data_6INB # _entry.id 6INB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6INB pdb_00006inb 10.2210/pdb6inb/pdb WWPDB D_1300009506 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6INB _pdbx_database_status.recvd_initial_deposition_date 2018-10-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wu, W.' 1 ? 'Zhang, Q.' 2 ? 'Bartlam, M.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biochem. Biophys. Res. Commun.' _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 509 _citation.language ? _citation.page_first 154 _citation.page_last 160 _citation.title 'Structural characterization of an acetolactate decarboxylase from Klebsiella pneumoniae' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2018.12.094 _citation.pdbx_database_id_PubMed 30580999 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, W.' 1 ? primary 'Zhao, Q.' 2 ? primary 'Che, S.' 3 ? primary 'Jia, H.' 4 ? primary 'Liang, H.' 5 ? primary 'Zhang, H.' 6 ? primary 'Liu, R.' 7 ? primary 'Zhang, Q.' 8 ? primary 'Bartlam, M.' 9 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6INB _cell.details ? _cell.formula_units_Z ? _cell.length_a 55.279 _cell.length_a_esd ? _cell.length_b 55.279 _cell.length_b_esd ? _cell.length_c 119.532 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6INB _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Alpha-acetolactate decarboxylase' 29226.637 1 4.1.1.5 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 197 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name BudA # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNHSAECTCEESLCETLRAFSAQHPESVLYQTSLMSALLSGVYEGSTTIADLLKHGDFGLGTFNELDGELIAFSSQVYQL RADGSARNAQPEQKTPFAVMTWFQPQYRKTFDHPVSRQQLHEVIDQQIPSDNLFCALRIDGHFRHAHTRTVPRQTPPYRA MTDVLDDQPVFRFNQREGVLVGFRTPQHMQGINVAGYHEHFITDDRKGGGHLLDYQLDHGVLTFGEIHKLMIDLPADSAF LQANLHPDNLDAAIRSVES ; _entity_poly.pdbx_seq_one_letter_code_can ;MNHSAECTCEESLCETLRAFSAQHPESVLYQTSLMSALLSGVYEGSTTIADLLKHGDFGLGTFNELDGELIAFSSQVYQL RADGSARNAQPEQKTPFAVMTWFQPQYRKTFDHPVSRQQLHEVIDQQIPSDNLFCALRIDGHFRHAHTRTVPRQTPPYRA MTDVLDDQPVFRFNQREGVLVGFRTPQHMQGINVAGYHEHFITDDRKGGGHLLDYQLDHGVLTFGEIHKLMIDLPADSAF LQANLHPDNLDAAIRSVES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 HIS n 1 4 SER n 1 5 ALA n 1 6 GLU n 1 7 CYS n 1 8 THR n 1 9 CYS n 1 10 GLU n 1 11 GLU n 1 12 SER n 1 13 LEU n 1 14 CYS n 1 15 GLU n 1 16 THR n 1 17 LEU n 1 18 ARG n 1 19 ALA n 1 20 PHE n 1 21 SER n 1 22 ALA n 1 23 GLN n 1 24 HIS n 1 25 PRO n 1 26 GLU n 1 27 SER n 1 28 VAL n 1 29 LEU n 1 30 TYR n 1 31 GLN n 1 32 THR n 1 33 SER n 1 34 LEU n 1 35 MET n 1 36 SER n 1 37 ALA n 1 38 LEU n 1 39 LEU n 1 40 SER n 1 41 GLY n 1 42 VAL n 1 43 TYR n 1 44 GLU n 1 45 GLY n 1 46 SER n 1 47 THR n 1 48 THR n 1 49 ILE n 1 50 ALA n 1 51 ASP n 1 52 LEU n 1 53 LEU n 1 54 LYS n 1 55 HIS n 1 56 GLY n 1 57 ASP n 1 58 PHE n 1 59 GLY n 1 60 LEU n 1 61 GLY n 1 62 THR n 1 63 PHE n 1 64 ASN n 1 65 GLU n 1 66 LEU n 1 67 ASP n 1 68 GLY n 1 69 GLU n 1 70 LEU n 1 71 ILE n 1 72 ALA n 1 73 PHE n 1 74 SER n 1 75 SER n 1 76 GLN n 1 77 VAL n 1 78 TYR n 1 79 GLN n 1 80 LEU n 1 81 ARG n 1 82 ALA n 1 83 ASP n 1 84 GLY n 1 85 SER n 1 86 ALA n 1 87 ARG n 1 88 ASN n 1 89 ALA n 1 90 GLN n 1 91 PRO n 1 92 GLU n 1 93 GLN n 1 94 LYS n 1 95 THR n 1 96 PRO n 1 97 PHE n 1 98 ALA n 1 99 VAL n 1 100 MET n 1 101 THR n 1 102 TRP n 1 103 PHE n 1 104 GLN n 1 105 PRO n 1 106 GLN n 1 107 TYR n 1 108 ARG n 1 109 LYS n 1 110 THR n 1 111 PHE n 1 112 ASP n 1 113 HIS n 1 114 PRO n 1 115 VAL n 1 116 SER n 1 117 ARG n 1 118 GLN n 1 119 GLN n 1 120 LEU n 1 121 HIS n 1 122 GLU n 1 123 VAL n 1 124 ILE n 1 125 ASP n 1 126 GLN n 1 127 GLN n 1 128 ILE n 1 129 PRO n 1 130 SER n 1 131 ASP n 1 132 ASN n 1 133 