data_6J4C
# 
_entry.id   6J4C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.387 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6J4C         pdb_00006j4c 10.2210/pdb6j4c/pdb 
WWPDB D_1300010385 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-01-15 
2 'Structure model' 1 1 2024-03-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Database references'  
3 2 'Structure model' 'Derived calculations' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom         
2 2 'Structure model' chem_comp_bond         
3 2 'Structure model' database_2             
4 2 'Structure model' pdbx_struct_conn_angle 
5 2 'Structure model' struct_conn            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_database_2.pdbx_DOI'                        
2  2 'Structure model' '_database_2.pdbx_database_accession'         
3  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
4  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
5  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
6  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
7  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
8  2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
9  2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry'      
11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
16 2 'Structure model' '_pdbx_struct_conn_angle.value'               
17 2 'Structure model' '_struct_conn.pdbx_dist_value'                
18 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
19 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
20 2 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
21 2 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
22 2 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
23 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
24 2 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
25 2 'Structure model' '_struct_conn.ptnr2_symmetry'                 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6J4C 
_pdbx_database_status.recvd_initial_deposition_date   2019-01-08 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB '6J4B contains the same protein but crystallized under a different condition.' 6J4B unspecified 
PDB '6J4D contains the same protein but crystallized under a different condition.' 6J4D unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Hou, Y.'   1 ? 
'Liu, B.'   2 ? 
'Hu, K.'    3 ? 
'Zhang, R.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Org.Biomol.Chem. 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1477-0539 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            17 
_citation.language                  ? 
_citation.page_first                9605 
_citation.page_last                 9614 
_citation.title                     'Structural basis of the mechanism of beta-methyl epimerization by enzyme MarH.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1039/c9ob01996k 
_citation.pdbx_database_id_PubMed   31681917 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Liu, B.'   1  0000-0002-4402-4595 
primary 'Hou, Y.'   2  ?                   
primary 'Wang, X.'  3  ?                   
primary 'Ma, X.'    4  ?                   
primary 'Fang, S.'  5  ?                   
primary 'Huang, T.' 6  ?                   
primary 'Chen, Y.'  7  ?                   
primary 'Bai, Z.'   8  ?                   
primary 'Lin, S.'   9  0000-0001-9406-9233 
primary 'Zhang, R.' 10 0000-0002-1719-1961 
primary 'Hu, K.'    11 0000-0002-2343-2012 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cupin superfamily protein' 13323.285 1  ? ? ? ? 
2 non-polymer syn 'ZINC ION'                  65.409    3  ? ? ? ? 
3 non-polymer syn GLYCEROL                    92.094    1  ? ? ? ? 
4 non-polymer syn 'ACETIC ACID'               60.052    1  ? ? ? ? 
5 water       nat water                       18.015    44 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSRPADPEIVEGLPIPLAVAGHHQPAPFYLTADMFGGLPVQLAGGELSTLVGKPVAAPHTHPVDELYLLVSPNKGGARIE
VQLDGRRHELLSPAVMRIPAGSEHCFLTLEAEVGSYCFGILLGDRL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSRPADPEIVEGLPIPLAVAGHHQPAPFYLTADMFGGLPVQLAGGELSTLVGKPVAAPHTHPVDELYLLVSPNKGGARIE
VQLDGRRHELLSPAVMRIPAGSEHCFLTLEAEVGSYCFGILLGDRL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'    ZN  
3 GLYCEROL      GOL 
4 'ACETIC ACID' ACY 
5 water         HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ARG n 
1 4   PRO n 
1 5   ALA n 
1 6   ASP n 
1 7   PRO n 
1 8   GLU n 
1 9   ILE n 
1 10  VAL n 
1 11  GLU n 
1 12  GLY n 
1 13  LEU n 
1 14  PRO n 
1 15  ILE n 
1 16  PRO n 
1 17  LEU n 
1 18  ALA n 
1 19  VAL n 
1 20  ALA n 
1 21  GLY n 
1 22  HIS n 
1 23  HIS n 
1 24  GLN n 
1 25  PRO n 
1 26  ALA n 
1 27  PRO n 
1 28  PHE n 
1 29  TYR n 
1 30  LEU n 
1 31  THR n 
1 32  ALA n 
1 33  ASP n 
1 34  MET n 
1 35  PHE n 
1 36  GLY n 
1 37  GLY n 
1 38  LEU n 
1 39  PRO n 
1 40  VAL n 
1 41  GLN n 
1 42  LEU n 
1 43  ALA n 
1 44  GLY n 
1 45  GLY n 
1 46  GLU n 
1 47  LEU n 
1 48  SER n 
1 49  THR n 
1 50  LEU n 
1 51  VAL n 
1 52  GLY n 
1 53  LYS n 
1 54  PRO n 
1 55  VAL n 
1 56  ALA n 
1 57  ALA n 
1 58  PRO n 
1 59  HIS n 
1 60  THR n 
1 61  HIS n 
1 62  PRO n 
1 63  VAL n 
1 64  ASP n 
1 65  GLU n 
1 66  LEU n 
1 67  TYR n 
1 68  LEU n 
1 69  LEU n 
1 70  VAL n 
1 71  SER n 
1 72  PRO n 
1 73  ASN n 
1 74  LYS n 
1 75  GLY n 
1 76  GLY n 
1 77  ALA n 
1 78  ARG n 
1 79  ILE n 
1 80  GLU n 
1 81  VAL n 
1 82  GLN n 
1 83  LEU n 
1 84  ASP n 
1 85  GLY n 
1 86  ARG n 
1 87  ARG n 
1 88  HIS n 
1 89  GLU n 
1 90  LEU n 
1 91  LEU n 
1 92  SER n 
1 93  PRO n 
1 94  ALA n 
1 95  VAL n 
1 96  MET n 
1 97  ARG n 
1 98  ILE n 
1 99  PRO n 
1 100 ALA n 
1 101 GLY n 
1 102 SER n 
1 103 GLU n 
1 104 HIS n 
1 105 CYS n 
1 106 PHE n 
1 107 LEU n 
1 108 THR n 
1 109 LEU n 
