 ? A ASN 10 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 451 ? 1_555 87.4 ? 9 OD1 ? A ASP 171 ? A ASP 170 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 451 ? 1_555 87.7 ? 10 O ? F HOH . ? A HOH 440 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 451 ? 1_555 93.3 ? 11 O ? A GLU 125 ? A GLU 124 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 OD1 ? A ASN 128 ? A ASN 127 ? 1_555 91.0 ? 12 O ? A GLU 125 ? A GLU 124 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 473 ? 1_555 97.8 ? 13 OD1 ? A ASN 128 ? A ASN 127 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 473 ? 1_555 82.6 ? 14 O ? A GLU 125 ? A GLU 124 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 491 ? 1_555 83.2 ? 15 OD1 ? A ASN 128 ? A ASN 127 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 491 ? 1_555 75.0 ? 16 O ? F HOH . ? A HOH 473 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 491 ? 1_555 157.6 ? 17 O ? A GLU 125 ? A GLU 124 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 561 ? 1_555 80.2 ? 18 OD1 ? A ASN 128 ? A ASN 127 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 561 ? 1_555 171.0 ? 19 O ? F HOH . ? A HOH 473 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 561 ? 1_555 100.5 ? 20 O ? F HOH . ? A HOH 491 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 561 ? 1_555 101.7 ? 21 O ? A GLU 125 ? A GLU 124 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 577 ? 1_555 162.9 ? 22 OD1 ? A ASN 128 ? A ASN 127 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 577 ? 1_555 105.2 ? 23 O ? F HOH . ? A HOH 473 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 577 ? 1_555 79.2 ? 24 O ? F HOH . ? A HOH 491 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 577 ? 1_555 106.1 ? 25 O ? F HOH . ? A HOH 561 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 577 ? 1_555 83.8 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id ACE _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id MET _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 2 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id ACE _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 0 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id MET _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 1 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id MET _pdbx_modification_feature.ref_pcm_id 4 _pdbx_modification_feature.ref_comp_id ACE _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Terminal acetylation' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LYS 146 A . ? LYS 145 A PRO 147 A ? PRO 146 A 1 9.55 2 LYS 146 A . ? LYS 145 A PRO 147 A ? PRO 146 A 1 10.26 