data_6IKT # _entry.id 6IKT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6IKT pdb_00006ikt 10.2210/pdb6ikt/pdb WWPDB D_1300009179 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6IKT _pdbx_database_status.recvd_initial_deposition_date 2018-10-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lee, I.H.' 1 ? 'Kang, L.W.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'K1U complex structure of peptide deformylase from Xanthomonas oryzae pv. oryzae' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, I.H.' 1 ? primary 'Kang, L.W.' 2 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6IKT _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.880 _cell.length_a_esd ? _cell.length_b 58.880 _cell.length_b_esd ? _cell.length_c 265.292 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6IKT _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptide deformylase' 18901.410 1 3.5.1.88 ? ? ? 2 non-polymer syn 'CADMIUM ION' 112.411 2 ? ? ? ? 3 non-polymer syn 'NICKEL (II) ION' 58.693 2 ? ? ? ? 4 non-polymer syn '(3R)-3-benzyl-4-oxo-4-[(2-oxo-2-phenylethyl)sulfanyl]butanoic acid' 342.409 1 ? ? ? ? 5 water nat water 18.015 38 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PDF,Polypeptide deformylase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MIRDIIRMGDKRLLRVAPQVTNLGSAELHALVSDMFETMGAAHGVGLAAPQIAVDLQLMVFGFEASERYPEAPAVPLTAL ANAQIEPLSDEMENGWEG(CSD)LSIPGLRAVIPRYRYIRYRGFAPDGSPIEREAEGFHARVVQHEYDHLVGRLYPSRIE NFDTFGFDDVLSY ; _entity_poly.pdbx_seq_one_letter_code_can ;MIRDIIRMGDKRLLRVAPQVTNLGSAELHALVSDMFETMGAAHGVGLAAPQIAVDLQLMVFGFEASERYPEAPAVPLTAL ANAQIEPLSDEMENGWEGCLSIPGLRAVIPRYRYIRYRGFAPDGSPIEREAEGFHARVVQHEYDHLVGRLYPSRIENFDT FGFDDVLSY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 ARG n 1 4 ASP n 1 5 ILE n 1 6 ILE n 1 7 ARG n 1 8 MET n 1 9 GLY n 1 10 ASP n 1 11 LYS n 1 12 ARG n 1 13 LEU n 1 14 LEU n 1 15 ARG n 1 16 VAL n 1 17 ALA n 1 18 PRO n 1 19 GLN n 1 20 VAL n 1 21 THR n 1 22 ASN n 1 23 LEU n 1 24 GLY n 1 25 SER n 1 26 ALA n 1 27 GLU n 1 28 LEU n 1 29 HIS n 1 30 ALA n 1 31 LEU n 1 32 VAL n 1 33 SER n 1 34 ASP n 1 35 MET n 1 36 PHE n 1 37 GLU n 1 38 THR n 1 39 MET n 1 40 GLY n 1 41 ALA n 1 42 ALA n 1 43 HIS n 1 44 GLY n 1 45 VAL n 1 46 GLY n 1 47 LEU n 1 48 ALA n 1 49 ALA n 1 50 PRO n 1 51 GLN n 1 52 ILE n 1 53 ALA n 1 54 VAL n 1 55 ASP n 1 56 LEU n 1 57 GLN n 1 58 LEU n 1 59 MET n 1 60 VAL n 1 61 PHE n 1 62 GLY n 1 63 PHE n 1 64 GLU n 1 65 ALA n 1 66 SER n 1 67 GLU n 1 68 ARG n 1 69 TYR n 1 70 PRO n 1 71 GLU n 1 72 ALA n 1 73 PRO n 1 74 ALA n 1 75 VAL n 1 76 PRO n 1 77 LEU n 1 78 THR n 1 79 ALA n 1 80 LEU n 1 81 ALA n 1 82 ASN n 1 83 ALA n 1 84 GLN n 1 85 ILE n 1 86 GLU n 1 87 PRO n 1 88 LEU n 1 89 SER n 1 90 ASP n 1 91 GLU n 1 92 MET n 1 93 GLU n 1 94 ASN n 1 95 GLY n 1 96 TRP n 1 97 GLU n 1 98 GLY n 1 99 CSD n 1 100 LEU n 1 101 SER n 1 102 ILE n 1 103 PRO n 1 104 GLY n 1 105 LEU n 1 106 ARG n 1 107 ALA n 1 108 VAL n 1 109 ILE n 1 110 PRO n 1 111 ARG n 1 112 TYR n 1 113 ARG n 1 114 TYR n 1 115 ILE n 1 116 ARG n 1 117 TYR n 1 118 ARG n 1 119 GLY n 1 120 PHE n 1 121 ALA n 1 122 PRO n 1 123 ASP n 1 124 GLY n 1 125 SER n 1 126 PRO n 1 127 ILE n 1 128 GLU n 1 129 ARG n 1 130 GLU n 1 131 ALA n 1 132 GLU n 1 133 GLY n 1 134 PHE n 1 135 HIS n 1 136 ALA n 1 137 ARG n 1 138 VAL n 1 139 VAL n 1 140 GLN n 1 141 HIS n 1 142 GLU n 1 143 TYR n 1 144 ASP n 1 145 HIS n 1 146 LEU n 1 147 VAL n 1 148 GLY n 1 149 ARG n 1 150 LEU n 1 151 TYR n 1 152 PRO n 1 153 SER n 1 154 ARG n 1 155 ILE n 1 156 GLU n 1 157 ASN n 1 158 PHE n 1 159 ASP n 1 160 THR n 1 161 PHE n 1 162 GLY n 1 163 PHE n 1 164 ASP n 1 165 ASP n 1 166 VAL n 1 167 LEU n 1 168 SER n 1 169 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 169 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'def, XOO1075' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'KACC10331 / KXO85' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Xanthomonas oryzae pv. oryzae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 291331 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5H3Z2_XANOR _struct_ref.pdbx_db_accession Q5H3Z2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIRDIIRMGDKRLLRVAPQVTNLGSAELHALVSDMFETMGAAHGVGLAAPQIAVDLQLMVFGFEASERYPEAPAVPLTAL ANAQIEPLSDEMENGWEGCLSIPGLRAVIPRYRYIRYRGFAPDGSPIEREAEGFHARVVQHEYDHLVGRLYPSRIENFDT FGFDDVLSY ; _struct_ref.pdbx_align_begin 42 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6IKT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 169 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5H3Z2 _struct_ref_seq.db_align_beg 42 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 210 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 169 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CD non-polymer . 'CADMIUM ION' ? 'Cd 2' 112.411 CSD 'L-peptide linking' n 3-SULFINOALANINE 'S-CYSTEINESULFINIC ACID; S-SULFINOCYSTEINE' 'C3 H7 N O4 S' 153.157 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K1U non-polymer . '(3R)-3-benzyl-4-oxo-4-[(2-oxo-2-phenylethyl)sulfanyl]butanoic acid' ? 