data_6IPO # _entry.id 6IPO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.303 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6IPO WWPDB D_1300009687 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6IPO _pdbx_database_status.recvd_initial_deposition_date 2018-11-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zang, J.' 1 ? 'Chen, H.' 2 ? 'Zhang, X.' 3 ? 'Zhao, G.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 778 _citation.page_last 778 _citation.title 'Disulfide-mediated conversion of 8-mer bowl-like protein architecture into three different nanocages.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-019-08788-9 _citation.pdbx_database_id_PubMed 30770832 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zang, J.' 1 ? primary 'Chen, H.' 2 ? primary 'Zhang, X.' 3 ? primary 'Zhang, C.' 4 ? primary 'Guo, J.' 5 ? primary 'Du, M.' 6 ? primary 'Zhao, G.' 7 0000-0001-8587-9680 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6IPO _cell.details ? _cell.formula_units_Z ? _cell.length_a 236.229 _cell.length_a_esd ? _cell.length_b 236.229 _cell.length_b_esd ? _cell.length_c 236.229 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 192 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6IPO _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ferritin heavy chain' 20345.584 2 1.16.3.1 C90A/C102A/C130A/D144C ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 3 ? ? ? ? 3 water nat water 18.015 18 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ferritin H subunit,Cell proliferation-inducing gene 15 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRI FLQDIKKPDADDWESGLNAMEAALHLEKNVNQSLLELHKLATDKNDPHLADFIETHYLIKELGCHVTNLRKMGAPESGLA EYLFDKHTLGDSDNES ; _entity_poly.pdbx_seq_one_letter_code_can ;TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRI FLQDIKKPDADDWESGLNAMEAALHLEKNVNQSLLELHKLATDKNDPHLADFIETHYLIKELGCHVTNLRKMGAPESGLA EYLFDKHTLGDSDNES ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 THR n 1 3 ALA n 1 4 SER n 1 5 THR n 1 6 SER n 1 7 GLN n 1 8 VAL n 1 9 ARG n 1 10 GLN n 1 11 ASN n 1 12 TYR n 1 13 HIS n 1 14 GLN n 1 15 ASP n 1 16 SER n 1 17 GLU n 1 18 ALA n 1 19 ALA n 1 20 ILE n 1 21 ASN n 1 22 ARG n 1 23 GLN n 1 24 ILE n 1 25 ASN n 1 26 LEU n 1 27 GLU n 1 28 LEU n 1 29 TYR n 1 30 ALA n 1 31 SER n 1 32 TYR n 1 33 VAL n 1 34 TYR n 1 35 LEU n 1 36 SER n 1 37 MET n 1 38 SER n 1 39 TYR n 1 40 TYR n 1 41 PHE n 1 42 ASP n 1 43 ARG n 1 44 ASP n 1 45 ASP n 1 46 VAL n 1 47 ALA n 1 48 LEU n 1 49 LYS n 1 50 ASN n 1 51 PHE n 1 52 ALA n 1 53 LYS n 1 54 TYR n 1 55 PHE n 1 56 LEU n 1 57 HIS n 1 58 GLN n 1 59 SER n 1 60 HIS n 1 61 GLU n 1 62 GLU n 1 63 ARG n 1 64 GLU n 1 65 HIS n 1 66 ALA n 1 67 GLU n 1 68 LYS n 1 69 LEU n 1 70 MET n 1 71 LYS n 1 72 LEU n 1 73 GLN n 1 74 ASN n 1 75 GLN n 1 76 ARG n 1 77 GLY n 1 78 GLY n 1 79 ARG n 1 80 ILE n 1 81 PHE n 1 82 LEU n 1 83 GLN n 1 84 ASP n 1 85 ILE n 1 86 LYS n 1 87 LYS n 1 88 PRO n 1 89 ASP n 1 90 ALA