data_6IQE # _entry.id 6IQE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6IQE pdb_00006iqe 10.2210/pdb6iqe/pdb WWPDB D_1300009635 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6IQE _pdbx_database_status.recvd_initial_deposition_date 2018-11-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hirano, Y.' 1 0000-0002-3007-6052 'Koshiba, T.' 2 0000-0001-8535-5043 'Tamada, T.' 3 0000-0003-1419-8022 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Iscience _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2589-0042 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 19 _citation.language ? _citation.page_first 1065 _citation.page_last 1078 _citation.title 'Structural Basis of Mitochondrial Scaffolds by Prohibitin Complexes: Insight into a Role of the Coiled-Coil Region.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.isci.2019.08.056 _citation.pdbx_database_id_PubMed 31522117 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yoshinaka, T.' 1 ? primary 'Kosako, H.' 2 ? primary 'Yoshizumi, T.' 3 ? primary 'Furukawa, R.' 4 ? primary 'Hirano, Y.' 5 ? primary 'Kuge, O.' 6 ? primary 'Tamada, T.' 7 ? primary 'Koshiba, T.' 8 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6IQE _cell.details ? _cell.formula_units_Z ? _cell.length_a 65.142 _cell.length_a_esd ? _cell.length_b 65.142 _cell.length_b_esd ? _cell.length_c 62.288 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6IQE _symmetry.cell_setting ? _symmetry.Int_Tables_number 91 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Prohibitin-2 9818.110 1 ? ? ? ? 2 water nat water 18.015 75 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'B-cell receptor-associated protein BAP37,D-prohibitin,Repressor of estrogen receptor activity' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIAL EHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;GSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIAL EHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PHE n 1 4 SER n 1 5 ARG n 1 6 GLU n 1 7 TYR n 1 8 THR n 1 9 ALA n 1 10 ALA n 1 11 VAL n 1 12 GLU n 1 13 ALA n 1 14 LYS n 1 15 GLN n 1 16 VAL n 1 17 ALA n 1 18 GLN n 1 19 GLN n 1 20 GLU n 1 21 ALA n 1 22 GLN n 1 23 ARG n 1 24 ALA n 1 25 GLN n 1 26 PHE n 1 27 LEU n 1 28 VAL n 1 29 GLU n 1 30 LYS n 1 31 ALA n 1 32 LYS n 1 33 GLN n 1 34 GLU n 1 35 GLN n 1 36 ARG n 1 37 GLN n 1 38 LYS n 1 39 ILE n 1 40 VAL n 1 41 GLN n 1 42 ALA n 1 43 GLU n 1 44 GLY n 1 45 GLU n 1 46 ALA n 1 47 GLU n 1 48 ALA n 1 49 ALA n 1 50 LYS n 1 51 MET n 1 52 LEU n 1 53 GLY n 1 54 GLU n 1 55 ALA n 1 56 LEU n 1 57 SER n 1 58 LYS n 1 59 ASN n 1 60 PRO n 1 61 GLY n 1 62 TYR n 1 63 ILE n 1 64 LYS n 1 65 LEU n 1 66 ARG n 1 67 LYS n 1 68 ILE n 1 69 ARG n 1 70 ALA n 1 71 ALA n 1 72 GLN n 1 73 ASN n 1 74 ILE n 1 75 SER n 1 76 LYS n 1 77 THR n 1 78 ILE n 1 79 ALA n 1 80 LEU n 1 81 GLU n 1 82 HIS n 1 83 HIS n 1 84 HIS n 1 85 HIS n 1 86 HIS n 1 87 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 87 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PHB2, BAP, REA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PHB2_HUMAN _struct_ref.pdbx_db_accession Q99623 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIA _struct_ref.pdbx_align_begin 188 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6IQE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 79 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99623 _struct_ref_seq.db_align_beg 188 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 265 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 188 _struct_ref_seq.pdbx_auth_seq_align_end 265 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6IQE GLY A 1 ? UNP Q99623 ? ? 'expression tag' 187 1 1 6IQE LEU A 80 ? UNP Q99623 ? ? 'expression tag' 266 2 1 6IQE GLU A 81 ? UNP Q99623 ? ? 'expression tag' 267 3 1 6IQE HIS A 82 ? UNP Q99623 ? ? 'expression tag' 268 4 1 6IQE HIS A 83 ? UNP Q99623 ? ? 'expression tag' 269 5 1 6IQE HIS A 84 ? UNP Q99623 ? ? 'expression tag' 270 6 1 6IQE HIS A 85 ? UNP Q99623 ? ? 'expression tag' 271 7 1 6IQE HIS A 86 ? UNP Q99623 ? ? 'expression tag' 272 8 1 6IQE HIS A 87 ? UNP Q99623 ? ? 'expression tag' 273 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6IQE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.37 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.45 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.0 M (NH4)Cl, 0.1 M Na-acetate pH 4.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL41XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL41XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6IQE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.7 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15289 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.7 _reflns_shell.d_res_low 1.73 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6IQE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.701 _refine.ls_d_res_low 46.062 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15264 _refine.ls_number_reflns_R_free 745 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.84 _refine.ls_percent_reflns_R_free 4.88 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2170 _refine.ls_R_factor_R_free 0.2389 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2159 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4TQL _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.10 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.25 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 456 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 75 _refine_hist.number_atoms_total 531 _refine_hist.d_res_high 1.701 _refine_hist.d_res_low 46.062 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 483 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.918 ? 646 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 15.960 ? 196 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.035 ? 68 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 89 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7011 1.8324 . . 130 2833 100.00 . . . 0.3517 . 0.3412 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8324 2.0168 . . 164 2836 100.00 . . . 0.3169 . 0.2776 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0168 2.3086 . . 155 2874 100.00 . . . 0.2028 . 0.1986 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3086 2.9086 . . 142 2905 100.00 . . . 0.2041 . 