'C19 H18 O4 S' 342.409 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6IKT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.74 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 67.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 287 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.05M cadmium sulfate, 0.1M HEPES pH 7.5, 2.0M sodium acetate trihydrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-03-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97940 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97940 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6IKT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.900 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21949 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.700 _reflns.pdbx_Rmerge_I_obs 0.161 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 9.744 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.169 _reflns.pdbx_Rpim_I_all 0.049 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.900 1.930 ? ? ? ? ? ? 982 91.600 ? ? ? ? 0.516 ? ? ? ? ? ? ? ? 4.000 ? 2.249 ? ? 0.588 0.269 ? 1 1 0.057 ? 1.930 1.970 ? ? ? ? ? ? 1027 91.900 ? ? ? ? 0.477 ? ? ? ? ? ? ? ? 4.500 ? 2.277 ? ? 0.533 0.228 ? 2 1 0.290 ? 1.970 2.010 ? ? ? ? ? ? 1011 94.400 ? ? ? ? 0.431 ? ? ? ? ? ? ? ? 4.900 ? 2.344 ? ? 0.476 0.195 ? 3 1 0.433 ? 2.010 2.050 ? ? ? ? ? ? 1057 95.100 ? ? ? ? 0.421 ? ? ? ? ? ? ? ? 5.400 ? 2.544 ? ? 0.462 0.181 ? 4 1 0.450 ? 2.050 2.090 ? ? ? ? ? ? 1056 95.900 ? ? ? ? 0.396 ? ? ? ? ? ? ? ? 5.900 ? 2.599 ? ? 0.431 0.163 ? 5 1 0.693 ? 2.090 2.140 ? ? ? ? ? ? 1064 96.100 ? ? ? ? 0.348 ? ? ? ? ? ? ? ? 6.200 ? 2.780 ? ? 0.376 0.136 ? 6 1 0.804 ? 2.140 2.190 ? ? ? ? ? ? 1062 96.400 ? ? ? ? 0.321 ? ? ? ? ? ? ? ? 6.500 ? 2.912 ? ? 0.345 0.122 ? 7 1 0.849 ? 2.190 2.250 ? ? ? ? ? ? 1078 96.500 ? ? ? ? 0.286 ? ? ? ? ? ? ? ? 6.800 ? 3.261 ? ? 0.306 0.104 ? 8 1 0.916 ? 2.250 2.320 ? ? ? ? ? ? 1067 96.500 ? ? ? ? 0.267 ? ? ? ? ? ? ? ? 7.400 ? 3.434 ? ? 0.285 0.095 ? 9 1 0.910 ? 2.320 2.390 ? ? ? ? ? ? 1080 97.600 ? ? ? ? 0.259 ? ? ? ? ? ? ? ? 7.600 ? 3.388 ? ? 0.276 0.091 ? 10 1 0.931 ? 2.390 2.480 ? ? ? ? ? ? 1097 97.000 ? ? ? ? 0.232 ? ? ? ? ? ? ? ? 8.000 ? 3.897 ? ? 0.246 0.079 ? 11 1 0.963 ? 2.480 2.580 ? ? ? ? ? ? 1074 97.000 ? ? ? ? 0.219 ? ? ? ? ? ? ? ? 8.700 ? 4.492 ? ? 0.231 0.071 ? 12 1 0.970 ? 2.580 2.700 ? ? ? ? ? ? 1112 97.500 ? ? ? ? 0.193 ? ? ? ? ? ? ? ? 9.100 ? 5.284 ? ? 0.203 0.061 ? 13 1 0.978 ? 2.700 2.840 ? ? ? ? ? ? 1103 98.200 ? ? ? ? 0.183 ? ? ? ? ? ? ? ? 9.900 ? 6.520 ? ? 0.191 0.055 ? 14 1 0.979 ? 2.840 3.020 ? ? ? ? ? ? 1112 98.100 ? ? ? ? 0.176 ? ? ? ? ? ? ? ? 10.600 ? 8.549 ? ? 0.183 0.051 ? 15 1 0.984 ? 3.020 3.250 ? ? ? ? ? ? 1146 98.700 ? ? ? ? 0.161 ? ? ? ? ? ? ? ? 11.600 ? 10.186 ? ? 0.167 0.045 ? 16 1 0.991 ? 3.250 3.580 ? ? ? ? ? ? 1138 99.000 ? ? ? ? 0.164 ? ? ? ? ? ? ? ? 12.800 ? 17.156 ? ? 0.170 0.044 ? 17 1 0.986 ? 3.580 4.090 ? ? ? ? ? ? 1177 99.200 ? ? ? ? 0.150 ? ? ? ? ? ? ? ? 13.600 ? 20.755 ? ? 0.155 0.039 ? 18 1 0.993 ? 4.090 5.160 ? ? ? ? ? ? 1196 99.000 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 13.400 ? 20.128 ? ? 0.121 0.031 ? 19 1 0.994 ? 5.160 50.000 ? ? ? ? ? ? 1310 96.100 ? ? ? ? 0.099 ? ? ? ? ? ? ? ? 12.800 ? 16.613 ? ? 0.103 0.027 ? 20 1 0.996 ? # _refine.aniso_B[1][1] 0.0000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.0000 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -0.0000 _refine.B_iso_max 77.710 _refine.B_iso_mean 22.0410 _refine.B_iso_min 11.200 _refine.correlation_coeff_Fo_to_Fc 0.9400 _refine.correlation_coeff_Fo_to_Fc_free 0.9210 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6IKT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9000 _refine.ls_d_res_low 49.9000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20787 _refine.ls_number_reflns_R_free 1144 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.0100 _refine.ls_percent_reflns_R_free 5.2000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2048 _refine.ls_R_factor_R_free 0.2392 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2029 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5E5D _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1150 _refine.pdbx_overall_ESU_R_Free 0.1170 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 3.1650 _refine.overall_SU_ML 0.0880 _refine.overall_SU_R_Cruickshank_DPI 0.1148 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.9000 _refine_hist.d_res_low 49.9000 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 1304 _refine_hist.pdbx_number_residues_total 160 _refine_hist.pdbx_B_iso_mean_ligand 45.40 _refine_hist.pdbx_B_iso_mean_solvent 22.72 _refine_hist.pdbx_number_atoms_protein 1239 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.019 0.019 1291 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1193 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.187 