n 1 91 ASP n 1 92 ASP n 1 93 TRP n 1 94 GLU n 1 95 SER n 1 96 GLY n 1 97 LEU n 1 98 ASN n 1 99 ALA n 1 100 MET n 1 101 GLU n 1 102 ALA n 1 103 ALA n 1 104 LEU n 1 105 HIS n 1 106 LEU n 1 107 GLU n 1 108 LYS n 1 109 ASN n 1 110 VAL n 1 111 ASN n 1 112 GLN n 1 113 SER n 1 114 LEU n 1 115 LEU n 1 116 GLU n 1 117 LEU n 1 118 HIS n 1 119 LYS n 1 120 LEU n 1 121 ALA n 1 122 THR n 1 123 ASP n 1 124 LYS n 1 125 ASN n 1 126 ASP n 1 127 PRO n 1 128 HIS n 1 129 LEU n 1 130 ALA n 1 131 ASP n 1 132 PHE n 1 133 ILE n 1 134 GLU n 1 135 THR n 1 136 HIS n 1 137 TYR n 1 138 LEU n 1 139 ILE n 1 140 LYS n 1 141 GLU n 1 142 LEU n 1 143 GLY n 1 144 CYS n 1 145 HIS n 1 146 VAL n 1 147 THR n 1 148 ASN n 1 149 LEU n 1 150 ARG n 1 151 LYS n 1 152 MET n 1 153 GLY n 1 154 ALA n 1 155 PRO n 1 156 GLU n 1 157 SER n 1 158 GLY n 1 159 LEU n 1 160 ALA n 1 161 GLU n 1 162 TYR n 1 163 LEU n 1 164 PHE n 1 165 ASP n 1 166 LYS n 1 167 HIS n 1 168 THR n 1 169 LEU n 1 170 GLY n 1 171 ASP n 1 172 SER n 1 173 ASP n 1 174 ASN n 1 175 GLU n 1 176 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 176 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FRIH_HUMAN _struct_ref.pdbx_db_accession P02794 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRI FLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGA PESGLAEYLFDKHTLGDSDNES ; _struct_ref.pdbx_align_begin 2 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6IPO A 1 ? 176 ? P02794 2 ? 183 ? 1 176 2 1 6IPO B 1 ? 176 ? P02794 2 ? 183 ? 1 176 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6IPO ALA A 90 ? UNP P02794 CYS 91 'engineered mutation' 90 1 1 6IPO ALA A 102 ? UNP P02794 CYS 103 'engineered mutation' 102 2 1 6IPO ALA A 130 ? UNP P02794 CYS 131 'engineered mutation' 130 3 1 6IPO ? A ? ? UNP P02794 ASN 140 deletion ? 4 1 6IPO ? A ? ? UNP P02794 GLU 141 deletion ? 5 1 6IPO ? A ? ? UNP P02794 GLN 142 deletion ? 6 1 6IPO ? A ? ? UNP P02794 VAL 143 deletion ? 7 1 6IPO ? A ? ? UNP P02794 LYS 144 deletion ? 8 1 6IPO ? A ? ? UNP P02794 ALA 145 deletion ? 9 1 6IPO CYS A 144 ? UNP P02794 ASP 151 'engineered mutation' 144 10 2 6IPO ALA B 90 ? UNP P02794 CYS 91 'engineered mutation' 90 11 2 6IPO ALA B 102 ? UNP P02794 CYS 103 'engineered mutation' 102 12 2 6IPO ALA B 130 ? UNP P02794 CYS 131 'engineered mutation' 130 13 2 6IPO ? B ? ? UNP P02794 ASN 140 deletion ? 14 2 6IPO ? B ? ? UNP P02794 GLU 141 deletion ? 15 2 6IPO ? B ? ? UNP P02794 GLN 142 deletion ? 16 2 6IPO ? B ? ? UNP P02794 VAL 143 deletion ? 17 2 6IPO ? B ? ? UNP P02794 LYS 144 deletion ? 18 2 6IPO ? B ? ? UNP P02794 ALA 145 deletion ? 