1 110 GLU n 
1 111 ALA n 
1 112 GLU n 
1 113 VAL n 
1 114 GLY n 
1 115 SER n 
1 116 TYR n 
1 117 CYS n 
1 118 PHE n 
1 119 GLY n 
1 120 ILE n 
1 121 LEU n 
1 122 LEU n 
1 123 GLY n 
1 124 ASP n 
1 125 ARG n 
1 126 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   126 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 marH 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Streptomyces sp. B9173' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1462558 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACY non-polymer         . 'ACETIC ACID'   ?                               'C2 H4 O2'       60.052  
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ?                               'Zn 2'           65.409  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   4   ?   ?   ?   A . n 
A 1 2   SER 2   5   ?   ?   ?   A . n 
A 1 3   ARG 3   6   ?   ?   ?   A . n 
A 1 4   PRO 4   7   7   PRO PRO A . n 
A 1 5   ALA 5   8   8   ALA ALA A . n 
A 1 6   ASP 6   9   9   ASP ASP A . n 
A 1 7   PRO 7   10  10  PRO PRO A . n 
A 1 8   GLU 8   11  11  GLU GLU A . n 
A 1 9   ILE 9   12  12  ILE ILE A . n 
A 1 10  VAL 10  13  13  VAL VAL A . n 
A 1 11  GLU 11  14  14  GLU GLU A . n 
A 1 12  GLY 12  15  15  GLY GLY A . n 
A 1 13  LEU 13  16  16  LEU LEU A . n 
A 1 14  PRO 14  17  17  PRO PRO A . n 
A 1 15  ILE 15  18  18  ILE ILE A . n 
A 1 16  PRO 16  19  19  PRO PRO A . n 
A 1 17  LEU 17  20  20  LEU LEU A . n 
A 1 18  ALA 18  21  21  ALA ALA A . n 
A 1 19  VAL 19  22  22  VAL VAL A . n 
A 1 20  ALA 20  23  23  ALA ALA A . n 
A 1 21  GLY 21  24  24  GLY GLY A . n 
A 1 22  HIS 22  25  25  HIS HIS A . n 
A 1 23  HIS 23  26  26  HIS HIS A . n 
A 1 24  GLN 24  27  27  GLN GLN A . n 
A 1 25  PRO 25  28  28  PRO PRO A . n 
A 1 26  ALA 26  29  29  ALA ALA A . n 
A 1 27  PRO 27  30  30  PRO PRO A . n 
A 1 28  PHE 28  31  31  PHE PHE A . n 
A 1 29  TYR 29  32  32  TYR TYR A . n 
A 1 30  LEU 30  33  33  LEU LEU A . n 
A 1 31  THR 31  34  34  THR THR A . n 
A 1 32  ALA 32  35  35  ALA ALA A . n 
A 1 33  ASP 33  36  36  ASP ASP A . n 
A 1 34  MET 34  37  37  MET MET A . n 
A 1 35  PHE 35  38  38  PHE PHE A . n 
A 1 36  GLY 36  39  39  GLY GLY A . n 
A 1 37  GLY 37  40  40  GLY GLY A . n 
A 1 38  LEU 38  41  41  LEU LEU A . n 
A 1 39  PRO 39  42  42  PRO PRO A . n 
A 1 40  VAL 40  43  43  VAL VAL A . n 
A 1 41  GLN 41  44  44  GLN GLN A . n 
A 1 42  LEU 42  45  45  LEU LEU A . n 
A 1 43  ALA 43  46  46  ALA ALA A . n 
A 1 44  GLY 44  47  47  GLY GLY A . n 
A 1 45  GLY 45  48  48  GLY GLY A . n 
A 1 46  GLU 46  49  49  GLU GLU A . n 
A 1 47  LEU 47  50  50  LEU LEU A . n 
A 1 48  SER 48  51  51  SER SER A . n 
A 1 49  THR 49  52  52  THR THR A . n 
A 1 50  LEU 50  53  53  LEU LEU A . n 
A 1 51  VAL 51  54  54  VAL VAL A . n 
A 1 52  GLY 52  55  55  GLY GLY A . n 
A 1 53  LYS 53  56  56  LYS LYS A . n 
A 1 54  PRO 54  57  57  PRO PRO A . n 
A 1 55  VAL 55  58  58  VAL VAL A . n 
A 1 56  ALA 56  59  59  ALA ALA A . n 
A 1 57  ALA 57  60  60  ALA ALA A . n 
A 1 58  PRO 58  61  61  PRO PRO A . n 
A 1 59  HIS 59  62  62  HIS HIS A . n 
A 1 60  THR 60  63  63  THR THR A . n 
A 1 61  HIS 61  64  64  HIS HIS A . n 
A 1 62  PRO 62  65  65  PRO PRO A . n 
A 1 63  VAL 63  66  66  VAL VAL A . n 
A 1 64  ASP 64  67  67  ASP ASP A . n 
A 1 65  GLU 65  68  68  GLU GLU A . n 
A 1 66  LEU 66  69  69  LEU LEU A . n 
A 1 67  TYR 67  70  70  TYR TYR A . n 
A 1 68  LEU 68  71  71  LEU LEU A . n 
A 1 69  LEU 69  72  72  LEU LEU A . n 
A 1 70  VAL 70  73  73  VAL VAL A . n 
A 1 71  SER 71  74  74  SER SER A . n 
A 1 72  PRO 72  75  75  PRO PRO A . n 
A 1 73  ASN 73  76  76  ASN ASN A . n 
A 1 74  LYS 74  77  77  LYS LYS A . n 
A 1 75  GLY 75  78  78  GLY GLY A . n 
A 1 76  GLY 76  79  79  GLY GLY A . n 
A 1 77  ALA 77  80  80  ALA ALA A . n 
A 1 78  ARG 78  81  81  ARG ARG A . n 
A 1 79  ILE 79  82  82  ILE ILE A . n 
A 1 80  GLU 80  83  83  GLU GLU A . n 
A 1 81  VAL 81  84  84  VAL VAL A . n 
A 1 82  GLN 82  85  85  GLN GLN A . n 
A 1 83  LEU 83  86  86  LEU LEU A . n 
A 1 84  ASP 84  87  87  ASP ASP A . n 
A 1 85  GLY 85  88  88  GLY GLY A . n 
A 1 86  ARG 86  89  89  ARG ARG A . n 
A 1 87  ARG 87  90  90  ARG ARG A . n 
A 1 88  HIS 88  91  91  HIS HIS A . n 
A 1 89  GLU 89  92  92  GLU GLU A . n 
A 1 90  LEU 90  93  93  LEU LEU A . n 
A 1 91  LEU 91  94  94  LEU LEU A . n 
A 1 92  SER 92  95  95  SER SER A . n 
A 1 93  PRO 93  96  96  PRO PRO A . n 
A 1 94  ALA 94  97  97  ALA ALA A . n 
A 1 95  VAL 95  98  98  VAL VAL A . n 
A 1 96  MET 96  99  99  MET MET A . n 
A 1 97  ARG 97  100 100 ARG ARG A . n 
A 1 98  ILE 98  101 101 ILE ILE A . n 
A 1 99  PRO 99  102 102 PRO PRO A . n 
A 1 100 ALA 100 103 103 ALA ALA A . n 
A 1 101 GLY 101 104 104 GLY GLY A . n 
A 1 102 SER 102 105 105 SER SER A . n 
A 1 103 GLU 103 106 106 GLU GLU A . n 
A 1 104 HIS 104 107 107 HIS HIS A . n 
A 1 105 CYS 105 108 108 CYS CYS A . n 
A 1 106 PHE 106 109 109 PHE PHE A . n 
A 1 107 LEU 107 110 110 LEU LEU A . n 
A 1 108 THR 108 111 111 THR THR A . n 
A 1 109 LEU 109 112 112 LEU LEU A . n 
A 1 110 GLU 110 113 113 GLU GLU A . n 
A 1 111 ALA 111 114 114 ALA ALA A . n 
A 1 112 GLU 112 115 115 GLU GLU A . n 
A 1 113 VAL 113 116 116 VAL VAL A . n 
A 1 114 GLY 114 117 117 GLY GLY A . n 
A 1 115 SER 115 118 118 SER SER A . n 
A 1 116 TYR 116 119 119 TYR TYR A . n 
A 1 117 CYS 117 120 120 CYS CYS A . n 
A 1 118 PHE 118 121 121 PHE PHE A . n 
A 1 119 GLY 119 122 122 GLY GLY A . n 
A 1 120 ILE 120 123 123 ILE ILE A . n 
A 1 121 LEU 121 124 124 LEU LEU A . n 
A 1 122 LEU 122 125 125 LEU LEU A . n 
A 1 123 GLY 123 126 126 GLY GLY A . n 
A 1 124 ASP 124 127 127 ASP ASP A . n 
A 1 125 ARG 125 128 128 ARG ARG A . n 
A 1 126 LEU 126 129 129 LEU LEU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1  201 1  ZN  ZN  A . 