0.1962 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9086 46.0792 . . 154 3071 100.00 . . . 0.2364 . 0.2022 . . . . . . . . . . # _struct.entry_id 6IQE _struct.title 'Human prohibitin 2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6IQE _struct_keywords.text 'Mitochondrial function and morphology, Transcriptional modulation, coiled coil, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 1 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 59 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 187 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 245 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 59 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6IQE _atom_sites.fract_transf_matrix[1][1] 0.015351 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015351 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016054 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 187 187 GLY GLY A . n A 1 2 SER 2 188 188 SER SER A . n A 1 3 PHE 3 189 189 PHE PHE A . n A 1 4 SER 4 190 190 SER SER A . n A 1 5 ARG 5 191 191 ARG ARG A . n A 1 6 GLU 6 192 192 GLU GLU A . n A 1 7 TYR 7 193 193 TYR TYR A . n A 1 8 THR 8 194 194 THR THR A . n A 1 9 ALA 9 195 195 ALA ALA A . n A 1 10 ALA 10 196 196 ALA ALA A . n A 1 11 VAL 11 197 197 VAL VAL A . n A 1 12 GLU 12 198 198 GLU GLU A . n A 1 13 ALA 13 199 199 ALA ALA A . n A 1 14 LYS 14 200 200 LYS LYS A . n A 1 15 GLN 15 201 201 GLN GLN A . n A 1 16 VAL 16 202 202 VAL VAL A . n A 1 17 ALA 17 203 203 ALA ALA A . n A 1 18 GLN 18 204 204 GLN GLN A . n A 1 19 GLN 19 205 205 GLN GLN A . n A 1 20 GLU 20 206 206 GLU GLU A . n A 1 21 ALA 21 207 207 ALA ALA A . n A 1 22 GLN 22 208 208 GLN GLN A . n A 1 23 ARG 23 209 209 ARG ARG A . n A 1 24 ALA 24 210 210 ALA ALA A . n A 1 25 GLN 25 211 211 GLN GLN A . n A 1 26 PHE 26 212 212 PHE PHE A . n A 1 27 LEU 27 213 213 LEU LEU A . n A 1 28 VAL 28 214 214 VAL VAL A . n A 1 29 GLU 29 215 215 GLU GLU A . n A 1 30 LYS 30 216 216 LYS LYS A . n A 1 31 ALA 31 217 217 ALA ALA A . n A 1 32 LYS 32 218 218 LYS LYS A . n A 1 33 GLN 33 219 219 GLN GLN A . n A 1 34 GLU 34 220 220 GLU GLU A . n A 1 35 GLN 35 221 221 GLN GLN A . n A 1 36 ARG 36 222 222 ARG ARG A . n A 1 37 GLN 37 223 223 GLN GLN A . n A 1 38 LYS 38 224 224 LYS LYS A . n A 1 39 ILE 39 225 225 ILE ILE A . n A 1 40 VAL 40 226 226 VAL VAL A . n A 1 41 GLN 41 227 227 GLN GLN A . n A 1 42 ALA 42 228 228 ALA ALA A . n A 1 43 GLU 43 229 229 GLU GLU A . n A 1 44 GLY 44 230 230 GLY GLY A . n A 1 45 GLU 45 231 231 GLU GLU A . n A 1 46 ALA 46 232 232 ALA ALA A . n A 1 47 GLU 47 233 233 GLU GLU A . n A 1 48 ALA 48 234 234 ALA ALA A . n A 1 49 ALA 49 235 235 ALA ALA A . n A 1 50 LYS 50 236 236 LYS LYS A . n A 1 51 MET 51 237 237 MET MET A . n A 1 52 LEU 52 238 238 LEU LEU A . n A 1 53 GLY 53 239 239 GLY GLY A . n A 1 54 GLU 54 240 240 GLU GLU A . n A 1 55 ALA 55 241 241 ALA ALA A . n A 1 56 LEU 56 242 242 LEU LEU A . n A 1 57 SER 57 243 243 SER SER A . n A 1 58 LYS 58 244 244 LYS LYS A . n A 1 59 ASN 59 245 245 ASN ASN A . n A 1 60 PRO 60 246 ? ? ? A . n A 1 61 GLY 61 247 ? ? ? A . n A 1 62 TYR 62 248 ? ? ? A . n A 1 63 ILE 63 249 ? ? ? A . n A 1 64 LYS 64 250 ? ? ? A . n A 1 65 