19 2 6IPO CYS B 144 ? UNP P02794 ASP 151 'engineered mutation' 144 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6IPO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.67 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.49 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'magnesium chloride, PEG 400, TRIS' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-05-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9779 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9779 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6IPO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.699 _reflns.d_resolution_low 48.05 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11867 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.3 _reflns.pdbx_Rmerge_I_obs 0.1914 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.796 _reflns_shell.d_res_low 2.998 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6IPO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.998 _refine.ls_d_res_low 48.05 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11866 _refine.ls_number_reflns_R_free 565 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.98 _refine.ls_percent_reflns_R_free 4.76 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1938 _refine.ls_R_factor_R_free 0.2453 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1913 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2FHA _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.95 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.34 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2494 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 2515 _refine_hist.d_res_high 2.998 _refine_hist.d_res_low 48.05 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 2547 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.951 ? 3432 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 17.428 ? 1535 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.048 ? 359 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 452 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.9982 3.2998 . . 138 2735 100.00 . . . 0.2906 . 0.2233 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2998 3.7772 . . 150 2755 100.00 . . . 0.2757 . 0.2035 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7772 4.7582 . . 144 2799 100.00 . . . 0.2178 . 0.1728 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.7582 48.2263 . . 133 3012 100.00 . . . 0.2372 . 0.1888 . . . . . . . . . . # _struct.entry_id 6IPO _struct.title 'Ferritin mutant C90A/C102A/C130A/D144C' _struct.pdbx_descriptor 'Ferritin heavy chain (E.C.1.16.3.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6IPO _struct_keywords.text 'Ferritin, Disulfide bond, 48-mer nanocage, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? G N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 12 ? PHE A 41 ? TYR A 12 PHE A 41 1 ? 30 HELX_P HELX_P2 AA2 LEU A 48 ? ARG A 76 ? LEU A 48 ARG A 76 1 ? 29 HELX_P HELX_P3 AA3 SER A 95 ? THR A 122 ? SER A 95 THR A 122 1 ? 28 HELX_P HELX_P4 AA4 HIS A 128 ? GLY A 153 ? HIS A 128 GLY A 153 1 ? 26 HELX_P HELX_P5 AA5 SER A 157 ? THR A 168 ? SER A 157 THR A 168 1 ? 12 HELX_P HELX_P6 AA6 HIS B 13 ? PHE B 41 ? HIS B 13 PHE B 41 1 ? 29 HELX_P HELX_P7 AA7 LEU B 48 ? ARG B 76 ? LEU B 48 ARG B 76 1 ? 