C 2 ZN  1  202 2  ZN  ZN  A . 
D 2 ZN  1  203 3  ZN  ZN  A . 
E 3 GOL 1  204 1  GOL GOL A . 
F 4 ACY 1  205 1  ACY ACY A . 
G 5 HOH 1  301 7  HOH HOH A . 
G 5 HOH 2  302 3  HOH HOH A . 
G 5 HOH 3  303 39 HOH HOH A . 
G 5 HOH 4  304 42 HOH HOH A . 
G 5 HOH 5  305 5  HOH HOH A . 
G 5 HOH 6  306 33 HOH HOH A . 
G 5 HOH 7  307 46 HOH HOH A . 
G 5 HOH 8  308 9  HOH HOH A . 
G 5 HOH 9  309 27 HOH HOH A . 
G 5 HOH 10 310 11 HOH HOH A . 
G 5 HOH 11 311 17 HOH HOH A . 
G 5 HOH 12 312 18 HOH HOH A . 
G 5 HOH 13 313 23 HOH HOH A . 
G 5 HOH 14 314 13 HOH HOH A . 
G 5 HOH 15 315 14 HOH HOH A . 
G 5 HOH 16 316 34 HOH HOH A . 
G 5 HOH 17 317 21 HOH HOH A . 
G 5 HOH 18 318 45 HOH HOH A . 
G 5 HOH 19 319 20 HOH HOH A . 
G 5 HOH 20 320 32 HOH HOH A . 
G 5 HOH 21 321 16 HOH HOH A . 
G 5 HOH 22 322 8  HOH HOH A . 
G 5 HOH 23 323 37 HOH HOH A . 
G 5 HOH 24 324 36 HOH HOH A . 
G 5 HOH 25 325 4  HOH HOH A . 
G 5 HOH 26 326 2  HOH HOH A . 
G 5 HOH 27 327 40 HOH HOH A . 
G 5 HOH 28 328 30 HOH HOH A . 
G 5 HOH 29 329 10 HOH HOH A . 
G 5 HOH 30 330 29 HOH HOH A . 
G 5 HOH 31 331 38 HOH HOH A . 
G 5 HOH 32 332 24 HOH HOH A . 
G 5 HOH 33 333 15 HOH HOH A . 
G 5 HOH 34 334 19 HOH HOH A . 
G 5 HOH 35 335 12 HOH HOH A . 
G 5 HOH 36 336 35 HOH HOH A . 
G 5 HOH 37 337 31 HOH HOH A . 
G 5 HOH 38 338 26 HOH HOH A . 
G 5 HOH 39 339 22 HOH HOH A . 
G 5 HOH 40 340 28 HOH HOH A . 
G 5 HOH 41 341 43 HOH HOH A . 
G 5 HOH 42 342 41 HOH HOH A . 
G 5 HOH 43 343 44 HOH HOH A . 
G 5 HOH 44 344 25 HOH HOH A . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0049 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .        5 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6J4C 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     43.538 
_cell.length_a_esd                 ? 
_cell.length_b                     43.538 
_cell.length_b_esd                 ? 
_cell.length_c                     97.974 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6J4C 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6J4C 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.01 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         38.87 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '10 mM ZnSO4, 100mM MES, pH 6.5, 24% PEG550' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-01-04 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97853 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NFPSS BEAMLINE BL18U' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97853 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL18U 
_diffrn_source.pdbx_synchrotron_site       NFPSS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6J4C 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.58 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       15498 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  18.6 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            48.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.58 
_reflns_shell.d_res_low                   1.61 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -0.0100 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][2]                            -0.0100 
_refine.aniso_B[2][3]                            -0.0000 
_refine.aniso_B[3][3]                            0.0200 
_refine.B_iso_max                                69.300 
_refine.B_iso_mean                               14.7280 
_refine.B_iso_min                                7.030 
_refine.correlation_coeff_Fo_to_Fc               0.9610 
_refine.correlation_coeff_Fo_to_Fc_free          0.9410 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6J4C 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.5800 
_refine.ls_d_res_low                             35.1900 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     14416 
_refine.ls_number_reflns_R_free                  759 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.8400 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1704 
_refine.ls_R_factor_R_free                       0.2086 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1686 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.0830 
_refine.pdbx_overall_ESU_R_Free                  0.0880 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             1.3480 
_refine.overall_SU_ML                            0.0490 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.5800 
_refine_hist.d_res_low                        35.1900 
_refine_hist.pdbx_number_atoms_ligand         13 
_refine_hist.number_atoms_solvent             44 
_refine_hist.number_atoms_total               974 
_refine_hist.pdbx_number_residues_total       123 
_refine_hist.pdbx_B_iso_mean_ligand           17.68 
_refine_hist.pdbx_B_iso_mean_solvent          19.65 
_refine_hist.pdbx_number_atoms_protein        917 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.023  0.019  950  ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  920  ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 2.277  2.009  1295 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 0.994  3.000  2126 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 6.276  5.000  122  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 37.457 23.611 36   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 12.696 15.000 139  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 12.018 15.000 5    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.148  0.200  147  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.015  0.021  1067 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  194  ? r_gen_planes_other     ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.5810 
_refine_ls_shell.d_res_low                        1.6220 
_refine_ls_shell.number_reflns_all                1094 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             57 
_refine_ls_shell.number_reflns_R_work             1037 
_refine_ls_shell.percent_reflns_obs               97.2400 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2260 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.1640 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6J4C 
_struct.title                        
'Crystal structure of MarH, an epimerase for biosynthesis of Maremycins in Streptomyces, under 10 mM ZnSO4' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6J4C 
_struct_keywords.text            'isomerase, epimerase, Maremycins, biosynthesis' 
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    X2D812_9ACTN 
_struct_ref.pdbx_db_accession          X2D812 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RPADPEIVEGLPIPLAVAGHHQPAPFYLTADMFGGLPVQLAGGELSTLVGKPVAAPHTHPVDELYLLVSPNKGGARIEVQ
LDGRRHELLSPAVMRIPAGSEHCFLTLEAEVGSYCFGILLGDRL
;
_struct_ref.pdbx_align_begin           6 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6J4C 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 126 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             X2D812 
_struct_ref_seq.db_align_beg                  6 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  129 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       6 
_struct_ref_seq.pdbx_auth_seq_align_end       129 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6J4C GLY A 1 ? UNP X2D812 ? ? 'expression tag' 4 1 
1 6J4C SER A 2 ? UNP X2D812 ? ? 'expression tag' 5 2 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3900  ? 