LEU 65 251 ? ? ? A . n A 1 66 ARG 66 252 ? ? ? A . n A 1 67 LYS 67 253 ? ? ? A . n A 1 68 ILE 68 254 ? ? ? A . n A 1 69 ARG 69 255 ? ? ? A . n A 1 70 ALA 70 256 ? ? ? A . n A 1 71 ALA 71 257 ? ? ? A . n A 1 72 GLN 72 258 ? ? ? A . n A 1 73 ASN 73 259 ? ? ? A . n A 1 74 ILE 74 260 ? ? ? A . n A 1 75 SER 75 261 ? ? ? A . n A 1 76 LYS 76 262 ? ? ? A . n A 1 77 THR 77 263 ? ? ? A . n A 1 78 ILE 78 264 ? ? ? A . n A 1 79 ALA 79 265 ? ? ? A . n A 1 80 LEU 80 266 ? ? ? A . n A 1 81 GLU 81 267 ? ? ? A . n A 1 82 HIS 82 268 ? ? ? A . n A 1 83 HIS 83 269 ? ? ? A . n A 1 84 HIS 84 270 ? ? ? A . n A 1 85 HIS 85 271 ? ? ? A . n A 1 86 HIS 86 272 ? ? ? A . n A 1 87 HIS 87 273 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 8 HOH HOH A . B 2 HOH 2 302 20 HOH HOH A . B 2 HOH 3 303 53 HOH HOH A . B 2 HOH 4 304 18 HOH HOH A . B 2 HOH 5 305 35 HOH HOH A . B 2 HOH 6 306 1 HOH HOH A . B 2 HOH 7 307 40 HOH HOH A . B 2 HOH 8 308 39 HOH HOH A . B 2 HOH 9 309 24 HOH HOH A . B 2 HOH 10 310 3 HOH HOH A . B 2 HOH 11 311 6 HOH HOH A . B 2 HOH 12 312 12 HOH HOH A . B 2 HOH 13 313 38 HOH HOH A . B 2 HOH 14 314 63 HOH HOH A . B 2 HOH 15 315 80 HOH HOH A . B 2 HOH 16 316 2 HOH HOH A . B 2 HOH 17 317 11 HOH HOH A . B 2 HOH 18 318 22 HOH HOH A . B 2 HOH 19 319 51 HOH HOH A . B 2 HOH 20 320 7 HOH HOH A . B 2 HOH 21 321 15 HOH HOH A . B 2 HOH 22 322 33 HOH HOH A . B 2 HOH 23 323 28 HOH HOH A . B 2 HOH 24 324 31 HOH HOH A . B 2 HOH 25 325 30 HOH HOH A . B 2 HOH 26 326 59 HOH HOH A . B 2 HOH 27 327 61 HOH HOH A . B 2 HOH 28 328 25 HOH HOH A . B 2 HOH 29 329 36 HOH HOH A . B 2 HOH 30 330 14 HOH HOH A . B 2 HOH 31 331 44 HOH HOH A . B 2 HOH 32 332 9 HOH HOH A . B 2 HOH 33 333 70 HOH HOH A . B 2 HOH 34 334 10 HOH HOH A . B 2 HOH 35 335 29 HOH HOH A . B 2 HOH 36 336 65 HOH HOH A . B 2 HOH 37 337 62 HOH HOH A . B 2 HOH 38 338 4 HOH HOH A . B 2 HOH 39 339 16 HOH HOH A . B 2 HOH 40 340 23 HOH HOH A . B 2 HOH 41 341 55 HOH HOH A . B 2 HOH 42 342 47 HOH HOH A . B 2 HOH 43 343 45 HOH HOH A . B 2 HOH 44 344 72 HOH HOH A . B 2 HOH 45 345 21 HOH HOH A . B 2 HOH 46 346 78 HOH HOH A . B 2 HOH 47 347 54 HOH HOH A . B 2 HOH 48 348 34 HOH HOH A . B 2 HOH 49 349 26 HOH HOH A . B 2 HOH 50 350 56 HOH HOH A . B 2 HOH 51 351 60 HOH HOH A . B 2 HOH 52 352 46 HOH HOH A . B 2 HOH 53 353 32 HOH HOH A . B 2 HOH 54 354 52 HOH HOH A . B 2 HOH 55 355 73 HOH HOH A . B 2 HOH 56 356 42 HOH HOH A . B 2 HOH 57 357 58 HOH HOH A . B 2 HOH 58 358 13 HOH HOH A . B 2 HOH 59 359 69 HOH HOH A . B 2 HOH 60 360 5 HOH HOH A . B 2 HOH 61 361 27 HOH HOH A . B 2 HOH 62 362 48 HOH HOH A . B 2 HOH 63 363 43 HOH HOH A . B 2 HOH 64 364 75 HOH HOH A . B 2 HOH 65 365 66 HOH HOH A . B 2 HOH 66 366 17 HOH HOH A . B 2 HOH 67 367 57 HOH HOH A . B 2 HOH 68 368 19 HOH HOH A . B 2 HOH 69 369 68 HOH HOH A . B 2 HOH 70 370 50 HOH HOH A . B 2 HOH 71 371 64 HOH HOH A . B 2 HOH 72 372 67 HOH HOH A . B 2 HOH 73 373 77 HOH HOH A . B 2 HOH 74 374 49 HOH HOH A . B 2 HOH 75 375 76 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1360 ? 1 MORE -13 ? 