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 135 ? ILE A 136 ? ALA A 134 ILE A 135 AA1 2 LYS A 110 ? LEU A 113 ? LYS A 109 LEU A 112 AA1 3 ALA A 5 ? PHE A 8 ? ALA A 4 PHE A 7 AA1 4 SER A 166 ? GLU A 170 ? SER A 165 GLU A 169 AA1 5 LEU A 185 ? VAL A 189 ? LEU A 184 VAL A 188 AA1 6 VAL A 200 ? VAL A 202 ? VAL A 199 VAL A 201 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 135 ? O ALA A 134 N LEU A 113 ? N LEU A 112 AA1 2 3 O ALA A 112 ? O ALA A 111 N PHE A 8 ? N PHE A 7 AA1 3 4 N LEU A 7 ? N LEU A 6 O ILE A 167 ? O ILE A 166 AA1 4 5 N GLY A 168 ? N GLY A 167 O LEU A 185 ? O LEU A 184 AA1 5 6 N GLY A 188 ? N GLY A 187 O VAL A 200 ? O VAL A 199 # _pdbx_entry_details.entry_id 6I03 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 AL A ALF 301 ? ? O1 A BG6 302 ? ? 1.86 2 1 OD1 A ASP 8 ? ? AL A ALF 301 ? ? 1.99 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 TYR _pdbx_validate_rmsd_angle.auth_seq_id_1 207 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 TYR _pdbx_validate_rmsd_angle.auth_seq_id_2 207 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 TYR _pdbx_validate_rmsd_angle.auth_seq_id_3 207 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 124.69 _pdbx_validate_rmsd_angle.angle_target_value 121.00 _pdbx_validate_rmsd_angle.angle_deviation 3.69 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.60 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 9 ? ? -102.64 -64.59 2 1 ASP A 15 ? ? -81.23 38.66 3 1 ALA A 113 ? ? -118.58 56.46 4 1 ALA A 142 ? B -101.14 45.17 5 1 ALA A 143 ? B 171.61 126.97 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id SER _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 171 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -12.05 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 628 ? 6.05 . 2 1 O ? A HOH 629 ? 6.94 . 3 1 O ? A HOH 630 ? 7.55 . 4 1 O ? A HOH 631 ? 8.75 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 220 ? A GLN 221 2 1 Y 1 A LYS 221 ? A LYS 222 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ALF AL AL N N 21 ALF F1 F N N 22 ALF F2 F N N 23 ALF F3 F N N 24 ALF F4 F N N 25 ARG N N N N 26 ARG CA C N S 27 ARG C C N N 28 ARG O O N N 29 ARG CB C N N 30 ARG CG C N N 31 ARG CD C N N 32 ARG NE N N N 33 ARG CZ C N N 34 ARG NH1 N N N 35 ARG NH2 N N N 36 ARG OXT O N N 37 ARG H H N N 38 ARG H2 H N N 39 ARG HA H N N 40 ARG HB2 H N N 41 ARG HB3 H N N 42 ARG HG2 H N N 43 ARG HG3 H N N 44 ARG HD2 H N N 45 ARG HD3 H N N 46 ARG HE H N N 47 ARG HH11 H N N 48 ARG HH12 H N N 49 ARG HH21 H N N 50 ARG HH22 H N N 51 ARG HXT H N N 52 ASN N N N N 53 ASN CA C N S 54 ASN C C N N 55 ASN O O N N 56 ASN CB C