1 MORE         -174  ? 
1 'SSA (A^2)'  11010 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 5_555 x-y,-y,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 32.6580000000 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       AA1 
_struct_conf.beg_label_comp_id       ASP 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        33 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLY 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        37 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ASP 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         36 
_struct_conf.end_auth_comp_id        GLY 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         40 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A ASP 6   OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 9   A ZN 201 5_555 ? ? ? ? ? ? ? 2.193 ? ? 
metalc2 metalc ? ? A HIS 23  NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 26  A ZN 203 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
metalc3 metalc ? ? A ASP 33  OD2 ? ? ? 1_555 D ZN . ZN ? ? A ASP 36  A ZN 203 4_455 ? ? ? ? ? ? ? 1.991 ? ? 
metalc4 metalc ? ? A HIS 59  NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 62  A ZN 202 1_555 ? ? ? ? ? ? ? 2.627 ? ? 
metalc5 metalc ? ? A HIS 61  NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 64  A ZN 202 1_555 ? ? ? ? ? ? ? 2.070 ? ? 
metalc6 metalc ? ? A GLU 65  OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 68  A ZN 202 1_555 ? ? ? ? ? ? ? 2.352 ? ? 
metalc7 metalc ? ? A HIS 88  NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 91  A ZN 201 1_555 ? ? ? ? ? ? ? 2.071 ? ? 
metalc8 metalc ? ? A HIS 104 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 107 A ZN 202 1_555 ? ? ? ? ? ? ? 2.041 ? ? 
metalc9 metalc ? ? A GLU 110 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 113 A ZN 201 5_665 ? ? ? ? ? ? ? 2.056 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 6  ? A ASP 9  ? 1_555 ZN ? B ZN . ? A ZN 201 ? 5_555 NE2 ? A HIS 88  ? A HIS 91  ? 1_555 63.6  ? 
2  OD2 ? A ASP 6  ? A ASP 9  ? 1_555 ZN ? B ZN . ? A ZN 201 ? 5_555 OE1 ? A GLU 110 ? A GLU 113 ? 1_555 51.4  ? 
3  NE2 ? A HIS 88 ? A HIS 91 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 5_555 OE1 ? A GLU 110 ? A GLU 113 ? 1_555 27.8  ? 
4  NE2 ? A HIS 23 ? A HIS 26 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OD2 ? A ASP 33  ? A ASP 36  ? 1_555 68.1  ? 
5  NE2 ? A HIS 59 ? A HIS 62 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 61  ? A HIS 64  ? 1_555 93.6  ? 
6  NE2 ? A HIS 59 ? A HIS 62 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OE1 ? A GLU 65  ? A GLU 68  ? 1_555 172.9 ? 
7  NE2 ? A HIS 61 ? A HIS 64 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OE1 ? A GLU 65  ? A GLU 68  ? 1_555 79.4  ? 
8  NE2 ? A HIS 59 ? A HIS 62 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 104 ? A HIS 107 ? 1_555 97.7  ? 
9  NE2 ? A HIS 61 ? A HIS 64 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 104 ? A HIS 107 ? 1_555 104.9 ? 
10 OE1 ? A GLU 65 ? A GLU 68 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 104 ? A HIS 107 ? 1_555 84.7  ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 13 A . ? LEU 16 A PRO 14 A ? PRO 17 A 1 -9.50  
2 SER 92 A . ? SER 95 A PRO 93 A ? PRO 96 A 1 -10.54 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 15  ? LEU A 17  ? ILE A 18  LEU A 20  
AA1 2 ALA A 26  ? LEU A 30  ? ALA A 29  LEU A 33  
AA1 3 GLN A 41  ? GLU A 46  ? GLN A 44  GLU A 49  
AA1 4 TYR A 116 ? LEU A 121 ? TYR A 119 LEU A 124 
AA1 5 GLU A 65  ? VAL A 70  ? GLU A 68  VAL A 73  
AA1 6 ALA A 94  ? ILE A 98  ? ALA A 97  ILE A 101 
AA2 1 ARG A 86  ? LEU A 91  ? ARG A 89  LEU A 94  
AA2 2 ARG A 78  ? LEU A 83  ? ARG A 81  LEU A 86  
AA2 3 HIS A 104 ? GLU A 110 ? HIS A 107 GLU A 113 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 17  ? N LEU A 20  O ALA A 26  ? O ALA A 29  
AA1 2 3 N TYR A 29  ? N TYR A 32  O LEU A 42  ? O LEU A 45  
AA1 3 4 N ALA A 43  ? N ALA A 46  O GLY A 119 ? O GLY A 122 
AA1 4 5 O PHE A 118 ? O PHE A 121 N LEU A 68  ? N LEU A 71  
AA1 5 6 N LEU A 69  ? N LEU A 72  O ALA A 94  ? O ALA A 97  
AA2 1 2 O LEU A 90  ? O LEU A 93  N ILE A 79  ? N ILE A 82  
AA2 2 3 N GLU A 80  ? N GLU A 83  O LEU A 107 ? O LEU A 110 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  201 ? 5 'binding site for residue ZN A 201'  
AC2 Software A ZN  202 ? 4 'binding site for residue ZN A 202'  
AC3 Software A ZN  203 ? 4 'binding site for residue ZN A 203'  
AC4 Software A GOL 204 ? 7 'binding site for residue GOL A 204' 
AC5 Software A ACY 205 ? 7 'binding site for residue ACY A 205' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASP A 6   ? ASP A 9   . ? 5_555 ? 