1 'SSA (A^2)' 9550 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_455 -x-1,y,-z -1.0000000000 0.0000000000 0.0000000000 -65.1420000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 368 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-09-25 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.4_1496 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 323 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 374 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 244 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -93.49 _pdbx_validate_torsion.psi -100.53 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 246 ? A PRO 60 2 1 Y 1 A GLY 247 ? A GLY 61 3 1 Y 1 A TYR 248 ? A TYR 62 4 1 Y 1 A ILE 249 ? A ILE 63 5 1 Y 1 A LYS 250 ? A LYS 64 6 1 Y 1 A LEU 251 ? A LEU 65 7 1 Y 1 A ARG 252 ? A ARG 66 8 1 Y 1 A LYS 253 ? A LYS 67 9 1 Y 1 A ILE 254 ? A ILE 68 10 1 Y 1 A ARG 255 ? A ARG 69 11 1 Y 1 A ALA 256 ? A ALA 70 12 1 Y 1 A ALA 257 ? A ALA 71 13 1 Y 1 A GLN 258 ? A GLN 72 14 1 Y 1 A ASN 259 ? A ASN 73 15 1 Y 1 A ILE 260 ? A ILE 74 16 1 Y 1 A SER 261 ? A SER 75 17 1 Y 1 A LYS 262 ? A LYS 76 18 1 Y 1 A THR 263 ? A THR 77 19 1 Y 1 A ILE 264 ? A ILE 78 20 1 Y 1 A ALA 265 ? A ALA 79 21 1 Y 1 A LEU 266 ? A LEU 80 22 1 Y 1 A GLU 267 ? A GLU 81 23 1 Y 1 A HIS 268 ? A HIS 82 24 1 Y 1 A HIS 269 ? A HIS 83 25 1 Y 1 A HIS 270 ? A HIS 84 26 1 Y 1 A HIS 271 ? A HIS 85 27 1 Y 1 A HIS 272 ? A HIS 86 28 1 Y 1 A HIS 273 ? A HIS 87 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 GLY N N N N 97 GLY CA C N N 98 GLY C C N N 99 GLY O O N N 100 GLY OXT O N N 101 GLY H H N N 102 GLY H2 H N N 103 GLY HA2 H N N 104 GLY HA3 H N N 105 GLY HXT H N N 106 HIS N N N N 107 HIS CA C N S 108 HIS C C N N 109 HIS O O N N 110 HIS CB C N N 111 HIS CG C Y N 112 HIS ND1 N Y N 113 HIS CD2 C Y N 114 HIS CE1 C Y N 115 HIS NE2 N Y N 116 HIS OXT O N N 117 HIS H H N N 118 HIS H2 H N N 119 HIS HA H N N 120 HIS HB2 H N N 121 HIS HB3 H N N 122 HIS HD1 H N N 123 HIS HD2 H N N 124 HIS HE1 H N N 125 HIS HE2 H N N 126 HIS HXT H N N 127 HOH O O N N 128 HOH H1 H N N 129 HOH H2 H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PHE N N N N 220 PHE CA C N S 221 PHE C C N N 222 PHE O O N N 223 PHE CB C N N 224 PHE CG C Y N 225 PHE CD1 C Y N 226 PHE CD2 C Y N 227 PHE CE1 C Y N 228 PHE CE2 C Y N 229 PHE CZ C Y N 230 PHE OXT O N N 231 PHE H H N N 232 PHE H2 H N N 233 PHE HA H N N 234 PHE HB2 H N N 235 PHE HB3 H N N 236 PHE HD1 H N N 237 PHE HD2 H N N 238 PHE HE1 H N N 239 PHE HE2 H N N 240 PHE HZ H N N 241 PHE HXT H N N 242 PRO N N N N 243 PRO CA C N S 244 PRO C C N N 245 PRO O O N N 246 PRO CB C N N 247 PRO CG C N N 248 PRO CD C N N 249 PRO OXT O N N 250 PRO H H N N 251 PRO HA H N N 252 PRO HB2 H N N 253 PRO HB3 H N N 254 PRO HG2 H N N 255 PRO HG3 H N N 256 PRO HD2 H N N 257 PRO HD3 H N N 258 PRO HXT H N N 259 SER N N N N 260 SER CA C N S 261 SER C C N N 262 SER O O N N 263 SER CB C N N 264 SER OG O N N 265 SER OXT O N N 266 SER H H N N 267 SER H2 H N N 268 SER HA H N N 269 SER HB2 H N N 270 SER HB3 H N N 271 SER HG H N N 272 SER HXT H N N 273 THR N N N N 274 THR CA C N S 275 THR C C N N 276 THR O O N N 277 THR CB C N R 278 THR OG1 O N N 279 THR CG2 C N N 280 THR OXT O N N 281 THR H H N N 282 THR H2 H N N 283 THR HA H N N 284 THR HB H N N 285 THR HG1 H N N 286 THR HG21 H N N 287 THR HG22 H N N 288 THR HG23 H N N 