N N 57 ASN CG C N N 58 ASN OD1 O N N 59 ASN ND2 N N N 60 ASN OXT O N N 61 ASN H H N N 62 ASN H2 H N N 63 ASN HA H N N 64 ASN HB2 H N N 65 ASN HB3 H N N 66 ASN HD21 H N N 67 ASN HD22 H N N 68 ASN HXT H N N 69 ASP N N N N 70 ASP CA C N S 71 ASP C C N N 72 ASP O O N N 73 ASP CB C N N 74 ASP CG C N N 75 ASP OD1 O N N 76 ASP OD2 O N N 77 ASP OXT O N N 78 ASP H H N N 79 ASP H2 H N N 80 ASP HA H N N 81 ASP HB2 H N N 82 ASP HB3 H N N 83 ASP HD2 H N N 84 ASP HXT H N N 85 BG6 C1 C N R 86 BG6 C2 C N R 87 BG6 O1 O N N 88 BG6 O5 O N N 89 BG6 C3 C N S 90 BG6 O2 O N N 91 BG6 C4 C N S 92 BG6 O3 O N N 93 BG6 C5 C N R 94 BG6 O4 O N N 95 BG6 C6 C N N 96 BG6 O6 O N N 97 BG6 P P N N 98 BG6 O1P O N N 99 BG6 O2P O N N 100 BG6 O3P O N N 101 BG6 H1 H N N 102 BG6 H2 H N N 103 BG6 HO1 H N N 104 BG6 H3 H N N 105 BG6 HO2 H N N 106 BG6 H4 H N N 107 BG6 HO3 H N N 108 BG6 H5 H N N 109 BG6 HO4 H N N 110 BG6 H61 H N N 111 BG6 H62 H N N 112 BG6 H1O1 H N N 113 BG6 H2O2 H N N 114 GLN N N N N 115 GLN CA C N S 116 GLN C C N N 117 GLN O O N N 118 GLN CB C N N 119 GLN CG C N N 120 GLN CD C N N 121 GLN OE1 O N N 122 GLN NE2 N N N 123 GLN OXT O N N 124 GLN H H N N 125 GLN H2 H N N 126 GLN HA H N N 127 GLN HB2 H N N 128 GLN HB3 H N N 129 GLN HG2 H N N 130 GLN HG3 H N N 131 GLN HE21 H N N 132 GLN HE22 H N N 133 GLN HXT H N N 134 GLU N N N N 135 GLU CA C N S 136 GLU C C N N 137 GLU O O N N 138 GLU CB C N N 139 GLU CG C N N 140 GLU CD C N N 141 GLU OE1 O N N 142 GLU OE2 O N N 143 GLU OXT O N N 144 GLU H H N N 145 GLU H2 H N N 146 GLU HA H N N 147 GLU HB2 H N N 148 GLU HB3 H N N 149 GLU HG2 H N N 150 GLU HG3 H N N 151 GLU HE2 H N N 152 GLU HXT H N N 153 GLY N N N N 154 GLY CA C N N 155 GLY C C N N 156 GLY O O N N 157 GLY OXT O N N 158 GLY H H N N 159 GLY H2 H N N 160 GLY HA2 H N N 161 GLY HA3 H N N 162 GLY HXT H N N 163 HIS N N N N 164 HIS CA C N S 165 HIS C C N N 166 HIS O O N N 167 HIS CB C N N 168 HIS CG C Y N 169 HIS ND1 N Y N 170 HIS CD2 C Y N 171 HIS CE1 C Y N 172 HIS NE2 N Y N 173 HIS OXT O N N 174 HIS H H N N 175 HIS H2 H N N 176 HIS HA H N N 177 HIS HB2 H N N 178 HIS HB3 H N N 179 HIS HD1 H N N 180 HIS HD2 H N N 181 HIS HE1 H N N 182 HIS HE2 H N N 183 HIS HXT H N N 184 HOH O O N N 185 HOH H1 H N N 186 HOH H2 H N N 187 ILE N N N N 188 ILE CA C N S 189 ILE C C N N 190 ILE O O N N 191 ILE CB C N S 192 ILE CG1 C N N 193 ILE CG2 C N N 194 ILE CD1 C N N 195 ILE OXT O N N 196 ILE H H N N 197 ILE H2 H N N 198 ILE HA H N N 199 ILE HB H N N 200 ILE HG12 H N N 201 ILE HG13 H N N 202 ILE HG21 H N N 203 ILE HG22 H N N 204 ILE HG23 H N N 205 ILE HD11 H N N 206 ILE HD12 H N N 207 ILE HD13 H N N 208 ILE HXT H N N 209 LEU N N N N 210 LEU CA C