2  AC1 5 HIS A 88  ? HIS A 91  . ? 1_555 ? 
3  AC1 5 GLU A 110 ? GLU A 113 . ? 5_565 ? 
4  AC1 5 HOH G .   ? HOH A 304 . ? 5_565 ? 
5  AC1 5 HOH G .   ? HOH A 309 . ? 5_565 ? 
6  AC2 4 HIS A 59  ? HIS A 62  . ? 1_555 ? 
7  AC2 4 HIS A 61  ? HIS A 64  . ? 1_555 ? 
8  AC2 4 GLU A 65  ? GLU A 68  . ? 1_555 ? 
9  AC2 4 HIS A 104 ? HIS A 107 . ? 1_555 ? 
10 AC3 4 HIS A 23  ? HIS A 26  . ? 1_555 ? 
11 AC3 4 ASP A 33  ? ASP A 36  . ? 4_565 ? 
12 AC3 4 HOH G .   ? HOH A 341 . ? 1_555 ? 
13 AC3 4 HOH G .   ? HOH A 343 . ? 1_555 ? 
14 AC4 7 ASP A 6   ? ASP A 9   . ? 4_565 ? 
15 AC4 7 ILE A 9   ? ILE A 12  . ? 4_565 ? 
16 AC4 7 ALA A 18  ? ALA A 21  . ? 1_555 ? 
17 AC4 7 VAL A 19  ? VAL A 22  . ? 1_555 ? 
18 AC4 7 HIS A 22  ? HIS A 25  . ? 1_555 ? 
19 AC4 7 GLN A 24  ? GLN A 27  . ? 1_555 ? 
20 AC4 7 PRO A 25  ? PRO A 28  . ? 1_555 ? 
21 AC5 7 TYR A 29  ? TYR A 32  . ? 5_555 ? 
22 AC5 7 VAL A 70  ? VAL A 73  . ? 1_555 ? 
23 AC5 7 SER A 71  ? SER A 74  . ? 1_555 ? 
24 AC5 7 PRO A 93  ? PRO A 96  . ? 1_555 ? 
25 AC5 7 TYR A 116 ? TYR A 119 . ? 5_555 ? 
26 AC5 7 HOH G .   ? HOH A 315 . ? 1_555 ? 
27 AC5 7 HOH G .   ? HOH A 335 . ? 1_555 ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 81 ? ? CZ A ARG 81 ? ? NH1 A ARG 81 ? ? 123.47 120.30 3.17  0.50 N 
2 1 CB A ASP 87 ? ? CG A ASP 87 ? ? OD2 A ASP 87 ? ? 112.89 118.30 -5.41 0.90 N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 4 ? A GLY 1 
2 1 Y 1 A SER 5 ? A SER 2 
3 1 Y 1 A ARG 6 ? A ARG 3 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ACY C    C  N N 1   
ACY O    O  N N 2   
ACY OXT  O  N N 3   
ACY CH3  C  N N 4   
ACY HXT  H  N N 5   
ACY H1   H  N N 6   
ACY H2   H  N N 7   
ACY H3   H  N N 8   
ALA N    N  N N 9   
ALA CA   C  N S 10  
ALA C    C  N N 11  
ALA O    O  N N 12  
ALA CB   C  N N 13  
ALA OXT  O  N N 14  
ALA H    H  N N 15  
ALA H2   H  N N 16  
ALA HA   H  N N 17  
ALA HB1  H  N N 18  
ALA HB2  H  N N 19  
ALA HB3  H  N N 20  
ALA HXT  H  N N 21  
ARG N    N  N N 22  
ARG CA   C  N S 23  
ARG C    C  N N 24  
ARG O    O  N N 25  
ARG CB   C  N N 26  
ARG CG   C  N N 27  
ARG CD   C  N N 28  
ARG NE   N  N N 29  
ARG CZ   C  N N 30  
ARG NH1  N  N N 31  
ARG NH2  N  N N 32  
ARG OXT  O  N N 33  
ARG H    H  N N 34  
ARG H2   H  N N 35  
ARG HA   H  N N 36  
ARG HB2  H  N N 37  
ARG HB3  H  N N 38  
ARG HG2  H  N N 39  
ARG HG3  H  N N 40  
ARG HD2  H  N N 41  
ARG HD3  H  N N 42  
ARG HE   H  N N 43  
ARG HH11 H  N N 44  
ARG HH12 H  N N 45  
ARG HH21 H  N N 46  
ARG HH22 H  N N 47  
ARG HXT  H  N N 48  
ASN N    N  N N 49  
ASN CA   C  N S 50  
ASN C    C  N N 51  
ASN O    O  N N 52  
ASN CB   C  N N 53  
ASN CG   C  N N 54  
ASN OD1  O  N N 55  
ASN ND2  N  N N 56  
ASN OXT  O  N N 57  
ASN H    H  N N 58  
ASN H2   H  N N 59  
ASN HA   H  N N 60  
ASN HB2  H  N N 61  
ASN HB3  H  N N 62  
ASN HD21 H  N N 63  
ASN HD22 H  N N 64  
ASN HXT  H  N N 65  
ASP N    N  N N 66  
ASP CA   C  N S 67  
ASP C    C  N N 68  
ASP O    O  N N 69  
ASP CB   C  N N 70  
ASP CG   C  N N 71  
ASP OD1  O  N N 72  
ASP OD2  O  N N 73  
ASP OXT  O  N N 74  
ASP H    H  N N 75  
ASP H2   H  N N 76  
ASP HA   H  N N 77  
ASP HB2  H  N N 78  
ASP HB3  H  N N 79  
ASP HD2  H  N N 80  
ASP HXT  H  N N 81  
CYS N    N  N N 82  
CYS CA   C  N R 83  
CYS C    C  N N 84  
CYS O    O  N N 85  
CYS CB   C  N N 86  
CYS SG   S  N N 87  
CYS OXT  O  N N 88  
CYS H    H  N N 89  
CYS H2   H  N N 90  
CYS HA   H  N N 91  
CYS HB2  H  N N 92  
CYS HB3  H  N N 93  
CYS HG   H  N N 94  
CYS HXT  H  N N 95  
GLN N    N  N N 96  
GLN CA   C  N S 97  
GLN C    C  N N 98  
GLN O    O  N N 99  
GLN CB   C  N N 100 
GLN CG   C  N N 101 
GLN CD   C  N N 102 
GLN OE1  O  N N 103 
GLN NE2  N  N N 104 
GLN OXT  O  N N 105 
GLN H    H  N N 106 
GLN H2   H  N N 107 
GLN HA   H  N N 108 
GLN HB2  H  N N 109 
GLN HB3  H  N N 110 
GLN HG2  H  N N 111 
GLN HG3  H  N N 112 
GLN HE21 H  N N 113 
GLN HE22 H  N N 114 
GLN HXT  H  N N 115 
GLU N    N  N N 116 
GLU CA   C  N S 117 
GLU C    C  N N 118 
GLU O    O  N N 119 
GLU CB   C  N N 120 
GLU CG   C  N N 121 
GLU CD   C  N N 122 
GLU OE1  O  N N 123 
GLU OE2  O  N N 124 
GLU OXT  O  N N 125 
GLU H    H  N N 126 
GLU H2   H  N N 127 
GLU HA   H  N N 128 
GLU HB2  H  N N 129 
GLU HB3  H  N N 130 
GLU HG2  H  N N 131 
GLU HG3  H  N N 132 
GLU HE2  H  N N 133 
GLU HXT  H  N N 134 
GLY N    N  N N 135 
GLY CA   C  N N 136 
GLY C    C  N N 137 
GLY O    O  N N 138 
GLY OXT  O  N N 139 
GLY H    H  N N 140 
GLY H2   H  N N 141 
GLY HA2  H  N N 142 
GLY HA3  H  N N 143 
GLY HXT  H  N N 144 
GOL C1   C  N N 145 
GOL O1   O  N N 146 
GOL C2   C  N N 147 
GOL O2   O  N N 148 
GOL C3   C  N N 149 
GOL O3   O  N N 150 
GOL H11  H  N N 151 
GOL H12  H  N N 152 
GOL HO1  H  N N 153 
GOL H2   H  N N 154 
GOL HO2  H  N N 155 
GOL H31  H  N N 156 
GOL H32  H  N N 157 
GOL HO3  H  N N 158 
HIS N    N  N N 159 
HIS CA   C  N S 160 
HIS C    C  N N 161 
HIS O    O  N N 162 
HIS CB   C  N N 163 
HIS CG   C  Y N 164 
HIS ND1  N  Y N 165 
HIS CD2  C  Y N 166 
HIS CE1  C  Y N 167 
HIS NE2  N  Y N 168 