1.986 1748 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.105 3.000 2741 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.236 5.000 157 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.929 22.623 61 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.306 15.000 199 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.669 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.142 0.200 189 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.011 0.021 1452 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 285 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.9010 _refine_ls_shell.d_res_low 1.9500 _refine_ls_shell.number_reflns_all 1457 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 75 _refine_ls_shell.number_reflns_R_work 1382 _refine_ls_shell.percent_reflns_obs 91.4100 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3660 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3230 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6IKT _struct.title 'K1U complex structure of peptide deformylase from Xanthomonas oryzae pv. oryzae' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6IKT _struct_keywords.text 'peptide deformylase, hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 10 ? ARG A 15 ? ASP A 10 ARG A 15 5 ? 6 HELX_P HELX_P2 AA2 SER A 25 ? ALA A 42 ? SER A 25 ALA A 42 1 ? 18 HELX_P HELX_P3 AA3 PRO A 50 ? ALA A 53 ? PRO A 50 ALA A 53 5 ? 4 HELX_P HELX_P4 AA4 GLY A 133 ? VAL A 147 ? GLY A 133 VAL A 147 1 ? 15 HELX_P HELX_P5 AA5 LEU A 150 ? ILE A 155 ? LEU A 150 ILE A 155 5 ? 6 HELX_P HELX_P6 AA6 ASN A 157 ? PHE A 161 ? ASN A 157 PHE A 161 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLY 98 C ? ? ? 1_555 A CSD 99 N ? ? A GLY 98 A CSD 99 1_555 ? ? ? ? ? ? ? 1.318 ? ? covale2 covale both ? A CSD 99 C ? ? ? 1_555 A LEU 100 N ? ? A CSD 99 A LEU 100 1_555 ? ? ? ? ? ? ? 1.326 ? ? metalc1 metalc ? ? A GLU 37 OE2 ? ? ? 1_555 E NI . NI ? ? A GLU 37 A NI 204 1_555 ? ? ? ? ? ? ? 2.346 ? ? metalc2 metalc ? ? A HIS 43 NE2 ? ? ? 1_555 C CD . CD ? ? A HIS 43 A CD 202 1_555 ? ? ? ? ? ? ? 2.269 ? ? metalc3 metalc ? ? A GLU 91 OE1 ? ? ? 1_555 D NI . NI ? ? A GLU 91 A NI 203 1_555 ? ? ? ? ? ? ? 2.097 ? ? metalc4 metalc ? ? A CSD 99 SG ? ? ? 1_555 B CD . CD ? ? A CSD 99 A CD 201 1_555 ? ? ? ? ? ? ? 2.548 ? ? metalc5 metalc ? ? A GLU 128 OE1 ? ? ? 1_555 C CD . CD ? ? A GLU 128 A CD 202 8_665 ? ? ? ? ? ? ? 2.488 ? ? metalc6 metalc ? ? A GLU 128 OE2 ? ? ? 1_555 C CD . CD ? ? A GLU 128 A CD 202 8_665 ? ? ? ? ? ? ? 2.539 ? ? metalc7 metalc ? ? A GLU 130 OE1 ? ? ? 1_555 C CD . CD ? ? A GLU 130 A CD 202 8_665 ? ? ? ? ? ? ? 2.438 ? ? metalc8 metalc ? ? A GLU 132 OE1 ? ? ? 1_555 E NI . NI ? ? A GLU 132 A NI 204 8_665 ? ? ? ? ? ? ? 2.523 ? ? metalc9 metalc ? ? A GLU 132 OE2 ? ? ? 1_555 E NI . NI ? ? A GLU 132 A NI 204 8_665 ? ? ? ? ? ? ? 2.352 ? ? metalc10 metalc ? ? A HIS 141 NE2 ? ? ? 1_555 B CD . CD ? ? A HIS 141 A CD 201 1_555 ? ? ? ? ? ? ? 2.349 ? ? metalc11 metalc ? ? A HIS 145 NE2 ? ? ? 1_555 B CD . CD ? ? A HIS 145 A CD 201 1_555 ? ? ? ? ? ? ? 2.346 ? ? metalc12 metalc ? ? B CD . CD ? ? ? 1_555 F K1U . O1 ? ? A CD 201 A K1U 205 1_555 ? ? ? ? ? ? ? 2.462 ? ? metalc13 metalc ? ? B CD . CD ? ? ? 1_555 F K1U . O2 ? ? A CD 201 A K1U 205 1_555 ? ? ? ? ? ? ? 1.764 ? ? metalc14 metalc ? ? C CD . CD ? ? ? 1_555 G HOH . O ? ? A CD 202 A HOH 308 8_565 ? ? ? ? ? ? ? 2.249 ? ? metalc15 metalc ? ? C CD . CD ? ? ? 1_555 G HOH . O ? ? A CD 202 A HOH 336 8_565 ? ? ? ? ? ? ? 2.408 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 46 ? ALA A 48 ? GLY A 46 ALA A 48 AA1 2 LEU A 58 ? PHE A 61 ? LEU A 58 PHE A 61 AA1 3 THR A 78 ? PRO A 87 ? THR A 78 PRO A 87 AA1 4 TYR A 114 ? PHE A 120 ? TYR A 114 PHE A 120 AA1 5 PRO A 126 ? GLU A 132 ? PRO A 126 GLU A 132 AA2 1 MET A 92 ? GLU A 97 ? MET A 92 GLU A 97 AA2 2 LEU A 105 ? TYR A 112 ? LEU A 105 TYR A 112 AA2 3 GLY A 162 ? PHE A 163 ? GLY A 162 PHE A 163 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 47 ? N LEU A 47 O VAL A 60 ? O VAL A 60 AA1 2 3 N MET A 59 ? N MET A 59 O LEU A 80 ? O LEU A 80 AA1 3 4 N ALA A 81 ? N ALA A 81 O PHE A 120 ? O PHE A 120 AA1 4 5 N ILE A 115 ? N ILE A 115 O ALA A 131 ? O ALA A 131 AA2 1 2 N GLU A 97 ? N GLU A 97 O ALA A 107 ? O ALA A 107 AA2 2 3 N ARG A 106 ? N ARG A 106 O GLY A 162 ? O GLY A 162 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CD 201 ? 5 'binding site for residue CD A 201' AC2 Software A CD 202 ? 5 'binding site for residue CD A 202' AC3 Software A NI 203 ? 2 'binding site for residue NI A 203' AC4 Software A NI 204 ? 2 'binding site for residue NI A 204' AC5 Software A K1U 205 ? 14 'binding site for residue K1U A 205' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLN A 51 ? GLN A 51 . ? 1_555 ? 2 AC1 5 CSD A 99 ? CSD A 99 . ? 1_555 ? 3 AC1 5 HIS A 141 ? HIS A 141 . ? 1_555 ? 4 AC1 5 HIS A 145 ? HIS A 145 . ? 1_555 ? 5 AC1 5 K1U F . ? K1U A 205 . ? 1_555 ? 6 AC2 5 HIS A 43 ? HIS A 43 . ? 