N S 211 LEU C C N N 212 LEU O O N N 213 LEU CB C N N 214 LEU CG C N N 215 LEU CD1 C N N 216 LEU CD2 C N N 217 LEU OXT O N N 218 LEU H H N N 219 LEU H2 H N N 220 LEU HA H N N 221 LEU HB2 H N N 222 LEU HB3 H N N 223 LEU HG H N N 224 LEU HD11 H N N 225 LEU HD12 H N N 226 LEU HD13 H N N 227 LEU HD21 H N N 228 LEU HD22 H N N 229 LEU HD23 H N N 230 LEU HXT H N N 231 LYS N N N N 232 LYS CA C N S 233 LYS C C N N 234 LYS O O N N 235 LYS CB C N N 236 LYS CG C N N 237 LYS CD C N N 238 LYS CE C N N 239 LYS NZ N N N 240 LYS OXT O N N 241 LYS H H N N 242 LYS H2 H N N 243 LYS HA H N N 244 LYS HB2 H N N 245 LYS HB3 H N N 246 LYS HG2 H N N 247 LYS HG3 H N N 248 LYS HD2 H N N 249 LYS HD3 H N N 250 LYS HE2 H N N 251 LYS HE3 H N N 252 LYS HZ1 H N N 253 LYS HZ2 H N N 254 LYS HZ3 H N N 255 LYS HXT H N N 256 MET N N N N 257 MET CA C N S 258 MET C C N N 259 MET O O N N 260 MET CB C N N 261 MET CG C N N 262 MET SD S N N 263 MET CE C N N 264 MET OXT O N N 265 MET H H N N 266 MET H2 H N N 267 MET HA H N N 268 MET HB2 H N N 269 MET HB3 H N N 270 MET HG2 H N N 271 MET HG3 H N N 272 MET HE1 H N N 273 MET HE2 H N N 274 MET HE3 H N N 275 MET HXT H N N 276 MG MG MG N N 277 NA NA NA N N 278 PHE N N N N 279 PHE CA C N S 280 PHE C C N N 281 PHE O O N N 282 PHE CB C N N 283 PHE CG C Y N 284 PHE CD1 C Y N 285 PHE CD2 C Y N 286 PHE CE1 C Y N 287 PHE CE2 C Y N 288 PHE CZ C Y N 289 PHE OXT O N N 290 PHE H H N N 291 PHE H2 H N N 292 PHE HA H N N 293 PHE HB2 H N N 294 PHE HB3 H N N 295 PHE HD1 H N N 296 PHE HD2 H N N 297 PHE HE1 H N N 298 PHE HE2 H N N 299 PHE HZ H N N 300 PHE HXT H N N 301 PRO N N N N 302 PRO CA C N S 303 PRO C C N N 304 PRO O O N N 305 PRO CB C N N 306 PRO CG C N N 307 PRO CD C N N 308 PRO OXT O N N 309 PRO H H N N 310 PRO HA H N N 311 PRO HB2 H N N 312 PRO HB3 H N N 313 PRO HG2 H N N 314 PRO HG3 H N N 315 PRO HD2 H N N 316 PRO HD3 H N N 317 PRO HXT H N N 318 SER N N N N 319 SER CA C N S 320 SER C C N N 321 SER O O N N 322 SER CB C N N 323 SER OG O N N 324 SER OXT O N N 325 SER H H N N 326 SER H2 H N N 327 SER HA H N N 328 SER HB2 H N N 329 SER HB3 H N N 330 SER HG H N N 331 SER HXT H N N 332 THR N N N N 333 THR CA C N S 334 THR C C N N 335 THR O O N N 336 THR CB C N R 337 THR OG1 O N N 338 THR CG2 C N N 339 THR OXT O N N 340 THR H H N N 341 THR H2 H N N 342 THR HA H N N 343 THR HB H N N 344 THR HG1 H N N 345 THR HG21 H N N 346 THR HG22 H N N 347 THR HG23 H N N 348 THR HXT H N N 349 TRP N N N N 350 TRP CA C N S 351 TRP C C N N 352 TRP O O N N 353 TRP CB C N N 354 TRP CG C Y N 355 TRP CD1 C Y N 356 TRP CD2 C Y N 357 TRP NE1 N Y N 358 TRP CE2 C Y N 359 TRP CE3 C Y N 360 TRP CZ2 C Y N 361 TRP CZ3 C Y N 362 TRP CH2 