HIS OXT  O  N N 169 
HIS H    H  N N 170 
HIS H2   H  N N 171 
HIS HA   H  N N 172 
HIS HB2  H  N N 173 
HIS HB3  H  N N 174 
HIS HD1  H  N N 175 
HIS HD2  H  N N 176 
HIS HE1  H  N N 177 
HIS HE2  H  N N 178 
HIS HXT  H  N N 179 
HOH O    O  N N 180 
HOH H1   H  N N 181 
HOH H2   H  N N 182 
ILE N    N  N N 183 
ILE CA   C  N S 184 
ILE C    C  N N 185 
ILE O    O  N N 186 
ILE CB   C  N S 187 
ILE CG1  C  N N 188 
ILE CG2  C  N N 189 
ILE CD1  C  N N 190 
ILE OXT  O  N N 191 
ILE H    H  N N 192 
ILE H2   H  N N 193 
ILE HA   H  N N 194 
ILE HB   H  N N 195 
ILE HG12 H  N N 196 
ILE HG13 H  N N 197 
ILE HG21 H  N N 198 
ILE HG22 H  N N 199 
ILE HG23 H  N N 200 
ILE HD11 H  N N 201 
ILE HD12 H  N N 202 
ILE HD13 H  N N 203 
ILE HXT  H  N N 204 
LEU N    N  N N 205 
LEU CA   C  N S 206 
LEU C    C  N N 207 
LEU O    O  N N 208 
LEU CB   C  N N 209 
LEU CG   C  N N 210 
LEU CD1  C  N N 211 
LEU CD2  C  N N 212 
LEU OXT  O  N N 213 
LEU H    H  N N 214 
LEU H2   H  N N 215 
LEU HA   H  N N 216 
LEU HB2  H  N N 217 
LEU HB3  H  N N 218 
LEU HG   H  N N 219 
LEU HD11 H  N N 220 
LEU HD12 H  N N 221 
LEU HD13 H  N N 222 
LEU HD21 H  N N 223 
LEU HD22 H  N N 224 
LEU HD23 H  N N 225 
LEU HXT  H  N N 226 
LYS N    N  N N 227 
LYS CA   C  N S 228 
LYS C    C  N N 229 
LYS O    O  N N 230 
LYS CB   C  N N 231 
LYS CG   C  N N 232 
LYS CD   C  N N 233 
LYS CE   C  N N 234 
LYS NZ   N  N N 235 
LYS OXT  O  N N 236 
LYS H    H  N N 237 
LYS H2   H  N N 238 
LYS HA   H  N N 239 
LYS HB2  H  N N 240 
LYS HB3  H  N N 241 
LYS HG2  H  N N 242 
LYS HG3  H  N N 243 
LYS HD2  H  N N 244 
LYS HD3  H  N N 245 
LYS HE2  H  N N 246 
LYS HE3  H  N N 247 
LYS HZ1  H  N N 248 
LYS HZ2  H  N N 249 
LYS HZ3  H  N N 250 
LYS HXT  H  N N 251 
MET N    N  N N 252 
MET CA   C  N S 253 
MET C    C  N N 254 
MET O    O  N N 255 
MET CB   C  N N 256 
MET CG   C  N N 257 
MET SD   S  N N 258 
MET CE   C  N N 259 
MET OXT  O  N N 260 
MET H    H  N N 261 
MET H2   H  N N 262 
MET HA   H  N N 263 
MET HB2  H  N N 264 
MET HB3  H  N N 265 
MET HG2  H  N N 266 
MET HG3  H  N N 267 
MET HE1  H  N N 268 
MET HE2  H  N N 269 
MET HE3  H  N N 270 
MET HXT  H  N N 271 
PHE N    N  N N 272 
PHE CA   C  N S 273 
PHE C    C  N N 274 
PHE O    O  N N 275 
PHE CB   C  N N 276 
PHE CG   C  Y N 277 
PHE CD1  C  Y N 278 
PHE CD2  C  Y N 279 
PHE CE1  C  Y N 280 
PHE CE2  C  Y N 281 
PHE CZ   C  Y N 282 
PHE OXT  O  N N 283 
PHE H    H  N N 284 
PHE H2   H  N N 285 
PHE HA   H  N N 286 
PHE HB2  H  N N 287 
PHE HB3  H  N N 288 
PHE HD1  H  N N 289 
PHE HD2  H  N N 290 
PHE HE1  H  N N 291 
PHE HE2  H  N N 292 
PHE HZ   H  N N 293 
PHE HXT  H  N N 294 
PRO N    N  N N 295 
PRO CA   C  N S 296 
PRO C    C  N N 297 
PRO O    O  N N 298 
PRO CB   C  N N 299 
PRO CG   C  N N 300 
PRO CD   C  N N 301 
PRO OXT  O  N N 302 
PRO H    H  N N 303 
PRO HA   H  N N 304 
PRO HB2  H  N N 305 
PRO HB3  H  N N 306 
PRO HG2  H  N N 307 
PRO HG3  H  N N 308 
PRO HD2  H  N N 309 
PRO HD3  H  N N 310 
PRO HXT  H  N N 311 
SER N    N  N N 312 
SER CA   C  N S 313 
SER C    C  N N 314 
SER O    O  N N 315 
SER CB   C  N N 316 
SER OG   O  N N 317 
SER OXT  O  N N 318 
SER H    H  N N 319 
SER H2   H  N N 320 
SER HA   H  N N 321 
SER HB2  H  N N 322 
SER HB3  H  N N 323 
SER HG   H  N N 324 
SER HXT  H  N N 325 
THR N    N  N N 326 
THR CA   C  N S 327 
THR C    C  N N 328 
THR O    O  N N 329 
THR CB   C  N R 330 
THR OG1  O  N N 331 
THR CG2  C  N N 332 
THR OXT  O  N N 333 
THR H    H  N N 334 
THR H2   H  N N 335 
THR HA   H  N N 336 
THR HB   H  N N 337 
THR HG1  H  N N 338 
THR HG21 H  N N 339 
THR HG22 H  N N 340 
THR HG23 H  N N 341 
THR HXT  H  N N 342 
TYR N    N  N N 343 
TYR CA   C  N S 344 
TYR C    C  N N 345 
TYR O    O  N N 346 
TYR CB   C  N N 347 
TYR CG   C  Y N 348 
TYR CD1  C  Y N 349 
TYR CD2  C  Y N 350 
TYR CE1  C  Y N 351 
TYR CE2  C  Y N 352 
TYR CZ   C  Y N 353 
TYR OH   O  N N 354 
TYR OXT  O  N N 355 
TYR H    H  N N 356 
TYR H2   H  N N 357 
TYR HA   H  N N 358 
TYR HB2  H  N N 359 
TYR HB3  H  N N 360 
TYR HD1  H  N N 361 
TYR HD2  H  N N 362 
TYR HE1  H  N N 363 
TYR HE2  H  N N 364 
TYR HH   H  N N 365 
TYR HXT  H  N N 366 
VAL N    N  N N 367 
VAL CA   C  N S 368 
VAL C    C  N N 369 
VAL O    O  N N 370 
VAL CB   C  N N 371 
VAL CG1  C  N N 372 
VAL CG2  C  N N 373 
VAL OXT  O  N N 374 
VAL H    H  N N 375 
VAL H2   H  N N 376 
VAL HA   H  N N 377 
VAL HB   H  N N 378 
VAL HG11 H  N N 379 
VAL HG12 H  N N 380 
VAL HG13 H  N N 381 
VAL HG21 H  N N 382 
VAL HG22 H  N N 383 
VAL HG23 H  N N 384 
VAL HXT  H  N N 385 
ZN  ZN   ZN N N 386 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ACY C   O    doub N N 1   
ACY C   OXT  sing N N 2   
ACY C   CH3  sing N N 3   
ACY OXT HXT  sing N N 4   
ACY CH3 H1   sing N N 5   
ACY CH3 H2   sing N N 6   
ACY CH3 H3   sing N N 7   
ALA N   CA   sing N N 8   
ALA N   H    sing N N 9   
ALA N   H2   sing N N 10  
ALA CA  C    sing N N 11  
ALA CA  CB   sing N N 12  
ALA CA  HA   sing N N 13  
ALA C   O    doub N N 14  
ALA C   OXT  sing N N 15  
ALA CB  HB1  sing N N 16  