29 HELX_P HELX_P8 AA8 GLY B 96 ? LYS B 124 ? GLY B 96 LYS B 124 1 ? 29 HELX_P HELX_P9 AA9 ASP B 126 ? GLY B 143 ? ASP B 126 GLY B 143 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? B CYS 144 SG ? ? ? 1_555 B CYS 144 SG ? ? B CYS 144 B CYS 144 18_555 ? ? ? ? ? ? ? 2.049 ? metalc1 metalc ? ? A GLU 27 OE1 ? ? ? 1_555 C MG . MG ? ? A GLU 27 A MG 201 1_555 ? ? ? ? ? ? ? 2.287 ? metalc2 metalc ? ? A GLU 62 OE1 ? ? ? 1_555 C MG . MG ? ? A GLU 62 A MG 201 1_555 ? ? ? ? ? ? ? 2.118 ? metalc3 metalc ? ? A GLU 107 OE2 ? ? ? 1_555 C MG . MG ? ? A GLU 107 A MG 201 1_555 ? ? ? ? ? ? ? 2.911 ? metalc4 metalc ? ? B GLU 27 OE1 ? ? ? 1_555 D MG . MG ? ? B GLU 27 B MG 201 1_555 ? ? ? ? ? ? ? 1.844 ? metalc5 metalc ? ? B GLU 62 OE1 ? ? ? 1_555 D MG . MG ? ? B GLU 62 B MG 201 1_555 ? ? ? ? ? ? ? 2.326 ? metalc6 metalc ? ? B GLU 62 OE2 ? ? ? 1_555 D MG . MG ? ? B GLU 62 B MG 201 1_555 ? ? ? ? ? ? ? 2.099 ? metalc7 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 201 A HOH 308 1_555 ? ? ? ? ? ? ? 2.436 ? metalc8 metalc ? ? E MG . MG ? ? ? 1_555 G HOH . O ? ? B MG 202 B HOH 307 1_555 ? ? ? ? ? ? ? 2.753 ? metalc9 metalc ? ? E MG . MG ? ? ? 1_555 G HOH . O ? ? B MG 202 B HOH 307 18_555 ? ? ? ? ? ? ? 2.753 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 154 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 154 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 155 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 155 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.72 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 201 ? 4 'binding site for residue MG A 201' AC2 Software B MG 201 ? 4 'binding site for residue MG B 201' AC3 Software B MG 202 ? 6 'binding site for residue MG B 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 27 ? GLU A 27 . ? 1_555 ? 2 AC1 4 GLU A 62 ? GLU A 62 . ? 1_555 ? 3 AC1 4 GLU A 107 ? GLU A 107 . ? 1_555 ? 4 AC1 4 HOH F . ? HOH A 308 . ? 1_555 ? 5 AC2 4 GLU B 27 ? GLU B 27 . ? 1_555 ? 6 AC2 4 GLU B 62 ? GLU B 62 . ? 1_555 ? 7 AC2 4 HIS B 65 ? HIS B 65 . ? 1_555 ? 8 AC2 4 LYS B 140 ? LYS B 140 . ? 1_555 ? 9 AC3 6 GLU B 107 ? GLU B 107 . ? 1_555 ? 10 AC3 6 GLU B 107 ? GLU B 107 . ? 18_555 ? 11 AC3 6 GLU B 141 ? GLU B 141 . ? 18_555 ? 12 AC3 6 GLU B 141 ? GLU B 141 . ? 1_555 ? 13 AC3 6 HOH G . ? HOH B 307 . ? 18_555 ? 14 AC3 6 HOH G . ? HOH B 307 . ? 1_555 ? # _atom_sites.entry_id 6IPO _atom_sites.fract_transf_matrix[1][1] 0.004233 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.004233 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004233 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 SER 6 6 ? ? ? A . n A 1 7 GLN 7 7 ? ? ? A . n A 1 8 VAL 8 8 ? ? ? A . n A 1 9 ARG 9 9 ? ? ? A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 CYS 144 144 144 CYS CYS A . n A 1 145 HIS 145 145 145 HIS HIS A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 MET 152 152 152 MET MET A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 PRO 155 155 155 