C Y N 363 TRP OXT O N N 364 TRP H H N N 365 TRP H2 H N N 366 TRP HA H N N 367 TRP HB2 H N N 368 TRP HB3 H N N 369 TRP HD1 H N N 370 TRP HE1 H N N 371 TRP HE3 H N N 372 TRP HZ2 H N N 373 TRP HZ3 H N N 374 TRP HH2 H N N 375 TRP HXT H N N 376 TYR N N N N 377 TYR CA C N S 378 TYR C C N N 379 TYR O O N N 380 TYR CB C N N 381 TYR CG C Y N 382 TYR CD1 C Y N 383 TYR CD2 C Y N 384 TYR CE1 C Y N 385 TYR CE2 C Y N 386 TYR CZ C Y N 387 TYR OH O N N 388 TYR OXT O N N 389 TYR H H N N 390 TYR H2 H N N 391 TYR HA H N N 392 TYR HB2 H N N 393 TYR HB3 H N N 394 TYR HD1 H N N 395 TYR HD2 H N N 396 TYR HE1 H N N 397 TYR HE2 H N N 398 TYR HH H N N 399 TYR HXT H N N 400 VAL N N N N 401 VAL CA C N S 402 VAL C C N N 403 VAL O O N N 404 VAL CB C N N 405 VAL CG1 C N N 406 VAL CG2 C N N 407 VAL OXT O N N 408 VAL H H N N 409 VAL H2 H N N 410 VAL HA H N N 411 VAL HB H N N 412 VAL HG11 H N N 413 VAL HG12 H N N 414 VAL HG13 H N N 415 VAL HG21 H N N 416 VAL HG22 H N N 417 VAL HG23 H N N 418 VAL HXT H N N 419 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ALF AL F1 sing N N 19 ALF AL F2 sing N N 20 ALF AL F3 sing N N 21 ALF AL F4 sing N N 22 ARG N CA sing N N 23 ARG N H sing N N 24 ARG N H2 sing N N 25 ARG CA C sing N N 26 ARG CA CB sing N N 27 ARG CA HA sing N N 28 ARG C O doub N N 29 ARG C OXT sing N N 30 ARG CB CG sing N N 31 ARG CB HB2 sing N N 32 ARG CB HB3 sing N N 33 ARG CG CD sing N N 34 ARG CG HG2 sing N N 35 ARG CG HG3 sing N N 36 ARG CD NE sing N N 37 ARG CD HD2 sing N N 38 ARG CD HD3 sing N N 39 ARG NE CZ sing N N 40 ARG NE HE sing N N 41 ARG CZ NH1 sing N N 42 ARG CZ NH2 doub N N 43 ARG NH1 HH11 sing N N 44 ARG NH1 HH12 sing N N 45 ARG NH2 HH21 sing N N 46 ARG NH2 HH22 sing N N 47 ARG OXT HXT sing N N 48 ASN N CA sing N N 49 ASN N H sing N N 50 ASN N H2 sing N N 51 ASN CA C sing N N 52 ASN CA CB sing N N 53 ASN CA HA sing N N 54 ASN C O doub N N 55 ASN C OXT sing N N 56 ASN CB CG sing N N 57 ASN CB HB2 sing N N 58 ASN CB HB3 sing N N 59 ASN CG OD1 doub N N 60 ASN CG ND2 sing N N 61 ASN ND2 HD21 sing N N 62 ASN ND2 HD22 sing N N 63 ASN OXT HXT sing N N 64 ASP N CA sing N N 65 ASP N H sing N N 66 ASP N H2 sing N N 67 ASP CA C sing N N 68 ASP CA CB sing N N 69 ASP CA HA sing N N 70 ASP C O doub N N 71 ASP C OXT sing N N 72 ASP CB CG sing N N 73 ASP CB HB2 sing N N 74 ASP CB HB3 sing N N 75 ASP CG OD1 doub N N 76 ASP CG OD2 sing N N 77 ASP OD2 HD2 sing N N 78 ASP OXT HXT sing N N 79 BG6 C1 C2 sing N N 80 BG6 C1 O1 sing N N 81 BG6 C1 O5 sing N N 82 BG6 C1 H1 sing N N 83 BG6 C2 C3 sing N N 84 BG6 C2 O2 sing N N 85 BG6 C2 H2 sing N N 86 BG6 O1 HO1 sing N N 87 BG6 O5 C5 sing N N 88 BG6 C3 C4 sing N N 89 BG6 C3 