LEU n 1 134 PHE n 1 135 CYS n 1 136 ALA n 1 137 LEU n 1 138 ARG n 1 139 ILE n 1 140 ASP n 1 141 GLY n 1 142 HIS n 1 143 PHE n 1 144 ARG n 1 145 HIS n 1 146 ALA n 1 147 HIS n 1 148 THR n 1 149 ARG n 1 150 THR n 1 151 VAL n 1 152 PRO n 1 153 ARG n 1 154 GLN n 1 155 THR n 1 156 PRO n 1 157 PRO n 1 158 TYR n 1 159 ARG n 1 160 ALA n 1 161 MET n 1 162 THR n 1 163 ASP n 1 164 VAL n 1 165 LEU n 1 166 ASP n 1 167 ASP n 1 168 GLN n 1 169 PRO n 1 170 VAL n 1 171 PHE n 1 172 ARG n 1 173 PHE n 1 174 ASN n 1 175 GLN n 1 176 ARG n 1 177 GLU n 1 178 GLY n 1 179 VAL n 1 180 LEU n 1 181 VAL n 1 182 GLY n 1 183 PHE n 1 184 ARG n 1 185 THR n 1 186 PRO n 1 187 GLN n 1 188 HIS n 1 189 MET n 1 190 GLN n 1 191 GLY n 1 192 ILE n 1 193 ASN n 1 194 VAL n 1 195 ALA n 1 196 GLY n 1 197 TYR n 1 198 HIS n 1 199 GLU n 1 200 HIS n 1 201 PHE n 1 202 ILE n 1 203 THR n 1 204 ASP n 1 205 ASP n 1 206 ARG n 1 207 LYS n 1 208 GLY n 1 209 GLY n 1 210 GLY n 1 211 HIS n 1 212 LEU n 1 213 LEU n 1 214 ASP n 1 215 TYR n 1 216 GLN n 1 217 LEU n 1 218 ASP n 1 219 HIS n 1 220 GLY n 1 221 VAL n 1 222 LEU n 1 223 THR n 1 224 PHE n 1 225 GLY n 1 226 GLU n 1 227 ILE n 1 228 HIS n 1 229 LYS n 1 230 LEU n 1 231 MET n 1 232 ILE n 1 233 ASP n 1 234 LEU n 1 235 PRO n 1 236 ALA n 1 237 ASP n 1 238 SER n 1 239 ALA n 1 240 PHE n 1 241 LEU n 1 242 GLN n 1 243 ALA n 1 244 ASN n 1 245 LEU n 1 246 HIS n 1 247 PRO n 1 248 ASP n 1 249 ASN n 1 250 LEU n 1 251 ASP n 1 252 ALA n 1 253 ALA n 1 254 ILE n 1 255 ARG n 1 256 SER n 1 257 VAL n 1 258 GLU n 1 259 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 259 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'budA, BN49_3166' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Klebsiella pneumoniae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 573 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code W9BHF3_KLEPN _struct_ref.pdbx_db_accession W9BHF3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNHSAECTCEESLCETLRAFSAQHPESVLYQTSLMSALLSGVYEGSTTIADLLKHGDFGLGTFNELDGELIAFSSQVYQL RADGSARNAQPEQKTPFAVMTWFQPQYRKTFDHPVSRQQLHEVIDQQIPSDNLFCALRIDGHFRHAHTRTVPRQTPPYRA MTDVLDDQPVFRFNQREGVLVGFRTPQHMQGINVAGYHEHFITDDRKGGGHLLDYQLDHGVLTFGEIHKLMIDLPADSAF LQANLHPDNLDAAIRSVES ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6INB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 259 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession W9BHF3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 259 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 259 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6INB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.80 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 31.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% (w/v) PEG-3000, 0.1M citrate, pH 5.5 and 12% w/v Polyethylene glycol 3,350, 0.1M sodium malonate, pH 6.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-05-27 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9785 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9785 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6INB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.8 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20250 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.021 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.8 _reflns_shell.d_res_low 1.83 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 9.