PRO PRO A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 TYR 162 162 162 TYR TYR A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 HIS 167 167 167 HIS HIS A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 SER 172 172 ? ? ? A . n A 1 173 ASP 173 173 ? ? ? A . n A 1 174 ASN 174 174 ? ? ? A . n A 1 175 GLU 175 175 ? ? ? A . n A 1 176 SER 176 176 ? ? ? A . n B 1 1 THR 1 1 ? ? ? B . n B 1 2 THR 2 2 ? ? ? B . n B 1 3 ALA 3 3 ? ? ? B . n B 1 4 SER 4 4 4 SER SER B . n B 1 5 THR 5 5 5 THR THR B . n B 1 6 SER 6 6 6 SER SER B . n B 1 7 GLN 7 7 7 GLN GLN B . n B 1 8 VAL 8 8 8 VAL VAL B . n B 1 9 ARG 9 9 9 ARG ARG B . n B 1 10 GLN 10 10 10 GLN GLN B . n B 1 11 ASN 11 11 11 ASN ASN B . n B 1 12 TYR 12 12 12 TYR TYR B . n B 1 13 HIS 13 13 13 HIS HIS B . n B 1 14 GLN 14 14 14 GLN GLN B . n B 1 15 ASP 15 15 15 ASP ASP B . n B 1 16 SER 16 16 16 SER SER B . n B 1 17 GLU 17 17 17 GLU GLU B . n B 1 18 ALA 18 18 18 ALA ALA B . n B 1 19 ALA 19 19 19 ALA ALA B . n B 1 20 ILE 20 20 20 ILE ILE B . n B 1 21 ASN 21 21 21 ASN ASN B . n B 1 22 ARG 22 22 22 ARG ARG B . n B 1 23 GLN 23 23 23 GLN GLN B . n B 1 24 ILE 24 24 24 ILE ILE B . n B 1 25 ASN 25 25 25 ASN ASN B . n B 1 26 LEU 26 26 26 LEU LEU B . n B 1 27 GLU 27 27 27 GLU GLU B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 TYR 29 29 29 TYR TYR B . n B 1 30 ALA 30 30 30 ALA ALA B . n B 1 31 SER 31 31 31 SER SER B . n B 1 32 TYR 32 32 32 TYR TYR B . n B 1 33 VAL 33 33 33 VAL VAL B . n B 1 34 TYR 34 34 34 TYR TYR B . n B 1 35 LEU 35 35 35 LEU LEU B . n B 1 36 SER 36 36 36 SER SER B . n B 1 37 MET 37 37 37 MET MET B . n B 1 38 SER 38 38 38 SER SER B . n B 1 39 TYR 39 39 39 TYR TYR B . n B 1 40 TYR 40 40 40 TYR TYR B . n B 1 41 PHE 41 41 41 PHE PHE B . n B 1 42 ASP 42 42 42 ASP ASP B . n B 1 43 ARG 43 43 43 ARG ARG B . n B 1 44 ASP 44 44 44 ASP ASP B . n B 1 45 ASP 45 45 45 ASP ASP B . n B 1 46 VAL 46 46 46 VAL VAL B . n B 1 47 ALA 47 47 47 ALA ALA B . n B 1 48 LEU 48 48 48 LEU LEU B . n B 1 49 LYS 49 49 49 LYS LYS B . n B 1 50 ASN 50 50 50 ASN ASN B . n B 1 51 PHE 51 51 51 PHE PHE B . n B 1 52 ALA 52 52 52 ALA ALA B . n B 1 53 LYS 53 53 53 LYS LYS B . n B 1 54 TYR 54 54 54 TYR TYR B . n B 1 55 PHE 55 55 55 PHE PHE B . n B 1 56 LEU 56 56 56 LEU LEU B . n B 1 57 HIS 57 57 57 HIS HIS B . n B 1 58 GLN 58 58 58 GLN GLN B . n B 1 59 SER 59 59 59 SER SER B . n B 1 60 HIS 60 60 60 HIS HIS B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 GLU 62 62 62 GLU GLU B . n B 1 63 ARG 63 63 63 ARG ARG B . n B 1 64 GLU 64 64 64 GLU GLU B . n B 1 65 HIS 65 65 65 HIS HIS B . n B 1 66 ALA 66 66 66 ALA ALA B . n B 1 67 GLU 67 67 67 GLU GLU B . n B 1 68 LYS 68 68 68 LYS LYS B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 MET 70 70 70 MET MET B . n B 1 71 LYS 71 71 71 LYS LYS B . n B 1 72 LEU 72 72 72 LEU LEU B . n B 1 73 GLN 73 73 73 GLN GLN B . n B 1 74 ASN 74 74 74 ASN ASN B . n B 1 75 GLN 75 75 75 GLN GLN B . n B 1 76 ARG 76 76 76 ARG ARG B . n B 