O3 sing N N 90 BG6 C3 H3 sing N N 91 BG6 O2 HO2 sing N N 92 BG6 C4 C5 sing N N 93 BG6 C4 O4 sing N N 94 BG6 C4 H4 sing N N 95 BG6 O3 HO3 sing N N 96 BG6 C5 C6 sing N N 97 BG6 C5 H5 sing N N 98 BG6 O4 HO4 sing N N 99 BG6 C6 O6 sing N N 100 BG6 C6 H61 sing N N 101 BG6 C6 H62 sing N N 102 BG6 O6 P sing N N 103 BG6 P O1P sing N N 104 BG6 P O2P sing N N 105 BG6 P O3P doub N N 106 BG6 O1P H1O1 sing N N 107 BG6 O2P H2O2 sing N N 108 GLN N CA sing N N 109 GLN N H sing N N 110 GLN N H2 sing N N 111 GLN CA C sing N N 112 GLN CA CB sing N N 113 GLN CA HA sing N N 114 GLN C O doub N N 115 GLN C OXT sing N N 116 GLN CB CG sing N N 117 GLN CB HB2 sing N N 118 GLN CB HB3 sing N N 119 GLN CG CD sing N N 120 GLN CG HG2 sing N N 121 GLN CG HG3 sing N N 122 GLN CD OE1 doub N N 123 GLN CD NE2 sing N N 124 GLN NE2 HE21 sing N N 125 GLN NE2 HE22 sing N N 126 GLN OXT HXT sing N N 127 GLU N CA sing N N 128 GLU N H sing N N 129 GLU N H2 sing N N 130 GLU CA C sing N N 131 GLU CA CB sing N N 132 GLU CA HA sing N N 133 GLU C O doub N N 134 GLU C OXT sing N N 135 GLU CB CG sing N N 136 GLU CB HB2 sing N N 137 GLU CB HB3 sing N N 138 GLU CG CD sing N N 139 GLU CG HG2 sing N N 140 GLU CG HG3 sing N N 141 GLU CD OE1 doub N N 142 GLU CD OE2 sing N N 143 GLU OE2 HE2 sing N N 144 GLU OXT HXT sing N N 145 GLY N CA sing N N 146 GLY N H sing N N 147 GLY N H2 sing N N 148 GLY CA C sing N N 149 GLY CA HA2 sing N N 150 GLY CA HA3 sing N N 151 GLY C O doub N N 152 GLY C OXT sing N N 153 GLY OXT HXT sing N N 154 HIS N CA sing N N 155 HIS N H sing N N 156 HIS N H2 sing N N 157 HIS CA C sing N N 158 HIS CA CB sing N N 159 HIS CA HA sing N N 160 HIS C O doub N N 161 HIS C OXT sing N N 162 HIS CB CG sing N N 163 HIS CB HB2 sing N N 164 HIS CB HB3 sing N N 165 HIS CG ND1 sing Y N 166 HIS CG CD2 doub Y N 167 HIS ND1 CE1 doub Y N 168 HIS ND1 HD1 sing N N 169 HIS CD2 NE2 sing Y N 170 HIS CD2 HD2 sing N N 171 HIS CE1 NE2 sing Y N 172 HIS CE1 HE1 sing N N 173 HIS NE2 HE2 sing N N 174 HIS OXT HXT sing N N 175 HOH O H1 sing N N 176 HOH O H2 sing N N 177 ILE N CA sing N N 178 ILE N H sing N N 179 ILE N H2 sing N N 180 ILE CA C sing N N 181 ILE CA CB sing N N 182 ILE CA HA sing N N 183 ILE C O doub N N 184 ILE C OXT sing N N 185 ILE CB CG1 sing N N 186 ILE CB CG2 sing N N 187 ILE CB HB sing N N 188 ILE CG1 CD1 sing N N 189 ILE CG1 HG12 sing N N 190 ILE CG1 HG13 sing N N 191 ILE CG2 HG21 sing N N 192 ILE CG2 HG22 sing N N 193 ILE CG2 HG23 sing N N 194 ILE CD1 HD11 sing N N 195 ILE CD1 HD12 sing N N 196 ILE CD1 HD13 sing N N 197 ILE OXT HXT sing N N 198 LEU N CA sing N N 199 LEU N H sing N N 200 LEU N H2 sing N N 201 LEU CA C sing N N 202 LEU CA