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 999 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 15 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.090 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.05 _refine.aniso_B[1][2] -0.03 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.05 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.17 _refine.B_iso_max ? _refine.B_iso_mean 21.880 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.959 _refine.correlation_coeff_Fo_to_Fc_free 0.930 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6INB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.80 _refine.ls_d_res_low 47.87 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19193 _refine.ls_number_reflns_R_free 1006 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.88 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.17497 _refine.ls_R_factor_R_free 0.21914 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.17272 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4BT2 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.131 _refine.pdbx_overall_ESU_R_Free 0.128 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.90 _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.644 _refine.overall_SU_ML 0.079 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1750 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 197 _refine_hist.number_atoms_total 1949 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 47.87 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.013 1799 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1595 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.563 1.643 2442 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.388 1.573 3700 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.926 5.000 220 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 40.553 22.110 109 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.034 15.000 287 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.776 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.066 0.200 226 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 2054 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 401 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 0.717 1.125 877 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 0.713 1.124 876 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.168 1.683 1095 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.168 1.685 1096 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.126 1.273 922 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 1.125 1.274 923 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 1.774 1.861 1347 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.300 14.958 1992 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 5.158 14.211 1948 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.802 _refine_ls_shell.d_res_low 1.849 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 67 _refine_ls_shell.number_reflns_R_work 1393 _refine_ls_shell.percent_reflns_obs 99.12 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.234 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.175 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6INB _struct.title 'Crystal structure of an acetolactate decarboxylase from Klebsiella pneumoniae' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6INB _struct_keywords.text 'Acetolactate decarboxylase, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 34 ? SER A 40 ? LEU A 34 SER A 40 1 ? 7 HELX_P HELX_P2 AA2 ILE A 49 ? LEU A 53 ? ILE A 49 LEU A 53 1 ? 5 HELX_P HELX_P3 AA3 ASN A 64 ? ASP A 67 ? ASN A 64 ASP A 67 5 ? 4 HELX_P HELX_P4 AA4 ARG A 117 ? ILE A 128 ? ARG A 117 ILE A 128 1 ? 12 HELX_P HELX_P5 AA5 ALA A 160 ? GLN A 168 ? ALA A 160 GLN A 168 1 ? 9 HELX_P HELX_P6 AA6 PRO A 186 ? GLN A 190 ? PRO A 186 GLN A 190 5 ? 