1_555 ? 7 AC2 5 GLU A 128 ? GLU A 128 . ? 8_565 ? 8 AC2 5 GLU A 130 ? GLU A 130 . ? 8_565 ? 9 AC2 5 HOH G . ? HOH A 308 . ? 8_565 ? 10 AC2 5 HOH G . ? HOH A 336 . ? 8_565 ? 11 AC3 2 GLU A 91 ? GLU A 91 . ? 1_555 ? 12 AC3 2 ARG A 113 ? ARG A 113 . ? 1_555 ? 13 AC4 2 GLU A 37 ? GLU A 37 . ? 1_555 ? 14 AC4 2 GLU A 132 ? GLU A 132 . ? 8_565 ? 15 AC5 14 HIS A 43 ? HIS A 43 . ? 1_555 ? 16 AC5 14 GLY A 44 ? GLY A 44 . ? 1_555 ? 17 AC5 14 VAL A 45 ? VAL A 45 . ? 1_555 ? 18 AC5 14 GLY A 46 ? GLY A 46 . ? 1_555 ? 19 AC5 14 GLN A 51 ? GLN A 51 . ? 1_555 ? 20 AC5 14 TRP A 96 ? TRP A 96 . ? 1_555 ? 21 AC5 14 GLU A 97 ? GLU A 97 . ? 1_555 ? 22 AC5 14 GLY A 98 ? GLY A 98 . ? 1_555 ? 23 AC5 14 CSD A 99 ? CSD A 99 . ? 1_555 ? 24 AC5 14 LEU A 100 ? LEU A 100 . ? 1_555 ? 25 AC5 14 HIS A 141 ? HIS A 141 . ? 1_555 ? 26 AC5 14 GLU A 142 ? GLU A 142 . ? 1_555 ? 27 AC5 14 HIS A 145 ? HIS A 145 . ? 1_555 ? 28 AC5 14 CD B . ? CD A 201 . ? 1_555 ? # _atom_sites.entry_id 6IKT _atom_sites.fract_transf_matrix[1][1] 0.016984 _atom_sites.fract_transf_matrix[1][2] 0.009806 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019611 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003769 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CD N NI O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 GLU 64 64 ? ? ? A . n A 1 65 ALA 65 65 ? ? ? A . n A 1 66 SER 66 66 ? ? ? A . n A 1 67 GLU 67 67 ? ? ? A . n A 1 68 ARG 68 68 ? ? ? A . n A 1 69 TYR 69 69 ? ? ? A . n A 1 70 PRO 70 70 ? ? ? A . n A 1 71 GLU 71 71 ? ? ? A . n A 1 72 ALA 72 72 ? ? ? A . n A 1 73 PRO 73 73 ? ? ? A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 MET 92 92 92 MET MET A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 CSD 99 99 99 CSD CSD A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 TYR 143 143 143 TYR TYR A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 HIS 145 145 145 HIS HIS A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 ASN 157 157 157 ASN ASN A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 PHE 163 163 163 PHE PHE A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 TYR 169 169 169 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CD 1 201 1 CD CD A . C 2 CD 1 202 2 CD CD A . D 3 NI 1 203 1 NI NI A . E 3 NI 1 204 2 NI NI A . F 4 K1U 1 205 1 K1U K1U A . G 5 HOH 1 301 38 HOH HOH A . G 5 HOH 2 302 24 HOH HOH A . G 5 HOH 3 303 16 HOH HOH A . G 5 HOH 4 304 26 HOH HOH A . G 5 HOH 5 305 22 HOH HOH A . G 5 HOH 6 306 20 HOH HOH A . G 5 HOH 7 307 14 HOH HOH A . G 5 HOH 8 308 2 HOH HOH A . G 5 HOH 9 309 5 HOH HOH A . G 5 HOH 10 310 8 HOH HOH A . G 5 HOH 11 311 23 HOH HOH A . G 5 HOH 12 312 9 HOH HOH A . G 5 HOH 13 313 10 HOH HOH A . G 5 HOH 14 314 12 HOH HOH A . G 5 HOH 15 315 35 HOH HOH A . G 5 HOH 16 316 31 HOH HOH A . G 5 HOH 17 317 15 HOH HOH A . G 5 HOH 18 318 27 HOH HOH A . G 5 HOH 19 319 17 HOH HOH A . G 5 HOH 20 320 29 HOH HOH A . G 5 HOH 21 321 34 HOH HOH A . G 5 HOH 22 322 1 HOH HOH A . G 5 HOH 23 323 21 HOH HOH A . G 5 HOH 24 324 32 HOH HOH A . G 5 HOH 25 325 6 HOH HOH A . G 5 HOH 26 326 11 HOH HOH A . G 5 HOH 27 327 4 HOH HOH A . G 5 HOH 28 328 39 HOH HOH A . G 5 HOH 29 329 37 HOH HOH A . G 5 HOH 30 330 30 HOH HOH A . G 5 HOH 31 331 33 HOH HOH A . G 5 HOH 32 332 13 HOH HOH A . G 5 HOH 33 333 7 HOH HOH A . G 5 HOH 34 334 28 HOH HOH A . G 5 HOH 35 335 25 HOH HOH A . G 5 HOH 36 336 3 HOH HOH A . G 5 HOH 37 337 41 HOH HOH A . G 5 HOH 38 338 40 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CSD _pdbx_struct_mod_residue.label_seq_id 99 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CSD _pdbx_struct_mod_residue.auth_seq_id 99 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 270 ? 1 MORE -15 ? 1 'SSA (A^2)' 8100 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 37 ? A GLU 37 ? 1_555 NI ? E NI . ? A NI 204 ? 1_555 OE1 ? A GLU 132 ? A GLU 132 ? 1_555 30.0 ? 2 OE2 ? A GLU 37 ? A GLU 37 ? 1_555 NI ? E NI . ? A NI 204 ? 1_555 OE2 ? A GLU 132 ? A GLU 132 ? 1_555 32.3 ? 3 OE1 ? A GLU 132 ? A GLU 132 ? 1_555 NI ? E NI . ? A NI 204 ? 1_555 OE2 ? A GLU 132 ? A GLU 132 ? 1_555 2.9 ? 4 NE2 ? A HIS 43 ? A HIS 43 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OE1 ? A GLU 128 ? A GLU 128 ? 1_555 51.8 ? 5 NE2 ? A HIS 43 ? A HIS 43 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OE2 ? A GLU 128 ? A GLU 128 ? 1_555 54.8 ? 6 OE1 ? A GLU 128 ? A GLU 128 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OE2 ? A GLU 128 ? A GLU 128 ? 1_555 3.5 ? 7 NE2 ? A HIS 43 ? A HIS 43 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OE1 ? A GLU 130 ? A GLU 130 ? 1_555 47.1 ? 8 OE1 ? A GLU 128 ? A GLU 128 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OE1 ? A GLU 130 ? A GLU 130 ? 1_555 5.5 ? 9 OE2 ? A GLU 128 ? A GLU 128 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OE1 ? A GLU 130 ? A GLU 130 ? 1_555 7.7 ? 10 NE2 ? A HIS 43 ? A HIS 43 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 O ? G HOH . ? A HOH 308 ? 