CB sing N N 203 LEU CA HA sing N N 204 LEU C O doub N N 205 LEU C OXT sing N N 206 LEU CB CG sing N N 207 LEU CB HB2 sing N N 208 LEU CB HB3 sing N N 209 LEU CG CD1 sing N N 210 LEU CG CD2 sing N N 211 LEU CG HG sing N N 212 LEU CD1 HD11 sing N N 213 LEU CD1 HD12 sing N N 214 LEU CD1 HD13 sing N N 215 LEU CD2 HD21 sing N N 216 LEU CD2 HD22 sing N N 217 LEU CD2 HD23 sing N N 218 LEU OXT HXT sing N N 219 LYS N CA sing N N 220 LYS N H sing N N 221 LYS N H2 sing N N 222 LYS CA C sing N N 223 LYS CA CB sing N N 224 LYS CA HA sing N N 225 LYS C O doub N N 226 LYS C OXT sing N N 227 LYS CB CG sing N N 228 LYS CB HB2 sing N N 229 LYS CB HB3 sing N N 230 LYS CG CD sing N N 231 LYS CG HG2 sing N N 232 LYS CG HG3 sing N N 233 LYS CD CE sing N N 234 LYS CD HD2 sing N N 235 LYS CD HD3 sing N N 236 LYS CE NZ sing N N 237 LYS CE HE2 sing N N 238 LYS CE HE3 sing N N 239 LYS NZ HZ1 sing N N 240 LYS NZ HZ2 sing N N 241 LYS NZ HZ3 sing N N 242 LYS OXT HXT sing N N 243 MET N CA sing N N 244 MET N H sing N N 245 MET N H2 sing N N 246 MET CA C sing N N 247 MET CA CB sing N N 248 MET CA HA sing N N 249 MET C O doub N N 250 MET C OXT sing N N 251 MET CB CG sing N N 252 MET CB HB2 sing N N 253 MET CB HB3 sing N N 254 MET CG SD sing N N 255 MET CG HG2 sing N N 256 MET CG HG3 sing N N 257 MET SD CE sing N N 258 MET CE HE1 sing N N 259 MET CE HE2 sing N N 260 MET CE HE3 sing N N 261 MET OXT HXT sing N N 262 PHE N CA sing N N 263 PHE N H sing N N 264 PHE N H2 sing N N 265 PHE CA C sing N N 266 PHE CA CB sing N N 267 PHE CA HA sing N N 268 PHE C O doub N N 269 PHE C OXT sing N N 270 PHE CB CG sing N N 271 PHE CB HB2 sing N N 272 PHE CB HB3 sing N N 273 PHE CG CD1 doub Y N 274 PHE CG CD2 sing Y N 275 PHE CD1 CE1 sing Y N 276 PHE CD1 HD1 sing N N 277 PHE CD2 CE2 doub Y N 278 PHE CD2 HD2 sing N N 279 PHE CE1 CZ doub Y N 280 PHE CE1 HE1 sing N N 281 PHE CE2 CZ sing Y N 282 PHE CE2 HE2 sing N N 283 PHE CZ HZ sing N N 284 PHE OXT HXT sing N N 285 PRO N CA sing N N 286 PRO N CD sing N N 287 PRO N H sing N N 288 PRO CA C sing N N 289 PRO CA CB sing N N 290 PRO CA HA sing N N 291 PRO C O doub N N 292 PRO C OXT sing N N 293 PRO CB CG sing N N 294 PRO CB HB2 sing N N 295 PRO CB HB3 sing N N 296 PRO CG CD sing N N 297 PRO CG HG2 sing N N 298 PRO CG HG3 sing N N 299 PRO CD HD2 sing N N 300 PRO CD HD3 sing N N 301 PRO OXT HXT sing N N 302 SER N CA sing N N 303 SER N H sing N N 304 SER N H2 sing N N 305 SER CA C sing N N 306 SER CA CB sing N N 307 SER CA HA sing N N 308 SER C O doub N N 309 SER C OXT sing N N 310 SER CB OG sing N N 311 SER CB HB2 sing N N 312 SER CB HB3 sing N N 313 SER OG HG sing N N 314 SER OXT HXT sing N N 315 