ALA CB  HB2  sing N N 17  
ALA CB  HB3  sing N N 18  
ALA OXT HXT  sing N N 19  
ARG N   CA   sing N N 20  
ARG N   H    sing N N 21  
ARG N   H2   sing N N 22  
ARG CA  C    sing N N 23  
ARG CA  CB   sing N N 24  
ARG CA  HA   sing N N 25  
ARG C   O    doub N N 26  
ARG C   OXT  sing N N 27  
ARG CB  CG   sing N N 28  
ARG CB  HB2  sing N N 29  
ARG CB  HB3  sing N N 30  
ARG CG  CD   sing N N 31  
ARG CG  HG2  sing N N 32  
ARG CG  HG3  sing N N 33  
ARG CD  NE   sing N N 34  
ARG CD  HD2  sing N N 35  
ARG CD  HD3  sing N N 36  
ARG NE  CZ   sing N N 37  
ARG NE  HE   sing N N 38  
ARG CZ  NH1  sing N N 39  
ARG CZ  NH2  doub N N 40  
ARG NH1 HH11 sing N N 41  
ARG NH1 HH12 sing N N 42  
ARG NH2 HH21 sing N N 43  
ARG NH2 HH22 sing N N 44  
ARG OXT HXT  sing N N 45  
ASN N   CA   sing N N 46  
ASN N   H    sing N N 47  
ASN N   H2   sing N N 48  
ASN CA  C    sing N N 49  
ASN CA  CB   sing N N 50  
ASN CA  HA   sing N N 51  
ASN C   O    doub N N 52  
ASN C   OXT  sing N N 53  
ASN CB  CG   sing N N 54  
ASN CB  HB2  sing N N 55  
ASN CB  HB3  sing N N 56  
ASN CG  OD1  doub N N 57  
ASN CG  ND2  sing N N 58  
ASN ND2 HD21 sing N N 59  
ASN ND2 HD22 sing N N 60  
ASN OXT HXT  sing N N 61  
ASP N   CA   sing N N 62  
ASP N   H    sing N N 63  
ASP N   H2   sing N N 64  
ASP CA  C    sing N N 65  
ASP CA  CB   sing N N 66  
ASP CA  HA   sing N N 67  
ASP C   O    doub N N 68  
ASP C   OXT  sing N N 69  
ASP CB  CG   sing N N 70  
ASP CB  HB2  sing N N 71  
ASP CB  HB3  sing N N 72  
ASP CG  OD1  doub N N 73  
ASP CG  OD2  sing N N 74  
ASP OD2 HD2  sing N N 75  
ASP OXT HXT  sing N N 76  
CYS N   CA   sing N N 77  
CYS N   H    sing N N 78  
CYS N   H2   sing N N 79  
CYS CA  C    sing N N 80  
CYS CA  CB   sing N N 81  
CYS CA  HA   sing N N 82  
CYS C   O    doub N N 83  
CYS C   OXT  sing N N 84  
CYS CB  SG   sing N N 85  
CYS CB  HB2  sing N N 86  
CYS CB  HB3  sing N N 87  
CYS SG  HG   sing N N 88  
CYS OXT HXT  sing N N 89  
GLN N   CA   sing N N 90  
GLN N   H    sing N N 91  
GLN N   H2   sing N N 92  
GLN CA  C    sing N N 93  
GLN CA  CB   sing N N 94  
GLN CA  HA   sing N N 95  
GLN C   O    doub N N 96  
GLN C   OXT  sing N N 97  
GLN CB  CG   sing N N 98  
GLN CB  HB2  sing N N 99  
GLN CB  HB3  sing N N 100 
GLN CG  CD   sing N N 101 
GLN CG  HG2  sing N N 102 
GLN CG  HG3  sing N N 103 
GLN CD  OE1  doub N N 104 
GLN CD  NE2  sing N N 105 
GLN NE2 HE21 sing N N 106 
GLN NE2 HE22 sing N N 107 
GLN OXT HXT  sing N N 108 
GLU N   CA   sing N N 109 
GLU N   H    sing N N 110 
GLU N   H2   sing N N 111 
GLU CA  C    sing N N 112 
GLU CA  CB   sing N N 113 
GLU CA  HA   sing N N 114 
GLU C   O    doub N N 115 
GLU C   OXT  sing N N 116 
GLU CB  CG   sing N N 117 
GLU CB  HB2  sing N N 118 
GLU CB  HB3  sing N N 119 
GLU CG  CD   sing N N 120 
GLU CG  HG2  sing N N 121 
GLU CG  HG3  sing N N 122 
GLU CD  OE1  doub N N 123 
GLU CD  OE2  sing N N 124 
GLU OE2 HE2  sing N N 125 
GLU OXT HXT  sing N N 126 
GLY N   CA   sing N N 127 
GLY N   H    sing N N 128 
GLY N   H2   sing N N 129 
GLY CA  C    sing N N 130 
GLY CA  HA2  sing N N 131 
GLY CA  HA3  sing N N 132 
GLY C   O    doub N N 133 
GLY C   OXT  sing N N 134 
GLY OXT HXT  sing N N 135 
GOL C1  O1   sing N N 136 
GOL C1  C2   sing N N 137 
GOL C1  H11  sing N N 138 
GOL C1  H12  sing N N 139 
GOL O1  HO1  sing N N 140 
GOL C2  O2   sing N N 141 
GOL C2  C3   sing N N 142 
GOL C2  H2   sing N N 143 
GOL O2  HO2  sing N N 144 
GOL C3  O3   sing N N 145 
GOL C3  H31  sing N N 146 
GOL C3  H32  sing N N 147 
GOL O3  HO3  sing N N 148 
HIS N   CA   sing N N 149 
HIS N   H    sing N N 150 
HIS N   H2   sing N N 151 
HIS CA  C    sing N N 152 
HIS CA  CB   sing N N 153 
HIS CA  HA   sing N N 154 
HIS C   O    doub N N 155 
HIS C   OXT  sing N N 156 
HIS CB  CG   sing N N 157 
HIS CB  HB2  sing N N 158 
HIS CB  HB3  sing N N 159 
HIS CG  ND1  sing Y N 160 
HIS CG  CD2  doub Y N 161 
HIS ND1 CE1  doub Y N 162 
HIS ND1 HD1  sing N N 163 
HIS CD2 NE2  sing Y N 164 
HIS CD2 HD2  sing N N 165 
HIS CE1 NE2  sing Y N 166 
HIS CE1 HE1  sing N N 167 
HIS NE2 HE2  sing N N 168 
HIS OXT HXT  sing N N 169 
HOH O   H1   sing N N 170 
HOH O   H2   sing N N 171 
ILE N   CA   sing N N 172 
ILE N   H    sing N N 173 
ILE N   H2   sing N N 174 
ILE CA  C    sing N N 175 
ILE CA  CB   sing N N 176 
ILE CA  HA   sing N N 177 
ILE C   O    doub N N 178 
ILE C   OXT  sing N N 179 
ILE CB  CG1  sing N N 180 
ILE CB  CG2  sing N N 181 
ILE CB  HB   sing N N 182 
ILE CG1 CD1  sing N N 183 
ILE CG1 HG12 sing N N 184 
ILE CG1 HG13 sing N N 185 
ILE CG2 HG21 sing N N 186 
ILE CG2 HG22 sing N N 187 
ILE CG2 HG23 sing N N 188 
ILE CD1 HD11 sing N N 189 
ILE CD1 HD12 sing N N 190 
ILE CD1 HD13 sing N N 191 
ILE OXT HXT  sing N N 192 
LEU N   CA   sing N N 193 
LEU N   H    sing N N 194 
LEU N   H2   sing N N 195 
LEU CA  C    sing N N 196 
LEU CA  CB   sing N N 197 
LEU CA  HA   sing N N 198 
LEU C   O    doub N N 199 
LEU C   OXT  sing N N 200 
LEU CB  CG   sing N N 201 
LEU CB  HB2  sing N N 202 
LEU CB  HB3  sing N N 203 