5 HELX_P HELX_P7 AA7 ASP A 237 ? ALA A 243 ? ASP A 237 ALA A 243 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 69 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 69 A ZN 301 1_555 ? ? ? ? ? ? ? 2.382 ? ? metalc2 metalc ? ? A GLU 69 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 69 A ZN 301 1_555 ? ? ? ? ? ? ? 2.196 ? ? metalc3 metalc ? ? A HIS 198 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 198 A ZN 301 1_555 ? ? ? ? ? ? ? 2.063 ? ? metalc4 metalc ? ? A HIS 200 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 200 A ZN 301 1_555 ? ? ? ? ? ? ? 2.120 ? ? metalc5 metalc ? ? A HIS 211 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 211 A ZN 301 1_555 ? ? ? ? ? ? ? 2.053 ? ? metalc6 metalc ? ? B ZN . ZN ? ? ? 1_555 D HOH . O ? ? A ZN 301 A HOH 534 1_555 ? ? ? ? ? ? ? 2.417 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 156 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 156 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 157 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 157 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.63 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 2 ? AA3 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 86 ? ASN A 88 ? ALA A 86 ASN A 88 AA1 2 GLN A 76 ? LEU A 80 ? GLN A 76 LEU A 80 AA1 3 GLU A 69 ? PHE A 73 ? GLU A 69 PHE A 73 AA1 4 PHE A 58 ? THR A 62 ? PHE A 58 THR A 62 AA1 5 PHE A 97 ? THR A 101 ? PHE A 97 THR A 101 AA1 6 VAL A 28 ? THR A 32 ? VAL A 28 THR A 32 AA1 7 LYS A 229 ? ASP A 233 ? LYS A 229 ASP A 233 AA2 1 THR A 47 ? THR A 48 ? THR A 47 THR A 48 AA2 2 LYS A 94 ? THR A 95 ? LYS A 94 THR A 95 AA3 1 TYR A 107 ? PHE A 111 ? TYR A 107 PHE A 111 AA3 2 VAL A 115 ? SER A 116 ? VAL A 115 SER A 116 AA3 3 PHE A 134 ? THR A 148 ? PHE A 134 THR A 148 AA3 4 PHE A 171 ? THR A 185 ? PHE A 171 THR A 185 AA3 5 GLY A 196 ? THR A 203 ? GLY A 196 THR A 203 AA3 6 GLY A 209 ? ILE A 227 ? GLY A 209 ILE A 227 AA3 7 VAL A 115 ? SER A 116 ? VAL A 115 SER A 116 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ARG A 87 ? O ARG A 87 N GLN A 79 ? N GLN A 79 AA1 2 3 O LEU A 80 ? O LEU A 80 N GLU A 69 ? N GLU A 69 AA1 3 4 O ALA A 72 ? O ALA A 72 N GLY A 59 ? N GLY A 59 AA1 4 5 N LEU A 60 ? N LEU A 60 O VAL A 99 ? O VAL A 99 AA1 5 6 O MET A 100 ? O MET A 100 N TYR A 30 ? N TYR A 30 AA1 6 7 N GLN A 31 ? N GLN A 31 O MET A 231 ? O MET A 231 AA2 1 2 N THR A 47 ? N THR A 47 O THR A 95 ? O THR A 95 AA3 3 4 N PHE A 143 ? N PHE A 143 O ARG A 176 ? O ARG A 176 AA3 4 5 N VAL A 181 ? N VAL A 181 O HIS A 200 ? O HIS A 200 AA3 5 6 N GLU A 199 ? N GLU A 199 O LEU A 212 ? O LEU A 212 AA3 6 7 O LEU A 217 ? O LEU A 217 N VAL A 115 ? N VAL A 115 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 301 ? 5 'binding site for residue ZN A 301' AC2 Software A CL 302 ? 5 'binding site for residue CL A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLU A 69 ? GLU A 69 . ? 1_555 ? 2 AC1 5 HIS A 198 ? HIS A 198 . ? 1_555 ? 3 AC1 5 HIS A 200 ? HIS A 200 . ? 1_555 ? 4 AC1 5 HIS A 211 ? HIS A 211 . ? 1_555 ? 5 AC1 5 HOH D . ? HOH A 534 . ? 1_555 ? 6 AC2 5 GLN A 104 ? GLN A 104 . ? 5_565 ? 7 AC2 5 HIS A 145 ? HIS A 145 . ? 1_555 ? 8 AC2 5 HIS A 147 ? HIS A 147 . ? 1_555 ? 9 AC2 5 ASN A 174 ? ASN A 174 . ? 1_555 ? 10 AC2 5 HOH D . ? HOH A 547 . ? 