1 77 GLY 77 77 77 GLY GLY B . n B 1 78 GLY 78 78 78 GLY GLY B . n B 1 79 ARG 79 79 79 ARG ARG B . n B 1 80 ILE 80 80 80 ILE ILE B . n B 1 81 PHE 81 81 81 PHE PHE B . n B 1 82 LEU 82 82 82 LEU LEU B . n B 1 83 GLN 83 83 83 GLN GLN B . n B 1 84 ASP 84 84 84 ASP ASP B . n B 1 85 ILE 85 85 85 ILE ILE B . n B 1 86 LYS 86 86 86 LYS LYS B . n B 1 87 LYS 87 87 87 LYS LYS B . n B 1 88 PRO 88 88 88 PRO PRO B . n B 1 89 ASP 89 89 89 ASP ASP B . n B 1 90 ALA 90 90 90 ALA ALA B . n B 1 91 ASP 91 91 91 ASP ASP B . n B 1 92 ASP 92 92 92 ASP ASP B . n B 1 93 TRP 93 93 93 TRP TRP B . n B 1 94 GLU 94 94 94 GLU GLU B . n B 1 95 SER 95 95 95 SER SER B . n B 1 96 GLY 96 96 96 GLY GLY B . n B 1 97 LEU 97 97 97 LEU LEU B . n B 1 98 ASN 98 98 98 ASN ASN B . n B 1 99 ALA 99 99 99 ALA ALA B . n B 1 100 MET 100 100 100 MET MET B . n B 1 101 GLU 101 101 101 GLU GLU B . n B 1 102 ALA 102 102 102 ALA ALA B . n B 1 103 ALA 103 103 103 ALA ALA B . n B 1 104 LEU 104 104 104 LEU LEU B . n B 1 105 HIS 105 105 105 HIS HIS B . n B 1 106 LEU 106 106 106 LEU LEU B . n B 1 107 GLU 107 107 107 GLU GLU B . n B 1 108 LYS 108 108 108 LYS LYS B . n B 1 109 ASN 109 109 109 ASN ASN B . n B 1 110 VAL 110 110 110 VAL VAL B . n B 1 111 ASN 111 111 111 ASN ASN B . n B 1 112 GLN 112 112 112 GLN GLN B . n B 1 113 SER 113 113 113 SER SER B . n B 1 114 LEU 114 114 114 LEU LEU B . n B 1 115 LEU 115 115 115 LEU LEU B . n B 1 116 GLU 116 116 116 GLU GLU B . n B 1 117 LEU 117 117 117 LEU LEU B . n B 1 118 HIS 118 118 118 HIS HIS B . n B 1 119 LYS 119 119 119 LYS LYS B . n B 1 120 LEU 120 120 120 LEU LEU B . n B 1 121 ALA 121 121 121 ALA ALA B . n B 1 122 THR 122 122 122 THR THR B . n B 1 123 ASP 123 123 123 ASP ASP B . n B 1 124 LYS 124 124 124 LYS LYS B . n B 1 125 ASN 125 125 125 ASN ASN B . n B 1 126 ASP 126 126 126 ASP ASP B . n B 1 127 PRO 127 127 127 PRO PRO B . n B 1 128 HIS 128 128 128 HIS HIS B . n B 1 129 LEU 129 129 129 LEU LEU B . n B 1 130 ALA 130 130 130 ALA ALA B . n B 1 131 ASP 131 131 131 ASP ASP B . n B 1 132 PHE 132 132 132 PHE PHE B . n B 1 133 ILE 133 133 133 ILE ILE B . n B 1 134 GLU 134 134 134 GLU GLU B . n B 1 135 THR 135 135 135 THR THR B . n B 1 136 HIS 136 136 136 HIS HIS B . n B 1 137 TYR 137 137 137 TYR TYR B . n B 1 138 LEU 138 138 138 LEU LEU B . n B 1 139 ILE 139 139 139 ILE ILE B . n B 1 140 LYS 140 140 140 LYS LYS B . n B 1 141 GLU 141 141 141 GLU GLU B . n B 1 142 LEU 142 142 142 LEU LEU B . n B 1 143 GLY 143 143 143 GLY GLY B . n B 1 144 CYS 144 144 144 CYS CYS B . n B 1 145 HIS 145 145 ? ? ? B . n B 1 146 VAL 146 146 ? ? ? B . n B 1 147 THR 147 147 ? ? ? B . n B 1 148 ASN 148 148 ? ? ? B . n B 1 149 LEU 149 149 ? ? ? B . n B 1 150 ARG 150 150 ? ? ? B . n B 1 151 LYS 151 151 ? ? ? B . n B 1 152 MET 152 152 ? ? ? B . n B 1 153 GLY 153 153 ? ? ? B . n B 1 154 ALA 154 154 ? ? ? B . n B 1 155 PRO 155 155 ? ? ? B . n B 1 156 GLU 156 156 ? ? ? B . n B 1 157 SER 157 157 ? ? ? B . n B 1 158 GLY 158 158 ? ? ? B . n B 1 159 LEU 159 159 ? ? ? B . n B 1 160 ALA 160 160 ? ? ? B . n B 1 161 GLU 161 161 ? ? ? B . n B 1 162 TYR 162 162 ? ? ? B . n B 1 163 LEU 163 163 ? ? ? B . n B 1 164 PHE 164 164 ? ? ? B . n B 1 165 ASP 165 165 ? ? ? B . n B 1 166 LYS 166 166 ? ? ? B . n B 1 167 HIS 167 167 ? ? ? B . n B 1 168 THR 168 168 ? ? ? B . n B 1 169 LEU 169 169 ? ? ? B . n B 1 170 GLY 170 170 ? ? ? B . n B 1 171 ASP 171 171 ? ? ? B . n B 1 172 SER 172 172 ? ? ? B . n B 1 173 ASP 173 173 ? ? ? B . n B 1 174 ASN 174 174 ? ? ? B . n B 1 175 GLU 175 175 ? ? ? B . n B 1 176 SER 176 176 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 MG 1 201 1 MG MG A . D 2 MG 1 201 2 MG MG B . E 2 MG 1 202 3 MG MG B . F 3 HOH 1 301 2 HOH HOH A . F 3 HOH 2 302 16 HOH HOH A . F 3 HOH 3 303 13 HOH HOH A . F 3 HOH 4 304 3 HOH HOH A . F 3 HOH 5 305 5 HOH HOH A . F 3 HOH 6 306 14 HOH HOH A . F 3 HOH 7 307 7 HOH HOH A . F 3 HOH 8 308 15 HOH HOH A . F 3 HOH 9 309 1 HOH HOH A . F 3 HOH 10 310 17 HOH HOH A . G 3 HOH 1 301 18 HOH HOH B . G 3 HOH 2 302 10 HOH HOH B . G 3 HOH 3 303 8 HOH HOH B . G 3 HOH 4 304 4 HOH HOH B . G 3 HOH 5 305 9 HOH HOH B . G 3 HOH 6 306 6 HOH HOH B . G 3 HOH 7 307 11 HOH HOH B . G 3 HOH 8 308 12 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 48-meric _pdbx_struct_assembly.oligomeric_count 48 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 154170 ? 1 MORE -869 ? 1 'SSA (A^2)' 285260 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 14 'crystal symmetry operation' 14_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 15 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_555 x,z,-y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_555 -x,-z,-y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_555 x,-z,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 22 'crystal symmetry operation' 22_555 z,-y,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 24 'crystal symmetry operation' 24_555 -z,-y,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 B MG 202 ? E MG . 2 1 A HOH 309 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 27 ? A GLU 27 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 OE1 ? A GLU 62 ? A GLU 62 ? 1_555 69.2 ? 2 OE1 ? A GLU 27 ? A GLU 27 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 OE2 ? A GLU 107 ? A GLU 107 ? 1_555 150.2 ? 3 OE1 ? A GLU 62 ? A GLU 62 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 OE2 ? A GLU 107 ? A GLU 107 ? 1_555 87.4 ? 4 OE1 ? A GLU 27 ? A GLU 27 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 308 ? 1_555 77.1 ? 5 OE1 ? A GLU 62 ? A GLU 62 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 308 ? 1_555 80.6 ? 6 OE2 ? A GLU 107 ? A GLU 107 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 308 ? 1_555 118.1 ? 7 OE1 ? B GLU 27 ? B GLU 27 ? 1_555 MG ? D MG . ? B MG 201 ? 1_555 OE1 ? B GLU 62 ? B GLU 62 ? 1_555 77.8 ? 8 OE1 ? B GLU 27 ? B GLU 27 ? 1_555 MG ? D MG . ? B MG 201 ? 1_555 OE2 ? B GLU 62 ? B GLU 62 ? 