289 THR HXT H N N 290 TYR N N N N 291 TYR CA C N S 292 TYR C C N N 293 TYR O O N N 294 TYR CB C N N 295 TYR CG C Y N 296 TYR CD1 C Y N 297 TYR CD2 C Y N 298 TYR CE1 C Y N 299 TYR CE2 C Y N 300 TYR CZ C Y N 301 TYR OH O N N 302 TYR OXT O N N 303 TYR H H N N 304 TYR H2 H N N 305 TYR HA H N N 306 TYR HB2 H N N 307 TYR HB3 H N N 308 TYR HD1 H N N 309 TYR HD2 H N N 310 TYR HE1 H N N 311 TYR HE2 H N N 312 TYR HH H N N 313 TYR HXT H N N 314 VAL N N N N 315 VAL CA C N S 316 VAL C C N N 317 VAL O O N N 318 VAL CB C N N 319 VAL CG1 C N N 320 VAL CG2 C N N 321 VAL OXT O N N 322 VAL H H N N 323 VAL H2 H N N 324 VAL HA H N N 325 VAL HB H N N 326 VAL HG11 H N N 327 VAL HG12 H N N 328 VAL HG13 H N N 329 VAL HG21 H N N 330 VAL HG22 H N N 331 VAL HG23 H N N 332 VAL HXT H N N 333 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 GLY N CA sing N N 92 GLY N H sing N N 93 GLY N H2 sing N N 94 GLY CA C sing N N 95 GLY CA HA2 sing N N 96 GLY CA HA3 sing N N 97 GLY C O doub N N 98 GLY C OXT sing N N 99 GLY OXT HXT sing N N 100 HIS N CA sing N N 101 HIS N H sing N N 102 HIS N H2 sing N N 103 HIS CA C sing N N 104 HIS CA CB sing N N 105 HIS CA HA sing N N 106 HIS C O doub N N 107 HIS C OXT sing N N 108 HIS CB CG sing N N 109 HIS CB HB2 sing N N 110 HIS CB HB3 sing N N 111 HIS CG ND1 sing Y N 112 HIS CG CD2 doub Y N 113 HIS ND1 CE1 doub Y N 114 HIS ND1 HD1 sing N N 115 HIS CD2 NE2 sing Y N 116 HIS CD2 HD2 sing N N 117 HIS CE1 NE2 sing Y N 118 HIS CE1 HE1 sing N N 119 HIS NE2 HE2 sing N N 120 HIS OXT HXT sing N N 121 HOH O H1 sing N N 122 HOH O H2 sing N N 123 ILE N CA sing N N 124 ILE N H sing N N 125 ILE N H2 sing N N 126 ILE CA C sing N N 127 ILE CA CB sing N N 128 ILE CA HA sing N N 129 ILE C O doub N N 130 ILE C OXT sing N N 131 ILE CB CG1 sing N N 132 ILE CB CG2 sing N N 133 ILE CB HB sing N N 134 ILE CG1 CD1 sing N N 135 ILE CG1 HG12 sing N N 136 ILE CG1 HG13 sing N N 137 ILE CG2 HG21 sing N N 138 ILE CG2 HG22 sing N N 139 ILE CG2 HG23 sing N N 140 ILE CD1 HD11 sing N N 141 ILE CD1 HD12 sing N N 142 ILE CD1 HD13 sing N N 143 ILE OXT HXT sing N N 144 LEU N CA sing N N 145 LEU N H sing N N 146 LEU N H2 sing N N 147 LEU CA C sing N N 148 LEU CA CB sing N N 149 LEU CA HA sing N N 150 LEU C O doub N N 151 LEU C OXT sing N N 152 LEU CB CG sing N N 153 LEU CB HB2 sing N N 154 LEU CB HB3 sing N N 155 LEU CG CD1 sing N N 156 LEU CG CD2 sing N N 157 LEU CG HG sing N N 158 LEU CD1 HD11 sing N N 159 LEU CD1 HD12 sing N N 160 LEU CD1 HD13 sing N N 161 LEU CD2 HD21 sing N N 162 LEU CD2 HD22 sing N N 163 LEU CD2 HD23 sing N N 164 LEU OXT HXT sing N N 165 LYS N CA sing N N 166 LYS N H sing N N 167 LYS N H2 sing N N 168 LYS CA C sing N N 169 LYS CA CB sing N N 170 LYS CA HA sing N N 171 LYS C O doub N N 172 LYS C OXT sing N N 173 LYS CB CG sing N N 174 LYS CB HB2 sing N N 175 LYS CB HB3 sing N N 176 LYS CG CD sing N N 177 LYS CG HG2 sing N N 178 LYS CG HG3 sing N N 179 LYS CD CE sing N N 180 LYS CD HD2 sing N N 181 LYS CD HD3 sing N N 182 LYS CE NZ sing N N 183 LYS CE HE2 sing N N 184 LYS CE HE3 sing N N 185 LYS NZ HZ1 sing N N 186 LYS NZ HZ2 sing N N 187 LYS NZ HZ3 sing N N 188 LYS OXT HXT sing N N 189 MET N CA sing N N 190 MET N H sing N N 191 MET