1_555 ? # _atom_sites.entry_id 6INB _atom_sites.fract_transf_matrix[1][1] 0.018090 _atom_sites.fract_transf_matrix[1][2] 0.010444 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020889 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008366 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 GLU 6 6 ? ? ? A . n A 1 7 CYS 7 7 ? ? ? A . n A 1 8 THR 8 8 ? ? ? A . n A 1 9 CYS 9 9 ? ? ? A . n A 1 10 GLU 10 10 ? ? ? A . n A 1 11 GLU 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 LEU 13 13 ? ? ? A . n A 1 14 CYS 14 14 ? ? ? A . n A 1 15 GLU 15 15 ? ? ? A . n A 1 16 THR 16 16 ? ? ? A . n A 1 17 LEU 17 17 ? ? ? A . n A 1 18 ARG 18 18 ? ? ? A . n A 1 19 ALA 19 19 ? ? ? A . n A 1 20 PHE 20 20 ? ? ? A . n A 1 21 SER 21 21 ? ? ? A . n A 1 22 ALA 22 22 ? ? ? A . n A 1 23 GLN 23 23 ? ? ? A . n A 1 24 HIS 24 24 ? ? ? A . n A 1 25 PRO 25 25 ? ? ? A . n A 1 26 GLU 26 26 ? ? ? A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 TRP 102 102 102 TRP TRP A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 CYS 135 135 135 CYS CYS A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 HIS 145 145 145 HIS HIS A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 GLN 154 154 154 GLN GLN A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 TYR 158 158 158 TYR TYR A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 MET 161 161 161 MET MET A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 PHE 171 171 171 PHE PHE A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 GLN 175 175 175 GLN GLN A . n A 1 176 ARG 176 176 176 ARG ARG A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 PHE 183 183 183 PHE PHE A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 PRO 186 186 186 PRO PRO A . n A 1 187 GLN 187 187 187 GLN GLN A . n A 1 188 HIS 188 188 188 HIS HIS A . n A 1 189 MET 189 189 189 MET MET A . n A 1 190 GLN 190 190 190 GLN GLN A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 ILE 192 192 192 ILE ILE A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 TYR 197 197 197 TYR TYR A . n A 1 198 HIS 198 198 198 HIS HIS A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 HIS 200 200 200 HIS HIS A . n A 1 201 PHE 201 201 201 PHE PHE A . n A 1 202 ILE 202 202 202 ILE ILE A . n A 1 203 THR 203 203 203 THR THR A . n A 1 204 ASP 204 204 204 ASP ASP A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 ARG 206 206 206 ARG ARG A . n A 1 207 LYS 207 207 207 LYS LYS A . n A 1 208 GLY 208 208 208 GLY GLY A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 HIS 211 211 211 HIS HIS A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 ASP 214 214 214 ASP ASP A . n A 1 215 TYR 215 215 215 TYR TYR A . n A 1 216 GLN 216 216 216 GLN GLN A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 ASP 218 218 218 ASP ASP A . n A 1 219 HIS 219 219 219 HIS HIS A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 THR 223 223 223 THR THR A . n A 1 224 PHE 224 224 224 PHE PHE A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 GLU 226 226 226 GLU GLU A . n A 1 227 ILE 227 227 227 ILE ILE A . n A 1 228 HIS 228 228 228 HIS HIS A . n A 1 229 LYS 229 229 229 LYS LYS A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 MET 231 231 231 MET MET A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 ASP 233 233 233 ASP ASP A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 PRO 235 235 235 PRO PRO A . n A 1 236 ALA 236 236 236 ALA ALA A . n A 1 237 ASP 237 237 237 ASP ASP A . n A 1 238 SER 238 238 238 SER SER A . n A 1 239 ALA 239 239 239 ALA ALA A . n A 1 240 PHE 240 240 240 PHE PHE A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 GLN 242 242 242 GLN GLN A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 ASN 244 244 244 ASN ASN A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 HIS 246 246 ? ? ? A . n A 1 247 PRO 247 247 ? ? ? A . n A 1 248 ASP 248 248 ? ? ? A . n A 1 249 ASN 249 249 ? ? ? A . n A 1 250 LEU 250 250 ? ? ? A . n A 1 251 ASP 251 251 ? ? ? A . n A 1 252 ALA 252 252 ? ? ? A . n A 1 253 ALA 253 253 ? ? ? A . n A 1 254 ILE 254 254 ? ? ? A . n A 1 255 ARG 255 255 ? ? ? A . n A 1 256 SER 256 256 ? ? ? A . n A 1 257 VAL 257 257 ? ? ? A . n A 1 258 GLU 258 258 ? ? ? A . n A 1 259 SER 259 259 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 1 ZN ZN A . C 3 CL 1 302 1 CL CL A . D 4 HOH 1 401 62 HOH HOH A . D 4 HOH 2 402 135 HOH HOH A . D 4 HOH 3 403 140 HOH HOH A . D 4 HOH 4 404 134 HOH HOH A . D 4 HOH 5 405 159 HOH HOH A . D 4 HOH 6 406 51 HOH HOH A . D 4 HOH 7 407 77 HOH HOH A . D 4 HOH 8 408 120 HOH HOH A . D 4 HOH 9 409 84 HOH HOH A . D 4 HOH 10 410 30 HOH HOH A . D 4 HOH 11 411 76 HOH HOH A . D 4 HOH 12 412 44 HOH HOH A . D 4 HOH 13 413 23 HOH HOH A . D 4 HOH 14 414 190 HOH HOH A . D 4 HOH 15 415 113 HOH HOH A . D 4 HOH 16 416 173 HOH HOH A . D 4 HOH 17 417 160 HOH HOH A . D 4 HOH 18 418 49 HOH HOH A . D 4 HOH 19 419 112 HOH HOH A . D 4 HOH 20 420 53 HOH HOH A . D 4 HOH 21 421 126 HOH HOH A . D 4 HOH 22 422 31 HOH HOH A . D 4 HOH 23 423 191 HOH HOH A . D 4 HOH 24 424 12 HOH HOH A . D 4 HOH 25 425 109 HOH HOH A . D 4 HOH 26 426 197 HOH HOH A . D 4 HOH 27 427 138 HOH HOH A . D 4 HOH 28 428 148 HOH HOH A . D 4 HOH 29 429 9 HOH HOH A . D 4 HOH 30 430 141 HOH HOH A . D 4 HOH 31 431 78 HOH HOH A . D 4 HOH 32 432 99 HOH HOH A . D 4 HOH 33 433 5 HOH HOH A . D 4 HOH 34 434 174 HOH HOH A . D 4 HOH 35 435 32 HOH HOH A . D 4 HOH 36 436 200 HOH HOH A . D 4 HOH 37 437 22 HOH HOH A . D 4 HOH 38 438 14 HOH HOH A . D 4 HOH 39 439 13 HOH HOH A . D 4 HOH 40 440 145 HOH HOH A . D 4 HOH 41 441 57 HOH HOH A . D 4 HOH 42 442 166 HOH HOH A . D 4 HOH 43 443 106 HOH HOH A . D 4 HOH 44 444 146 HOH HOH A . D 4 HOH 45 445 68 HOH HOH A . D 4 HOH 46 446 127 HOH HOH A . D 4 HOH 47 447 73 HOH HOH A . D 4 HOH 48 448 79 HOH HOH A . D 4 HOH 49 449 94 HOH HOH A . D 4 HOH 50 450 74 HOH HOH A . D 4 HOH 51 451 66 HOH HOH A . D 4 HOH 52 452 123 HOH HOH A . D 4 HOH 53 453 178 HOH HOH A . D 4 HOH 54 454 4 HOH HOH A . D 4 HOH 55 455 118 HOH HOH A . D 4 HOH 56 456 124 HOH HOH A . D 4 HOH 57 457 87 HOH HOH A . D 4 HOH 58 458 130 HOH HOH A . D 4 HOH 59 459 38 HOH HOH A . D 4 HOH 60 460 90 HOH HOH A . D 4 HOH 61 461 50 HOH HOH A . D 4 HOH 62 462 102 HOH HOH A . D 4 HOH 63 463 164 HOH HOH A . D 4 HOH 64 464 26 HOH HOH A . D 4 HOH 65 465 39 HOH HOH A . D 4 HOH 66 466 46 HOH HOH A . D 4 HOH 67 467 92 HOH HOH A . D 4 HOH 68 468 64 HOH HOH A . D 4 HOH 69 469 65 HOH HOH A . D 4 HOH 70 470 18 HOH HOH A . D 4 HOH 71 471 153 HOH HOH A . D 4 HOH 72 472 151 HOH HOH A . D 4 HOH 73 473 181 HOH HOH A . D 4 HOH 74 474 48 HOH HOH A . D 4 HOH 75 475 156 HOH HOH A . D 4 HOH 76 476 165 HOH HOH A . D 4 HOH 77 477 21 HOH HOH A . D 4 HOH 78 478 63 HOH HOH A . D 4 HOH 79 479 61 HOH HOH A . D 4 HOH 80 480 27 HOH HOH A . D 4 HOH 81 481 75 HOH HOH A . D 4 HOH 82 482 115 HOH HOH A . D 4 HOH 83 483 108 HOH HOH A . D 4 HOH 84 484 41 HOH HOH A . D 4 HOH 85 485 25 HOH HOH A . D 4 HOH 86 486 3 HOH HOH A . D 4 HOH 87 487 60 HOH HOH A . D 4 HOH 88 488 45 HOH HOH A . D 4 HOH 89 489 101 HOH HOH A . D 4 HOH 90 490 1 HOH HOH A . D 4 HOH 91 491 105 HOH HOH A . D 4 HOH 92 492 129 HOH HOH A . D 4 HOH 93 493 175 HOH HOH A . D 4 HOH 94 494 16 HOH HOH A . D 4 HOH 95 495 33 HOH HOH A . D 4 HOH 96 496 6 HOH HOH A . D 4 HOH 97 497 28 HOH HOH A . D 4 HOH 98 498 89 HOH HOH A . D 4 HOH 99 499 199 HOH HOH A . D 4 HOH 100 500 10 HOH HOH A . D 4 HOH 101 501 125 HOH HOH A . D 4 HOH 102 502 17 HOH HOH A . D 4 HOH 103 503 7 HOH HOH A . D 4 HOH 104 504 128 HOH HOH A . D 4 HOH 105 505 19 HOH HOH A . D 4 HOH 106 506 167 HOH HOH A . D 4 HOH 107 507 171 HOH HOH A . D 4 HOH 108 508 104 HOH HOH A . D 4 HOH 109 509 43 HOH HOH A . D 4 HOH 110 510 47 HOH HOH A . D 4 HOH 111 511 36 HOH HOH A . D 4 HOH 112 512 20 HOH HOH A . D 4 HOH 113 513 168 HOH HOH A . D 4 HOH 114 514 58 HOH HOH A . D 4 HOH 115 515 83 HOH HOH A . D 4 HOH 116 516 97 HOH HOH A . D 4 HOH 117 517 24 HOH HOH A . D 4 HOH 118 518 131 HOH HOH A . D 4 HOH 119 519 2 HOH HOH A . D 4 HOH 120 520 8 HOH HOH A . D 4 HOH 121 521 157 HOH HOH A . D 4 HOH 122 522 114 HOH HOH A . D 4 HOH 123 523 95 HOH HOH A . D 4 HOH 124 524 56 HOH HOH A . D 4 HOH 125 525 172 HOH HOH A . D 4 HOH 126 526 133 HOH HOH A . D 4 HOH 127 527 150 HOH HOH A . D 4 HOH 128 528 132 HOH HOH A . D 4 HOH 129 529 117 HOH HOH A . D 4 HOH 130 530 185 HOH HOH A . D 4 HOH 131 531 98 HOH HOH A . D 4 HOH 132 532 170 HOH HOH A . D 4 HOH 133 533 40 HOH HOH A . D 4 HOH 134 534 11 HOH HOH A . D 4 HOH 135 535 177 HOH HOH A . D 4 HOH 136 536 142 HOH HOH A . D 4 HOH 137 537 93 HOH HOH A . D 4 HOH 138 538 207 HOH HOH A . D 4 HOH 139 539 34 HOH HOH A . D 4 HOH 140 540 55 HOH HOH A . D 4 HOH 141 541 176 HOH HOH A . D 4 HOH 142 542 35 HOH HOH A . D 4 HOH 143 543 136 HOH HOH A . D 4 HOH 144 544 155 HOH HOH A . D 4 HOH 145 545 37 HOH HOH A . D 4 HOH 146 546 15 HOH HOH A . D 4 HOH 147 547 52 HOH HOH A . D 4 HOH 148 548 180 HOH HOH A . D 4 HOH 149 549 96 HOH HOH A . D 4 HOH 150 550 186 HOH HOH A . D 4 HOH 151 551 111 HOH HOH A . D 4 HOH 152 552 121 HOH HOH A . D 4 HOH 153 553 103 HOH HOH A . D 4 HOH 154 554 80 HOH HOH A . D 4 HOH 155 555 54 HOH HOH A . D 4 HOH 156 556 154 HOH HOH A . D 4 HOH 157 557 193 HOH HOH A . D 4 HOH 158 558 91 HOH HOH A . D 4 HOH 159 559 196 HOH HOH A . D 4 HOH 160 560 144 HOH HOH A . D 4 HOH 161 561 59 HOH HOH A . D 4 HOH 162 562 158 HOH HOH A . D 4 HOH 163 563 169 HOH HOH A . D 4 HOH 164 564 147 HOH HOH A . D 4 HOH 165 565 85 HOH HOH A . D 4 HOH 166 566 184 HOH HOH A . D 4 HOH 167 567 192 HOH HOH A . D 4 HOH 168 568 29 HOH HOH A . D 4 HOH 169 569 71 HOH HOH A . D 4 HOH 170 570 122 HOH HOH A . D 4 HOH 171 571 116 HOH HOH A . D 4 HOH 172 572 70 HOH HOH A . D 4 HOH 173 573 149 HOH HOH A . D 4 HOH 174 574 82 HOH HOH A . D 4 HOH 175 575 163 HOH HOH A . D 4 HOH 176 576 203 HOH HOH A . D 4 HOH 177 577 86 HOH HOH A . D 4 HOH 178 578 162 HOH HOH A . D 4 HOH 179 579 72 HOH HOH A . D 4 HOH 180 580 204 HOH HOH A . D 4 HOH 181 581 67 HOH HOH A . D 4 HOH 182 582 110 HOH HOH A . D 4 HOH 183 583 42 HOH HOH A . D 4 HOH 184 584 81 HOH HOH A . D 4 HOH 185 585 88 HOH HOH A . D 4 HOH 186 586 179 HOH HOH A . D 4 HOH 187 587 152 HOH HOH A . D 4 HOH 188 588 143 HOH HOH A . D 4 HOH 189 589 182 HOH HOH A . D 4 HOH 190 590 161 HOH HOH A . D 4 HOH 191 591 195 HOH HOH A . D 4 HOH 192 592 119 HOH HOH A . D 4 HOH 193 593 205 HOH HOH A . D 4 HOH 194 594 69 HOH HOH A . D 4 HOH 195 595 100 HOH HOH A . D 4 HOH 196 596 183 HOH HOH A . D 4 HOH 197 597 189 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2490 ? 1 MORE -111 ? 1 'SSA (A^2)' 17920 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 79.6880000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 595 ? D HOH . 2 1 A HOH 597 ? D HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 69 ? A GLU 69 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OE2 ? A GLU 69 ? A GLU 69 ? 1_555 57.7 ? 2 OE1 ? A GLU 69 ? A GLU 69 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 198 ? A HIS 198 ? 1_555 159.7 ? 3 OE2 ? A GLU 69 ? A GLU 69 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 198 ? A HIS 198 ? 1_555 105.4 ? 4 OE1 ? A GLU 69 ? A GLU 69 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 200 ? A HIS 200 ? 1_555 93.8 ? 5 OE2 ? A GLU 69 ? A GLU 69 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 200 ? A HIS 200 ? 1_555 84.9 ? 6 NE2 ? A HIS 198 ? A HIS 198 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 200 ? A HIS 200 ? 1_555 95.8 ? 7 OE1 ? A GLU 69 ? A GLU 69 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 211 ? A HIS 211 ? 