1_555 124.6 ? 9 OE1 ? B GLU 62 ? B GLU 62 ? 1_555 MG ? D MG . ? B MG 201 ? 1_555 OE2 ? B GLU 62 ? B GLU 62 ? 1_555 58.4 ? 10 O ? G HOH . ? B HOH 307 ? 1_555 MG ? E MG . ? B MG 202 ? 1_555 O ? G HOH . ? B HOH 307 ? 18_555 141.4 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2019-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NH1 B ARG 9 ? ? O B TYR 12 ? ? 2.00 2 1 NH2 B ARG 9 ? ? OE1 B GLU 17 ? ? 2.11 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ALA _pdbx_validate_rmsd_angle.auth_seq_id_1 154 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 155 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 155 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 136.62 _pdbx_validate_rmsd_angle.angle_target_value 120.60 _pdbx_validate_rmsd_angle.angle_deviation 16.02 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.20 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 47 ? ? 61.26 60.17 2 1 ARG A 76 ? ? -67.40 4.19 3 1 GLU A 94 ? ? 70.64 -54.03 4 1 THR A 122 ? ? 34.48 45.51 5 1 ASP A 126 ? ? 54.85 73.96 6 1 PRO A 127 ? ? -69.04 -73.63 7 1 GLN B 10 ? ? -168.13 104.52 8 1 ASP B 89 ? ? -84.41 47.45 9 1 ALA B 90 ? ? -173.86 148.30 10 1 TRP B 93 ? ? 52.61 -2.39 11 1 GLU B 94 ? ? 41.09 -102.07 12 1 ASN B 125 ? ? 32.16 63.90 13 1 ASP B 126 ? ? -118.39 77.09 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 1 ? A THR 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A SER 6 ? A SER 6 7 1 Y 1 A GLN 7 ? A GLN 7 8 1 Y 1 A VAL 8 ? A VAL 8 9 1 Y 1 A ARG 9 ? A ARG 9 10 1 Y 1 A SER 172 ? A SER 172 11 1 Y 1 A ASP 173 ? A ASP 173 12 1 Y 1 A ASN 174 ? A ASN 174 13 1 Y 1 A GLU 175 ? A GLU 175 14 1 Y 1 A SER 176 ? A SER 176 15 1 Y 1 B THR 1 ? B THR 1 16 1 Y 1 B THR 2 ? B THR 2 17 1 Y 1 B ALA 3 ? B ALA 3 18 1 Y 1 B HIS 145 ? B HIS 145 19 1 Y 1 B VAL 146 ? B VAL 146 20 1 Y 1 B THR 147 ? B THR 147 21 1 Y 1 B ASN 148 ? B ASN 148 22 1 Y 1 B LEU 149 ? B LEU 149 23 1 Y 1 B ARG 150 ? B ARG 150 24 1 Y 1 B LYS 151 ? B LYS 151 25 1 Y 1 B MET 152 ? B MET 152 26 1 Y 1 B GLY 153 ? B GLY 153 27 1 Y 1 B ALA 154 ? B ALA 154 28 1 Y 1 B PRO 155 ? B PRO 155 29 1 Y 1 B GLU 156 ? B GLU 156 30 1 Y 1 B SER 157 ? B SER 157 31 1 Y 1 B GLY 158 ? B GLY 158 32 1 Y 1 B LEU 159 ? B LEU 159 33 1 Y 1 B ALA 160 ? B ALA 160 34 1 Y 1 B GLU 161 ? B GLU 161 35 1 Y 1 B TYR 162 ? B TYR 162 36 1 Y 1 B LEU 163 ? B LEU 163 37 1 Y 1 B PHE 164 ? B PHE 164 38 1 Y 1 B ASP 165 ? B ASP 165 39 1 Y 1 B LYS 166 ? B LYS 166 40 1 Y 1 B HIS 167 ? B HIS 167 41 1 Y 1 B THR 168 ? B THR 168 42 1 Y 1 B LEU 169 ? B LEU 169 43 1 Y 1 B GLY 170 ? B GLY 170 44 1 Y 1 B ASP 171 ? B ASP 171 45 1 Y 1 B SER 172 ? B SER 172 46 1 Y 1 B ASP 173 ? B ASP 173 47 1 Y 1 B ASN 174 ? B ASN 174 48 1 Y 1 B GLU 175 ? B GLU 175 49 1 Y 1 B SER 176 ? B SER 176 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31730069 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'equilibrium centrifugation' _pdbx_struct_assembly_auth_evidence.details ? #