8_565 94.4 ? 11 OE1 ? A GLU 128 ? A GLU 128 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 O ? G HOH . ? A HOH 308 ? 8_565 93.7 ? 12 OE2 ? A GLU 128 ? A GLU 128 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 O ? G HOH . ? A HOH 308 ? 8_565 95.5 ? 13 OE1 ? A GLU 130 ? A GLU 130 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 O ? G HOH . ? A HOH 308 ? 8_565 96.6 ? 14 NE2 ? A HIS 43 ? A HIS 43 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 O ? G HOH . ? A HOH 336 ? 8_565 158.9 ? 15 OE1 ? A GLU 128 ? A GLU 128 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 O ? G HOH . ? A HOH 336 ? 8_565 147.9 ? 16 OE2 ? A GLU 128 ? A GLU 128 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 O ? G HOH . ? A HOH 336 ? 8_565 145.3 ? 17 OE1 ? A GLU 130 ? A GLU 130 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 O ? G HOH . ? A HOH 336 ? 8_565 153.1 ? 18 O ? G HOH . ? A HOH 308 ? 8_565 CD ? C CD . ? A CD 202 ? 1_555 O ? G HOH . ? A HOH 336 ? 8_565 79.4 ? 19 SG ? A CSD 99 ? A CSD 99 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 NE2 ? A HIS 141 ? A HIS 141 ? 1_555 101.6 ? 20 SG ? A CSD 99 ? A CSD 99 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 NE2 ? A HIS 145 ? A HIS 145 ? 1_555 100.7 ? 21 NE2 ? A HIS 141 ? A HIS 141 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 NE2 ? A HIS 145 ? A HIS 145 ? 1_555 105.0 ? 22 SG ? A CSD 99 ? A CSD 99 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 O1 ? F K1U . ? A K1U 205 ? 1_555 95.6 ? 23 NE2 ? A HIS 141 ? A HIS 141 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 O1 ? F K1U . ? A K1U 205 ? 1_555 109.0 ? 24 NE2 ? A HIS 145 ? A HIS 145 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 O1 ? F K1U . ? A K1U 205 ? 1_555 138.2 ? 25 SG ? A CSD 99 ? A CSD 99 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 O2 ? F K1U . ? A K1U 205 ? 1_555 159.9 ? 26 NE2 ? A HIS 141 ? A HIS 141 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 O2 ? F K1U . ? A K1U 205 ? 1_555 93.8 ? 27 NE2 ? A HIS 145 ? A HIS 145 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 O2 ? F K1U . ? A K1U 205 ? 1_555 87.5 ? 28 O1 ? F K1U . ? A K1U 205 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 O2 ? F K1U . ? A K1U 205 ? 1_555 67.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-10-23 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' struct_conn 6 2 'Structure model' struct_conn_type # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_struct_conn.conn_type_id' 4 2 'Structure model' '_struct_conn.id' 5 2 'Structure model' '_struct_conn.pdbx_dist_value' 6 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 8 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 9 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 10 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 11 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 12 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 13 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 14 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 15 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 16 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 17 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 18 2 'Structure model' '_struct_conn.ptnr2_label_seq_id' 19 2 'Structure model' '_struct_conn.ptnr2_symmetry' 20 2 'Structure model' '_struct_conn_type.id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 3 ? ? CZ A ARG 3 ? ? NH1 A ARG 3 ? ? 123.38 120.30 3.08 0.50 N 2 1 NE A ARG 3 ? ? CZ A ARG 3 ? ? NH2 A ARG 3 ? ? 116.49 120.30 -3.81 0.50 N 3 1 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH2 A ARG 7 ? ? 117.07 120.30 -3.23 0.50 N 4 1 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 116.67 120.30 -3.63 0.50 N 5 1 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH2 A ARG 106 ? ? 124.88 120.30 4.58 0.50 N 6 1 CB A ASP 123 ? ? CG A ASP 123 ? ? OD1 A ASP 123 ? ? 123.84 118.30 5.54 0.90 N # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 27 ? CG ? A GLU 27 CG 2 1 Y 1 A GLU 27 ? CD ? A GLU 27 CD 3 1 Y 1 A GLU 27 ? OE1 ? A GLU 27 OE1 4 1 Y 1 A GLU 27 ? OE2 ? A GLU 27 OE2 5 1 Y 1 A PHE 63 ? CG ? A PHE 63 CG 6 1 Y 1 A PHE 63 ? CD1 ? A PHE 63 CD1 7 1 Y 1 A PHE 63 ? CD2 ? A PHE 63 CD2 8 1 Y 1 A PHE 63 ? CE1 ? A PHE 63 CE1 9 1 Y 1 A PHE 63 ? CE2 ? A PHE 63 CE2 10 1 Y 1 A PHE 63 ? CZ ? A PHE 63 CZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 64 ? A GLU 64 2 1 Y 1 A ALA 65 ? A ALA 65 3 1 Y 1 A SER 66 ? A SER 66 4 1 Y 1 A GLU 67 ? A GLU 67 5 1 Y 1 A ARG 68 ? A ARG 68 6 1 Y 1 A TYR 69 ? A TYR 69 7 1 Y 1 A PRO 70 ? A PRO 70 8 1 Y 1 A GLU 71 ? A GLU 71 9 1 Y 1 A ALA 72 ? A ALA 72 10 1 Y 1 A PRO 73 ? A PRO 73 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CD CD CD N N 74 CSD N N N N 75 CSD CA C N R 76 CSD CB C N N 77 CSD SG S N N 78 CSD C C N N 79 CSD O O N N 80 CSD OXT O N N 81 CSD OD1 O N N 82 CSD OD2 O N N 83 CSD H H N N 84 CSD H2 H N N 85 CSD HA H N N 86 CSD HB2 H