1_555 93.3 ? 8 OE2 ? A GLU 69 ? A GLU 69 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 211 ? A HIS 211 ? 1_555 149.5 ? 9 NE2 ? A HIS 198 ? A HIS 198 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 211 ? A HIS 211 ? 1_555 100.6 ? 10 NE2 ? A HIS 200 ? A HIS 200 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 211 ? A HIS 211 ? 1_555 108.3 ? 11 OE1 ? A GLU 69 ? A GLU 69 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 534 ? 1_555 78.2 ? 12 OE2 ? A GLU 69 ? A GLU 69 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 534 ? 1_555 79.3 ? 13 NE2 ? A HIS 198 ? A HIS 198 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 534 ? 1_555 88.0 ? 14 NE2 ? A HIS 200 ? A HIS 200 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 534 ? 1_555 164.2 ? 15 ND1 ? A HIS 211 ? A HIS 211 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 534 ? 1_555 85.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-01-16 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -7.0490 _pdbx_refine_tls.origin_y 17.1310 _pdbx_refine_tls.origin_z 45.1320 _pdbx_refine_tls.T[1][1] 0.0080 _pdbx_refine_tls.T[2][2] 0.0306 _pdbx_refine_tls.T[3][3] 0.0151 _pdbx_refine_tls.T[1][2] -0.0062 _pdbx_refine_tls.T[1][3] -0.0048 _pdbx_refine_tls.T[2][3] -0.0082 _pdbx_refine_tls.L[1][1] 1.3803 _pdbx_refine_tls.L[2][2] 1.6757 _pdbx_refine_tls.L[3][3] 1.8691 _pdbx_refine_tls.L[1][2] -0.5881 _pdbx_refine_tls.L[1][3] -0.2187 _pdbx_refine_tls.L[2][3] -0.1356 _pdbx_refine_tls.S[1][1] 0.0004 _pdbx_refine_tls.S[1][2] 0.0397 _pdbx_refine_tls.S[1][3] -0.0328 _pdbx_refine_tls.S[2][1] -0.0168 _pdbx_refine_tls.S[2][2] 0.0024 _pdbx_refine_tls.S[2][3] 0.0987 _pdbx_refine_tls.S[3][1] 0.1029 _pdbx_refine_tls.S[3][2] -0.1445 _pdbx_refine_tls.S[3][3] -0.0028 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 27 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 245 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 204 ? ? O A HOH 401 ? ? 1.98 2 1 NZ A LYS 229 ? ? O A HOH 402 ? ? 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 33 ? ? 61.57 -161.22 2 1 VAL A 194 ? ? -58.07 104.39 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 596 ? 6.03 . 2 1 O ? A HOH 597 ? 7.05 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A GLU 6 ? A GLU 6 7 1 Y 1 A CYS 7 ? A CYS 7 8 1 Y 1 A THR 8 ? A THR 8 9 1 Y 1 A CYS 9 ? A CYS 9 10 1 Y 1 A GLU 10 ? A GLU 10 11 1 Y 1 A GLU 11 ? A GLU 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A LEU 13 ? A LEU 13 14 1 Y 1 A CYS 14 ? A CYS 14 15 1 Y 1 A GLU 15 ? A GLU 15 16 1 Y 1 A THR 16 ? A THR 16 17 1 Y 1 A LEU 17 ? A LEU 17 18 1 Y 1 A ARG 18 ? A ARG 18 19 1 Y 1 A ALA 19 ? A ALA 19 20 1 Y 1 A PHE 20 ? A PHE 20 21 1 Y 1 A SER 21 ? A SER 21 22 1 Y 1 A ALA 22 ? A ALA 22 23 1 Y 1 A GLN 23 ? A GLN 23 24 1 Y 1 A HIS 24 ? A HIS 24 25 1 Y 1 A PRO 25 ? A PRO 25 26 1 Y 1 A GLU 26 ? A GLU 26 27 1 Y 1 A HIS 246 ? A HIS 246 28 1 Y 1 A PRO 247 ? A PRO 247 29 1 Y 1 A ASP 248 ? A ASP 248 30 1 Y 1 A ASN 249 ? A ASN 249 31 1 Y 1 A LEU 250 ? A LEU 250 32 1 Y 1 A ASP 251 ? A ASP 251 33 1 Y 1 A ALA 252 ? A ALA 252 34 1 Y 1 A ALA 253 ? A ALA 253 35 1 Y 1 A ILE 254 ? A ILE 254 36 1 Y 1 A ARG 255 ? A ARG 255 37 1 Y 1 A SER 256 ? A SER 256 38 1 Y 1 A VAL 257 ? A VAL 257 39 1 Y 1 A GLU 258 ? A GLU 258 40 1 Y 1 A SER 259 ? A SER 259 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 ZN ZN ZN N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31570128 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'CHLORIDE ION' CL 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4BT2 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'equilibrium centrifugation' _pdbx_struct_assembly_auth_evidence.details ? #