LEU CG  CD1  sing N N 204 
LEU CG  CD2  sing N N 205 
LEU CG  HG   sing N N 206 
LEU CD1 HD11 sing N N 207 
LEU CD1 HD12 sing N N 208 
LEU CD1 HD13 sing N N 209 
LEU CD2 HD21 sing N N 210 
LEU CD2 HD22 sing N N 211 
LEU CD2 HD23 sing N N 212 
LEU OXT HXT  sing N N 213 
LYS N   CA   sing N N 214 
LYS N   H    sing N N 215 
LYS N   H2   sing N N 216 
LYS CA  C    sing N N 217 
LYS CA  CB   sing N N 218 
LYS CA  HA   sing N N 219 
LYS C   O    doub N N 220 
LYS C   OXT  sing N N 221 
LYS CB  CG   sing N N 222 
LYS CB  HB2  sing N N 223 
LYS CB  HB3  sing N N 224 
LYS CG  CD   sing N N 225 
LYS CG  HG2  sing N N 226 
LYS CG  HG3  sing N N 227 
LYS CD  CE   sing N N 228 
LYS CD  HD2  sing N N 229 
LYS CD  HD3  sing N N 230 
LYS CE  NZ   sing N N 231 
LYS CE  HE2  sing N N 232 
LYS CE  HE3  sing N N 233 
LYS NZ  HZ1  sing N N 234 
LYS NZ  HZ2  sing N N 235 
LYS NZ  HZ3  sing N N 236 
LYS OXT HXT  sing N N 237 
MET N   CA   sing N N 238 
MET N   H    sing N N 239 
MET N   H2   sing N N 240 
MET CA  C    sing N N 241 
MET CA  CB   sing N N 242 
MET CA  HA   sing N N 243 
MET C   O    doub N N 244 
MET C   OXT  sing N N 245 
MET CB  CG   sing N N 246 
MET CB  HB2  sing N N 247 
MET CB  HB3  sing N N 248 
MET CG  SD   sing N N 249 
MET CG  HG2  sing N N 250 
MET CG  HG3  sing N N 251 
MET SD  CE   sing N N 252 
MET CE  HE1  sing N N 253 
MET CE  HE2  sing N N 254 
MET CE  HE3  sing N N 255 
MET OXT HXT  sing N N 256 
PHE N   CA   sing N N 257 
PHE N   H    sing N N 258 
PHE N   H2   sing N N 259 
PHE CA  C    sing N N 260 
PHE CA  CB   sing N N 261 
PHE CA  HA   sing N N 262 
PHE C   O    doub N N 263 
PHE C   OXT  sing N N 264 
PHE CB  CG   sing N N 265 
PHE CB  HB2  sing N N 266 
PHE CB  HB3  sing N N 267 
PHE CG  CD1  doub Y N 268 
PHE CG  CD2  sing Y N 269 
PHE CD1 CE1  sing Y N 270 
PHE CD1 HD1  sing N N 271 
PHE CD2 CE2  doub Y N 272 
PHE CD2 HD2  sing N N 273 
PHE CE1 CZ   doub Y N 274 
PHE CE1 HE1  sing N N 275 
PHE CE2 CZ   sing Y N 276 
PHE CE2 HE2  sing N N 277 
PHE CZ  HZ   sing N N 278 
PHE OXT HXT  sing N N 279 
PRO N   CA   sing N N 280 
PRO N   CD   sing N N 281 
PRO N   H    sing N N 282 
PRO CA  C    sing N N 283 
PRO CA  CB   sing N N 284 
PRO CA  HA   sing N N 285 
PRO C   O    doub N N 286 
PRO C   OXT  sing N N 287 
PRO CB  CG   sing N N 288 
PRO CB  HB2  sing N N 289 
PRO CB  HB3  sing N N 290 
PRO CG  CD   sing N N 291 
PRO CG  HG2  sing N N 292 
PRO CG  HG3  sing N N 293 
PRO CD  HD2  sing N N 294 
PRO CD  HD3  sing N N 295 
PRO OXT HXT  sing N N 296 
SER N   CA   sing N N 297 
SER N   H    sing N N 298 
SER N   H2   sing N N 299 
SER CA  C    sing N N 300 
SER CA  CB   sing N N 301 
SER CA  HA   sing N N 302 
SER C   O    doub N N 303 
SER C   OXT  sing N N 304 
SER CB  OG   sing N N 305 
SER CB  HB2  sing N N 306 
SER CB  HB3  sing N N 307 
SER OG  HG   sing N N 308 
SER OXT HXT  sing N N 309 
THR N   CA   sing N N 310 
THR N   H    sing N N 311 
THR N   H2   sing N N 312 
THR CA  C    sing N N 313 
THR CA  CB   sing N N 314 
THR CA  HA   sing N N 315 
THR C   O    doub N N 316 
THR C   OXT  sing N N 317 
THR CB  OG1  sing N N 318 
THR CB  CG2  sing N N 319 
THR CB  HB   sing N N 320 
THR OG1 HG1  sing N N 321 
THR CG2 HG21 sing N N 322 
THR CG2 HG22 sing N N 323 
THR CG2 HG23 sing N N 324 
THR OXT HXT  sing N N 325 
TYR N   CA   sing N N 326 
TYR N   H    sing N N 327 
TYR N   H2   sing N N 328 
TYR CA  C    sing N N 329 
TYR CA  CB   sing N N 330 
TYR CA  HA   sing N N 331 
TYR C   O    doub N N 332 
TYR C   OXT  sing N N 333 
TYR CB  CG   sing N N 334 
TYR CB  HB2  sing N N 335 
TYR CB  HB3  sing N N 336 
TYR CG  CD1  doub Y N 337 
TYR CG  CD2  sing Y N 338 
TYR CD1 CE1  sing Y N 339 
TYR CD1 HD1  sing N N 340 
TYR CD2 CE2  doub Y N 341 
TYR CD2 HD2  sing N N 342 
TYR CE1 CZ   doub Y N 343 
TYR CE1 HE1  sing N N 344 
TYR CE2 CZ   sing Y N 345 
TYR CE2 HE2  sing N N 346 
TYR CZ  OH   sing N N 347 
TYR OH  HH   sing N N 348 
TYR OXT HXT  sing N N 349 
VAL N   CA   sing N N 350 
VAL N   H    sing N N 351 
VAL N   H2   sing N N 352 
VAL CA  C    sing N N 353 
VAL CA  CB   sing N N 354 
VAL CA  HA   sing N N 355 
VAL C   O    doub N N 356 
VAL C   OXT  sing N N 357 
VAL CB  CG1  sing N N 358 
VAL CB  CG2  sing N N 359 
VAL CB  HB   sing N N 360 
VAL CG1 HG11 sing N N 361 
VAL CG1 HG12 sing N N 362 
VAL CG1 HG13 sing N N 363 
VAL CG2 HG21 sing N N 364 
VAL CG2 HG22 sing N N 365 
VAL CG2 HG23 sing N N 366 
VAL OXT HXT  sing N N 367 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Basic Research Program of China (973 Program)' China 2017YFA0505800 1 
'National Basic Research Program of China (973 Program)' China 2017YFA0504300 2 
'National Natural Science Foundation of China'           China 31570720       3 
# 
_atom_sites.entry_id                    6J4C 
_atom_sites.fract_transf_matrix[1][1]   0.022968 
_atom_sites.fract_transf_matrix[1][2]   0.013261 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.026522 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010207 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_