N N 87 CSD HB3 H N N 88 CSD HXT H N N 89 CSD HD2 H N N 90 GLN N N N N 91 GLN CA C N S 92 GLN C C N N 93 GLN O O N N 94 GLN CB C N N 95 GLN CG C N N 96 GLN CD C N N 97 GLN OE1 O N N 98 GLN NE2 N N N 99 GLN OXT O N N 100 GLN H H N N 101 GLN H2 H N N 102 GLN HA H N N 103 GLN HB2 H N N 104 GLN HB3 H N N 105 GLN HG2 H N N 106 GLN HG3 H N N 107 GLN HE21 H N N 108 GLN HE22 H N N 109 GLN HXT H N N 110 GLU N N N N 111 GLU CA C N S 112 GLU C C N N 113 GLU O O N N 114 GLU CB C N N 115 GLU CG C N N 116 GLU CD C N N 117 GLU OE1 O N N 118 GLU OE2 O N N 119 GLU OXT O N N 120 GLU H H N N 121 GLU H2 H N N 122 GLU HA H N N 123 GLU HB2 H N N 124 GLU HB3 H N N 125 GLU HG2 H N N 126 GLU HG3 H N N 127 GLU HE2 H N N 128 GLU HXT H N N 129 GLY N N N N 130 GLY CA C N N 131 GLY C C N N 132 GLY O O N N 133 GLY OXT O N N 134 GLY H H N N 135 GLY H2 H N N 136 GLY HA2 H N N 137 GLY HA3 H N N 138 GLY HXT H N N 139 HIS N N N N 140 HIS CA C N S 141 HIS C C N N 142 HIS O O N N 143 HIS CB C N N 144 HIS CG C Y N 145 HIS ND1 N Y N 146 HIS CD2 C Y N 147 HIS CE1 C Y N 148 HIS NE2 N Y N 149 HIS OXT O N N 150 HIS H H N N 151 HIS H2 H N N 152 HIS HA H N N 153 HIS HB2 H N N 154 HIS HB3 H N N 155 HIS HD1 H N N 156 HIS HD2 H N N 157 HIS HE1 H N N 158 HIS HE2 H N N 159 HIS HXT H N N 160 HOH O O N N 161 HOH H1 H N N 162 HOH H2 H N N 163 ILE N N N N 164 ILE CA C N S 165 ILE C C N N 166 ILE O O N N 167 ILE CB C N S 168 ILE CG1 C N N 169 ILE CG2 C N N 170 ILE CD1 C N N 171 ILE OXT O N N 172 ILE H H N N 173 ILE H2 H N N 174 ILE HA H N N 175 ILE HB H N N 176 ILE HG12 H N N 177 ILE HG13 H N N 178 ILE HG21 H N N 179 ILE HG22 H N N 180 ILE HG23 H N N 181 ILE HD11 H N N 182 ILE HD12 H N N 183 ILE HD13 H N N 184 ILE HXT H N N 185 K1U O1 O N N 186 K1U C8 C N N 187 K1U O2 O N N 188 K1U C24 C N N 189 K1U C9 C N R 190 K1U C1 C N N 191 K1U C2 C Y N 192 K1U C3 C Y N 193 K1U C4 C Y N 194 K1U C5 C Y N 195 K1U C6 C Y N 196 K1U C7 C Y N 197 K1U C10 C N N 198 K1U O3 O N N 199 K1U S1 S N N 200 K1U C11 C N N 201 K1U C12 C N N 202 K1U O4 O N N 203 K1U C13 C Y N 204 K1U C14 C Y N 205 K1U C15 C Y N 206 K1U C16 C Y N 207 K1U C17 C Y N 208 K1U C18 C Y N 209 K1U H1 H N N 210 K1U H2 H N N 211 K1U H3 H N N 212 K1U H4 H N N 213 K1U H5 H N N 214 K1U H6 H N N 215 K1U H7 H N N 216 K1U H8 H N N 217 K1U H9 H N N 218 K1U H10 H N N 219 K1U H11 H N N 220 K1U H12 H N N 221 K1U H13 H N N 222 K1U H14 H N N 223 K1U H15 H N N 224 K1U H16 H N N 225 K1U H17 H N N 226 K1U H18 H N N 227 LEU N N N N 228 LEU CA C N S 229 LEU C C N N 230 LEU O O N N 231 LEU CB C N N 232 LEU CG C N N 233 LEU CD1 C N N 234 LEU CD2 C N N 235 LEU OXT O N N 236 LEU H H N N 237 LEU H2 H N N 238 LEU HA H N N 239 LEU HB2 H N N 240 LEU HB3 H N N 241 LEU HG H N N 242 LEU HD11 H N N 243 LEU HD12 H N N 244 LEU HD13 H N N 245 LEU HD21 H N N 246 LEU HD22 H N N 247 LEU HD23 H N N 248 LEU HXT H N N 249 LYS N N N N 250 LYS CA C N S 251 LYS C C N N 252 LYS O O N N 253 LYS CB C N N 254 LYS CG C N N 255 LYS CD C N N 256 LYS CE C N N 257 LYS NZ N N N 258 LYS OXT O N N 259 LYS H H N N 260 LYS H2 H N N 261 LYS HA H N N 262 LYS HB2 H N N 263 LYS HB3 H N N 264 LYS HG2 H N N 265 LYS HG3 H N N 266 LYS HD2 H N N 267 LYS HD3 H N N 268 LYS HE2 H N N 269 LYS HE3 H N N 270 LYS HZ1 H N N 271 LYS HZ2 H N N 272 LYS HZ3 H N N 273 LYS HXT H N N 274 MET N N N N 275 MET CA C N S 276 MET C C N N 277 MET O O N N 278 MET CB C N N 279 MET CG C N N 280 MET SD S N N 281 MET CE C N N 282 MET OXT O N N 283 MET H H N N 284 MET H2 H N N 285 MET HA H N N 286 MET HB2 H N N 287 MET HB3 H N N 288 MET HG2 H N N 289 MET HG3 H N N 290 MET HE1 H N N 291 MET HE2 H N N 292 MET HE3 H N N 293 MET HXT H N N 294 NI NI NI N N 295 PHE N N N N 296 PHE CA C N S 297 PHE C C N N 298 PHE O O N N 299 PHE CB C N N 300 PHE CG C Y N 301 PHE CD1 C Y N 302 PHE CD2 C Y N 303 PHE CE1 C Y N 304 PHE CE2 C Y N 305 PHE CZ C Y N 306 PHE OXT O N N 307 PHE H H N N 308 PHE H2 H N N 309 PHE HA H N N 310 PHE HB2 H N N 311 PHE HB3 H N N 312 PHE HD1 H N N 313 PHE HD2 H N N 314 PHE HE1 H N N 315 PHE HE2 H N N 316 PHE HZ H N N 317 PHE HXT H N N 318 PRO N N N N 319 PRO CA C N S 320 PRO C C N N 321 PRO O O N N 322 PRO CB C N N 323 PRO CG C N N 324 PRO CD C N N 325 PRO OXT O N N 326 PRO H H N N 327 PRO HA H N N 328 PRO HB2 H N N 329 PRO HB3 H N N 330 PRO HG2 H N N 331 PRO HG3 H N N 332 PRO HD2 H N N 333 PRO HD3 H N N 334 PRO HXT H N N 335 SER N N N N 336 SER CA C N S 337 SER C C N N 338 SER O O N N 339 SER CB C N N 340 SER OG O N N 341 SER OXT O N N 342 SER H H N N 343 SER H2 H N N 344 SER HA H N N 345 SER HB2 H N N 346 SER HB3 H N N 347 SER HG H N N 348 SER HXT H N N 349 THR N N N N 350 THR CA C N S 351 THR C C N N 352 THR O O N N 353 THR CB C N R 354 THR OG1 O N N 355 THR CG2 C N N 356 THR OXT O N N 357 THR H H N N 358 THR H2 H N N 359 THR HA H N N 360 THR HB H N N 361 THR HG1 H N N 362 THR HG21 H N N 363 THR HG22 H N N 364 THR HG23 H N N 365 THR HXT H N N 366 TRP N N N N 367 TRP CA C N S 368 TRP C C N N 369 TRP O O N N 370 TRP CB