THR N CA sing N N 316 THR N H sing N N 317 THR N H2 sing N N 318 THR CA C sing N N 319 THR CA CB sing N N 320 THR CA HA sing N N 321 THR C O doub N N 322 THR C OXT sing N N 323 THR CB OG1 sing N N 324 THR CB CG2 sing N N 325 THR CB HB sing N N 326 THR OG1 HG1 sing N N 327 THR CG2 HG21 sing N N 328 THR CG2 HG22 sing N N 329 THR CG2 HG23 sing N N 330 THR OXT HXT sing N N 331 TRP N CA sing N N 332 TRP N H sing N N 333 TRP N H2 sing N N 334 TRP CA C sing N N 335 TRP CA CB sing N N 336 TRP CA HA sing N N 337 TRP C O doub N N 338 TRP C OXT sing N N 339 TRP CB CG sing N N 340 TRP CB HB2 sing N N 341 TRP CB HB3 sing N N 342 TRP CG CD1 doub Y N 343 TRP CG CD2 sing Y N 344 TRP CD1 NE1 sing Y N 345 TRP CD1 HD1 sing N N 346 TRP CD2 CE2 doub Y N 347 TRP CD2 CE3 sing Y N 348 TRP NE1 CE2 sing Y N 349 TRP NE1 HE1 sing N N 350 TRP CE2 CZ2 sing Y N 351 TRP CE3 CZ3 doub Y N 352 TRP CE3 HE3 sing N N 353 TRP CZ2 CH2 doub Y N 354 TRP CZ2 HZ2 sing N N 355 TRP CZ3 CH2 sing Y N 356 TRP CZ3 HZ3 sing N N 357 TRP CH2 HH2 sing N N 358 TRP OXT HXT sing N N 359 TYR N CA sing N N 360 TYR N H sing N N 361 TYR N H2 sing N N 362 TYR CA C sing N N 363 TYR CA CB sing N N 364 TYR CA HA sing N N 365 TYR C O doub N N 366 TYR C OXT sing N N 367 TYR CB CG sing N N 368 TYR CB HB2 sing N N 369 TYR CB HB3 sing N N 370 TYR CG CD1 doub Y N 371 TYR CG CD2 sing Y N 372 TYR CD1 CE1 sing Y N 373 TYR CD1 HD1 sing N N 374 TYR CD2 CE2 doub Y N 375 TYR CD2 HD2 sing N N 376 TYR CE1 CZ doub Y N 377 TYR CE1 HE1 sing N N 378 TYR CE2 CZ sing Y N 379 TYR CE2 HE2 sing N N 380 TYR CZ OH sing N N 381 TYR OH HH sing N N 382 TYR OXT HXT sing N N 383 VAL N CA sing N N 384 VAL N H sing N N 385 VAL N H2 sing N N 386 VAL CA C sing N N 387 VAL CA CB sing N N 388 VAL CA HA sing N N 389 VAL C O doub N N 390 VAL C OXT sing N N 391 VAL CB CG1 sing N N 392 VAL CB CG2 sing N N 393 VAL CB HB sing N N 394 VAL CG1 HG11 sing N N 395 VAL CG1 HG12 sing N N 396 VAL CG1 HG13 sing N N 397 VAL CG2 HG21 sing N N 398 VAL CG2 HG22 sing N N 399 VAL CG2 HG23 sing N N 400 VAL OXT HXT sing N N 401 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Biotechnology and Biological Sciences Research Council' 'United Kingdom' BB/M021637/1 1 'Biotechnology and Biological Sciences Research Council' 'United Kingdom' BB/K016245/1 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2WF6 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6I03 _atom_sites.fract_transf_matrix[1][1] 0.026652 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018423 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009577 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol AL C F MG N NA O P S # loop_