N H2 sing N N 192 MET CA C sing N N 193 MET CA CB sing N N 194 MET CA HA sing N N 195 MET C O doub N N 196 MET C OXT sing N N 197 MET CB CG sing N N 198 MET CB HB2 sing N N 199 MET CB HB3 sing N N 200 MET CG SD sing N N 201 MET CG HG2 sing N N 202 MET CG HG3 sing N N 203 MET SD CE sing N N 204 MET CE HE1 sing N N 205 MET CE HE2 sing N N 206 MET CE HE3 sing N N 207 MET OXT HXT sing N N 208 PHE N CA sing N N 209 PHE N H sing N N 210 PHE N H2 sing N N 211 PHE CA C sing N N 212 PHE CA CB sing N N 213 PHE CA HA sing N N 214 PHE C O doub N N 215 PHE C OXT sing N N 216 PHE CB CG sing N N 217 PHE CB HB2 sing N N 218 PHE CB HB3 sing N N 219 PHE CG CD1 doub Y N 220 PHE CG CD2 sing Y N 221 PHE CD1 CE1 sing Y N 222 PHE CD1 HD1 sing N N 223 PHE CD2 CE2 doub Y N 224 PHE CD2 HD2 sing N N 225 PHE CE1 CZ doub Y N 226 PHE CE1 HE1 sing N N 227 PHE CE2 CZ sing Y N 228 PHE CE2 HE2 sing N N 229 PHE CZ HZ sing N N 230 PHE OXT HXT sing N N 231 PRO N CA sing N N 232 PRO N CD sing N N 233 PRO N H sing N N 234 PRO CA C sing N N 235 PRO CA CB sing N N 236 PRO CA HA sing N N 237 PRO C O doub N N 238 PRO C OXT sing N N 239 PRO CB CG sing N N 240 PRO CB HB2 sing N N 241 PRO CB HB3 sing N N 242 PRO CG CD sing N N 243 PRO CG HG2 sing N N 244 PRO CG HG3 sing N N 245 PRO CD HD2 sing N N 246 PRO CD HD3 sing N N 247 PRO OXT HXT sing N N 248 SER N CA sing N N 249 SER N H sing N N 250 SER N H2 sing N N 251 SER CA C sing N N 252 SER CA CB sing N N 253 SER CA HA sing N N 254 SER C O doub N N 255 SER C OXT sing N N 256 SER CB OG sing N N 257 SER CB HB2 sing N N 258 SER CB HB3 sing N N 259 SER OG HG sing N N 260 SER OXT HXT sing N N 261 THR N CA sing N N 262 THR N H sing N N 263 THR N H2 sing N N 264 THR CA C sing N N 265 THR CA CB sing N N 266 THR CA HA sing N N 267 THR C O doub N N 268 THR C OXT sing N N 269 THR CB OG1 sing N N 270 THR CB CG2 sing N N 271 THR CB HB sing N N 272 THR OG1 HG1 sing N N 273 THR CG2 HG21 sing N N 274 THR CG2 HG22 sing N N 275 THR CG2 HG23 sing N N 276 THR OXT HXT sing N N 277 TYR N CA sing N N 278 TYR N H sing N N 279 TYR N H2 sing N N 280 TYR CA C sing N N 281 TYR CA CB sing N N 282 TYR CA HA sing N N 283 TYR C O doub N N 284 TYR C OXT sing N N 285 TYR CB CG sing N N 286 TYR CB HB2 sing N N 287 TYR CB HB3 sing N N 288 TYR CG CD1 doub Y N 289 TYR CG CD2 sing Y N 290 TYR CD1 CE1 sing Y N 291 TYR CD1 HD1 sing N N 292 TYR CD2 CE2 doub Y N 293 TYR CD2 HD2 sing N N 294 TYR CE1 CZ doub Y N 295 TYR CE1 HE1 sing N N 296 TYR CE2 CZ sing Y N 297 TYR CE2 HE2 sing N N 298 TYR CZ OH sing N N 299 TYR OH HH sing N N 300 TYR OXT HXT sing N N 301 VAL N CA sing N N 302 VAL N H sing N N 303 VAL N H2 sing N N 304 VAL CA C sing N N 305 VAL CA CB sing N N 306 VAL CA HA sing N N 307 VAL C O doub N N 308 VAL C OXT sing N N 309 VAL CB CG1 sing N N 310 VAL CB CG2 sing N N 311 VAL CB HB sing N N 312 VAL CG1 HG11 sing N N 313 VAL CG1 HG12 sing N N 314 VAL CG1 HG13 sing N N 315 VAL CG2 HG21 sing N N 316 VAL CG2 HG22 sing N N 317 VAL CG2 HG23 sing N N 318 VAL OXT HXT sing N N 319 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4TQL _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support cross-linking _pdbx_struct_assembly_auth_evidence.details ? #