C N N 371 TRP CG C Y N 372 TRP CD1 C Y N 373 TRP CD2 C Y N 374 TRP NE1 N Y N 375 TRP CE2 C Y N 376 TRP CE3 C Y N 377 TRP CZ2 C Y N 378 TRP CZ3 C Y N 379 TRP CH2 C Y N 380 TRP OXT O N N 381 TRP H H N N 382 TRP H2 H N N 383 TRP HA H N N 384 TRP HB2 H N N 385 TRP HB3 H N N 386 TRP HD1 H N N 387 TRP HE1 H N N 388 TRP HE3 H N N 389 TRP HZ2 H N N 390 TRP HZ3 H N N 391 TRP HH2 H N N 392 TRP HXT H N N 393 TYR N N N N 394 TYR CA C N S 395 TYR C C N N 396 TYR O O N N 397 TYR CB C N N 398 TYR CG C Y N 399 TYR CD1 C Y N 400 TYR CD2 C Y N 401 TYR CE1 C Y N 402 TYR CE2 C Y N 403 TYR CZ C Y N 404 TYR OH O N N 405 TYR OXT O N N 406 TYR H H N N 407 TYR H2 H N N 408 TYR HA H N N 409 TYR HB2 H N N 410 TYR HB3 H N N 411 TYR HD1 H N N 412 TYR HD2 H N N 413 TYR HE1 H N N 414 TYR HE2 H N N 415 TYR HH H N N 416 TYR HXT H N N 417 VAL N N N N 418 VAL CA C N S 419 VAL C C N N 420 VAL O O N N 421 VAL CB C N N 422 VAL CG1 C N N 423 VAL CG2 C N N 424 VAL OXT O N N 425 VAL H H N N 426 VAL H2 H N N 427 VAL HA H N N 428 VAL HB H N N 429 VAL HG11 H N N 430 VAL HG12 H N N 431 VAL HG13 H N N 432 VAL HG21 H N N 433 VAL HG22 H N N 434 VAL HG23 H N N 435 VAL HXT H N N 436 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CSD N CA sing N N 70 CSD N H sing N N 71 CSD N H2 sing N N 72 CSD CA CB sing N N 73 CSD CA C sing N N 74 CSD CA HA sing N N 75 CSD CB SG sing N N 76 CSD CB HB2 sing N N 77 CSD CB HB3 sing N N 78 CSD SG OD1 doub N N 79 CSD SG OD2 sing N N 80 CSD C O doub N N 81 CSD C OXT sing N N 82 CSD OXT HXT sing N N 83 CSD OD2 HD2 sing N N 84 GLN N CA sing N N 85 GLN N H sing N N 86 GLN N H2 sing N N 87 GLN CA C sing N N 88 GLN CA CB sing N N 89 GLN CA HA sing N N 90 GLN C O doub N N 91 GLN C OXT sing N N 92 GLN CB CG sing N N 93 GLN CB HB2 sing N N 94 GLN CB HB3 sing N N 95 GLN CG CD sing N N 96 GLN CG HG2 sing N N 97 GLN CG HG3 sing N N 98 GLN CD OE1 doub N N 99 GLN CD NE2 sing N N 100 GLN NE2 HE21 sing N N 101 GLN NE2 HE22 sing N N 102 GLN OXT HXT sing N N 103 GLU N CA sing N N 104 GLU N H sing N N 105 GLU N H2 sing N N 106 GLU CA C sing N N 107 GLU CA CB sing N N 108 GLU CA HA sing N N 109 GLU C O doub N N 110 GLU C OXT sing N N 111 GLU CB CG sing N N 112 GLU CB HB2 sing N N 113 GLU CB HB3 sing N N 114 GLU CG CD sing N N 115 GLU CG HG2 sing N N 116 GLU CG HG3 sing N N 117 GLU CD OE1 doub N N 118 GLU CD OE2 sing N N 119 GLU OE2 HE2 sing N N 120 GLU OXT HXT sing N N 121 GLY N CA sing N N 122 GLY N H sing N N 123 GLY N H2 sing N N 124 GLY CA C sing N N 125 GLY CA HA2 sing N N 126 GLY CA HA3 sing N N 127 GLY C O doub N N 128 GLY C OXT sing N N 129 GLY OXT HXT sing N N 130 HIS N CA sing N N 131 HIS N H sing N N 132 HIS N H2 sing N N 133 HIS CA C sing N N 134 HIS CA CB sing N N 135 HIS CA HA sing N N 136 HIS C O doub N N 137 HIS C OXT sing N N 138 HIS CB CG sing N N 139 HIS CB HB2 sing N N 140 HIS CB HB3 sing N N 141 HIS CG ND1 sing Y N 142 HIS CG CD2 doub Y N 143 HIS ND1 CE1 doub Y N 144 HIS ND1 HD1 sing N N 145 HIS CD2 NE2 sing Y N 146 HIS CD2 HD2 sing N N 147 HIS CE1 NE2 sing Y N 148 HIS CE1 HE1 sing N N 149 HIS NE2 HE2 sing N N 150 HIS OXT HXT sing N N 151 HOH O H1 sing N N 152 HOH O H2 sing N N 153 ILE N CA sing N N 154 ILE N H sing N N 155 ILE N H2 sing N N 156 ILE CA C sing N N 157 ILE CA CB sing N N 158 ILE CA HA sing N N 159 ILE C O doub N N 160 ILE C OXT sing N N 161 ILE CB CG1 sing N N 162 ILE CB CG2 sing N N 163 ILE CB HB sing N N 164 ILE CG1 CD1 sing N N 165 ILE CG1 HG12 sing N N 166 ILE CG1 HG13 sing N N 167 ILE CG2 HG21 sing N N 168 ILE CG2 HG22 sing N N 169 ILE CG2 HG23 sing N N 170 ILE CD1 HD11 sing N N 171 ILE CD1 HD12 sing N N 172 ILE CD1 HD13 sing N N 173 ILE OXT HXT sing N N 174 K1U O2 C8 doub N N 175 K1U C8 O1 sing N N 176 K1U C8 C24 sing N N 177 K1U C24 C9 sing N N 178 K1U C9 C1 sing N N 179 K1U C9 C10 sing N N 180 K1U C1 C2 sing N N 181 K1U C10 O3 doub N N 182 K1U C10 S1 sing N N 183 K1U C3 C2 doub Y N 184 K1U C3 C4 sing Y N 185 K1U C2 C7 sing Y N 186 K1U S1 C11 sing N N 187 K1U C11 C12 sing N N 188 K1U C4 C5 doub Y N 189 K1U C7 C6 doub Y N 190 K1U C12 O4 doub N N 191 K1U C12 C13 sing N N 192 K1U C5 C6 sing Y N 193 K1U C13 C18 doub Y N 194 K1U C13 C14 sing Y N 195 K1U C18 C17 sing Y N 196 K1U C14 C15 doub Y N 197 K1U C17 C16 doub Y N 198 K1U C15 C16 sing Y N 199 K1U O1 H1 sing N N 200 K1U C24 H2 sing N N 201 K1U C24 H3 sing N N 202 K1U C9 H4 sing N N 203 K1U C1 H5 sing N N 204 K1U C1 H6 sing N N 205 K1U C3 H7 sing N N 206 K1U C4 H8 sing N N 207 K1U C5 H9 sing N N 208 K1U C6 H10 sing N N 209 K1U C7 H11 sing N N 210 K1U C11 H12 sing N N 211 K1U C11 H13 sing N N 212 K1U C14 H14 sing N N 213 K1U C15 H15 sing N N 214 K1U C16 H16 sing N N 215 K1U C17 H17 sing N N 216 K1U C18 H18 sing N N 217 LEU N CA sing N N 218 LEU N H sing N N 219 LEU N H2 sing N N 220 LEU CA C sing N N 221 LEU CA CB sing N N 222 LEU CA HA sing N N 223 LEU C O doub N N 224 LEU C OXT sing N N 225 LEU CB CG sing N N 226 LEU CB HB2 sing N N 227 LEU CB HB3 sing N N 228 LEU CG CD1 sing N N 229 LEU CG CD2 sing N N 230 LEU CG HG sing N N 231 LEU CD1 HD11 sing N N 232 LEU CD1 HD12 sing N N 233 LEU CD1 HD13 sing N N 234 LEU CD2 HD21 sing N N 235 LEU CD2 HD22 sing N N 236 LEU CD2 HD23 sing N N 237 LEU OXT HXT sing N N 238 LYS N CA sing N N 239 LYS N H sing N N 240 LYS N H2 sing N N 241 LYS CA C sing N N 242 LYS CA CB sing N N 243 LYS CA HA sing N N 244 LYS C O doub N N 245 LYS C OXT sing N N 246 LYS CB CG sing N N 247 LYS CB HB2 sing N N 248 LYS CB HB3 sing N N 249 LYS CG CD sing N N 250 LYS CG HG2 sing N N 251 LYS CG HG3 sing N N 252 LYS CD CE sing N N 253 LYS CD HD2 sing N N 254 LYS CD HD3 sing N N 255 LYS CE NZ sing N N 256 LYS CE HE2 sing N N 257 LYS CE HE3 sing N N 258 LYS NZ HZ1 sing N N 259 LYS NZ HZ2 sing N N 260 LYS NZ HZ3 sing N N 261 LYS OXT HXT sing N N 262 MET N CA sing N N 263 MET N H sing N N 264 MET N H2 sing N N 265 MET CA C sing N N 266 MET CA CB sing N N 267 MET CA HA sing N N 268 MET C O doub N N 269 MET C OXT sing N N 270 MET CB CG sing N N 271 MET CB HB2 sing N N 272 MET CB HB3 sing N N 273 MET CG SD sing N N 274 MET CG HG2 sing N N 275 MET CG HG3 sing N N 276 MET SD CE sing N N 277 MET CE HE1 sing N N 278 MET CE HE2 sing N N 279 MET CE HE3 sing N N 280 MET OXT HXT sing N N 281 PHE N CA sing N N 282 PHE N H sing N N 283 PHE N H2 sing N N 284 PHE CA C sing N N 285 PHE CA CB sing N N 286 PHE CA HA sing N N 287 PHE C O doub N N 288 PHE C OXT sing N N 289 PHE CB CG sing N N 290 PHE CB HB2 sing N N 291 PHE CB HB3 sing N N 292 PHE CG CD1 doub Y N 293 PHE CG CD2 sing Y N 294 PHE CD1 CE1 sing Y N 295 PHE CD1 HD1 sing N N 296 PHE CD2 CE2 doub Y N 297 PHE CD2 HD2 sing N N 298 PHE CE1 CZ doub Y N 299 PHE CE1 HE1 sing N N 300 PHE CE2 CZ sing Y N 301 PHE CE2 HE2 sing N N 302 PHE CZ HZ sing N N 303 PHE OXT HXT sing N N 304 PRO N CA sing N N 305 PRO N CD sing N N 306 PRO N H sing N N 307 PRO CA C sing N N 308 PRO CA CB sing N N 309 PRO CA HA sing N N 310 PRO C O doub N N 311 PRO C OXT sing N N 312 PRO CB CG sing N N 313 PRO CB HB2 sing N N 314 PRO CB HB3 sing N N 315 PRO CG CD sing N N 316 PRO CG HG2 sing N N 317 PRO CG HG3 sing N N 318 PRO CD HD2 sing N N 319 PRO CD HD3 sing N N 320 PRO OXT HXT sing N N 321 SER N CA sing N N 322 SER N H sing N N 323 SER N H2 sing N N 324 SER CA C sing N N 325 SER CA CB sing N N 326 SER CA HA sing N N 327 SER C O doub N N 328 SER C OXT sing N N 329 SER CB OG sing N N 330 SER CB HB2 sing N N 331 SER CB HB3 sing N N 332 SER OG HG sing N N 333 SER OXT HXT sing N N 334 THR N CA sing N N 335 THR N H sing N N 336 THR N H2 sing N N 337 THR CA C sing N N 338 THR CA CB sing N N 339 THR CA HA sing N N 340 THR C O doub N N 341 THR C OXT sing N N 342 THR CB OG1 sing N N 343 THR CB CG2 sing N N 344 THR CB HB sing N N 345 THR OG1 HG1 sing N N 346 THR CG2 HG21 sing N N 347 THR CG2 HG22 sing N N 348 THR CG2 HG23 sing N N 349 THR OXT HXT sing N N 350 TRP N CA sing N N 351 TRP N H sing N N 352 TRP N H2 sing N N 353 TRP CA C sing N N 354 TRP CA CB sing N N 355 TRP CA HA sing N N 356 TRP C O doub N N 357 TRP C OXT sing N N 358 TRP CB CG sing N N 359 TRP CB HB2 sing N N 360 TRP CB HB3 sing N N 361 TRP CG CD1 doub Y N 362 TRP CG CD2 sing Y N 363 TRP CD1 NE1 sing Y N 364 TRP CD1 HD1 sing N N 365 TRP CD2 CE2 doub Y N 366 TRP CD2 CE3 sing Y N 367 TRP NE1 CE2 sing Y N 368 TRP NE1 HE1 sing N N 369 TRP CE2 CZ2 sing Y N 370 TRP CE3 CZ3 doub Y N 371 TRP CE3 HE3 sing N N 372 TRP CZ2 CH2 doub Y N 373 TRP CZ2 HZ2 sing N N 374 TRP CZ3 CH2 sing Y N 375 TRP CZ3 HZ3 sing N N 376 TRP CH2 HH2 sing N N 377 TRP OXT HXT sing N N 378 TYR N CA sing N N 379 TYR N H sing N N 380 TYR N H2 sing N N 381 TYR CA C sing N N 382 TYR CA CB sing N N 383 TYR CA HA sing N N 384 TYR C O doub N N 385 TYR C OXT sing N N 386 TYR CB CG sing N N 387 TYR CB HB2 sing N N 388 TYR CB HB3 sing N N 389 TYR CG CD1 doub Y N 390 TYR CG CD2 sing Y N 391 TYR CD1 CE1 sing Y N 392 TYR CD1 HD1 sing N N 393 TYR CD2 CE2 doub Y N 394 TYR CD2 HD2 sing N N 395 TYR CE1 CZ doub Y N 396 TYR CE1 HE1 sing N N 397 TYR CE2 CZ sing Y N 398 TYR CE2 HE2 sing N N 399 TYR CZ OH sing N N 400 TYR OH HH sing N N 401 TYR OXT HXT sing N N 402 VAL N CA sing N N 403 VAL N H sing N N 404 VAL N H2 sing N N 405 VAL CA C sing N N 406 VAL CA CB sing N N 407 VAL CA HA sing N N 408 VAL C O doub N N 409 VAL C OXT sing N N 410 VAL CB CG1 sing N N 411 VAL CB CG2 sing N N 412 VAL CB HB sing N N 413 VAL CG1 HG11 sing N N 414 VAL CG1 HG12 sing N N 415 VAL CG1 HG13 sing N N 416 VAL CG2 HG21 sing N N 417 VAL CG2 HG22 sing N N 418 VAL CG2 HG23 sing N N 419 VAL OXT HXT sing N N 420 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id K1U _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id K1U _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CADMIUM ION' CD 3 'NICKEL (II) ION' NI 4 '(3R)-3-benzyl-4-oxo-4-[(2-oxo-2-phenylethyl)sulfanyl]butanoic acid' K1U 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5E5D _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #