data_6J98 # _entry.id 6J98 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6J98 pdb_00006j98 10.2210/pdb6j98/pdb WWPDB D_1300010691 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-03-04 2 'Structure model' 1 1 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_entry_details 5 2 'Structure model' pdbx_modification_feature 6 2 'Structure model' pdbx_struct_conn_angle 7 2 'Structure model' struct_conn 8 2 'Structure model' struct_conn_type # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.value' 16 2 'Structure model' '_struct_conn.conn_type_id' 17 2 'Structure model' '_struct_conn.id' 18 2 'Structure model' '_struct_conn.pdbx_dist_value' 19 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 20 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 21 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 22 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 23 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 24 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 25 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 26 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 27 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 28 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 29 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 30 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 31 2 'Structure model' '_struct_conn.ptnr2_label_seq_id' 32 2 'Structure model' '_struct_conn.ptnr2_symmetry' 33 2 'Structure model' '_struct_conn_type.id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6J98 _pdbx_database_status.recvd_initial_deposition_date 2019-01-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cha, Y.J.' 1 0000-0001-9005-1140 'Cho, H.S.' 2 0000-0003-4067-4715 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? ? ? ? primary 'To Be Published' ? 0353 ? ? ? ? ? ? ? 'Crystal structure of P8 from Lactobacillus rhamnosus' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 'Toxicol Res' ? ? 1976-8257 ? ? 30 ? 27 32 ;A Probiotic Preparation Duolac-Gold Ameliorates Dextran Sulphate Sodium-induced Mouse Colitis by Downregulating the Expression of IL-6. ; 2014 ? 10.5487/TR.2014.30.1.027 24795796 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cha, Y.J.' 1 ? primary 'Cho, H.S.' 2 ? 1 'Yoon, H.' 3 ? 1 'Yoon, Y.S.' 4 ? 1 'Kim, M.S.' 5 ? 1 'Chung, M.J.' 6 ? 1 'Yum, D.Y.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man P8 9188.576 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 5 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 77 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GS(MSE)ATVDPEKTLFLDEP(MSE)NKVFDWSNSEAPVRDALWDYY(MSE)EKNSRDTIKTEEE(MSE)KPVLD(MSE) SDDEVKALAEKVLKKLE ; _entity_poly.pdbx_seq_one_letter_code_can GSMATVDPEKTLFLDEPMNKVFDWSNSEAPVRDALWDYYMEKNSRDTIKTEEEMKPVLDMSDDEVKALAEKVLKKLE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 1,2-ETHANEDIOL EDO 4 GLYCEROL GOL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MSE n 1 4 ALA n 1 5 THR n 1 6 VAL n 1 7 ASP n 1 8 PRO n 1 9 GLU n 1 10 LYS n 1 11 THR n 1 12 LEU n 1 13 PHE n 1 14 LEU n 1 15 ASP n 1 16 GLU n 1 17 PRO n 1 18 MSE n 1 19 ASN n 1 20 LYS n 1 21 VAL n 1 22 PHE n 1 23 ASP n 1 24 TRP n 1 25 SER n 1 26 ASN n 1 27 SER n 1 28 GLU n 1 29 ALA n 1 30 PRO n 1 31 VAL n 1 32 ARG n 1 33 ASP n 1 34 ALA n 1 35 LEU n 1 36 TRP n 1 37 ASP n 1 38 TYR n 1 39 TYR n 1 40 MSE n 1 41 GLU n 1 42 LYS n 1 43 ASN n 1 44 SER n 1 45 ARG n 1 46 ASP n 1 47 THR n 1 48 ILE n 1 49 LYS n 1 50 THR n 1 51 GLU n 1 52 GLU n 1 53 GLU n 1 54 MSE n 1 55 LYS n 1 56 PRO n 1 57 VAL n 1 58 LEU n 1 59 ASP n 1 60 MSE n 1 61 SER n 1 62 ASP n 1 63 ASP n 1 64 GLU n 1 65 VAL n 1 66 LYS n 1 67 ALA n 1 68 LEU n 1 69 ALA n 1 70 GLU n 1 71 LYS n 1 72 VAL n 1 73 LEU n 1 74 LYS n 1 75 LYS n 1 76 LEU n 1 77 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 77 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'B4Q13_10920, BGK71_11245, CCE29_09795, DBP98_10520, PY66_06245, PY91_09235' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactobacillus rhamnosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 47715 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 -1 GLY GLY A . n A 1 2 SER 2 0 0 SER SER A . n A 1 3 MSE 3 1 1 MSE MSE A . n A 1 4 ALA 4 2 2 ALA ALA A . n A 1 5 THR 5 3 3 THR THR A . n A 1 6 VAL 6 4 4 VAL VAL A . n A 1 7 ASP 7 5 5 ASP ASP A . n A 1 8 PRO 8 6 6 PRO PRO A . n A 1 9 GLU 9 7 7 GLU GLU A . n A 1 10 LYS 10 8 8 LYS LYS A . n A 1 11 THR 11 9 9 THR THR A . n A 1 12 LEU 12 10 10 LEU LEU A . n A 1 13 PHE 13 11 11 PHE PHE A . n A 1 14 LEU 14 12 12 LEU LEU A . n A 1 15 ASP 15 13 13 ASP ASP A . n A 1 16 GLU 16 14 14 GLU GLU A . n A 1 17 PRO 17 15 15 PRO PRO A . n A 1 18 MSE 18 16 16 MSE MSE A . n A 1 19 ASN 19 17 17 ASN ASN A . n A 1 20 LYS 20 18 18 LYS LYS A . n A 1 21 VAL 21 19 19 VAL VAL A . n A 1 22 PHE 22 20 20 PHE PHE A . n A 1 23 ASP 23 21 21 ASP ASP A . n A 1 24 TRP 24 22 22 TRP TRP A . n A 1 25 SER 25 23 23 SER SER A . n A 1 26 ASN 26 24 24 ASN ASN A . n A 1 27 SER 27 25 25 SER SER A . n A 1 28 GLU 28 26 26 GLU GLU A . n A 1 29 ALA 29 27 27 ALA ALA A . n A 1 30 PRO 30 28 28 PRO PRO A . n A 1 31 VAL 31 29 29 VAL VAL A . n A 1 32 ARG 32 30 30 ARG ARG A . n A 1 33 ASP 33 31 31 ASP ASP A . n A 1 34 ALA 34 32 32 ALA ALA A . n A 1 35 LEU 35 33 33 LEU LEU A . n A 1 36 TRP 36 34 34 TRP TRP A . n A 1 37 ASP 37 35 35 ASP ASP A . n A 1 38 TYR 38 36 36 TYR TYR A . n A 1 39 TYR 39 37 37 TYR TYR A . n A 1 40 MSE 40 38 38 MSE MSE A . n A 1 41 GLU 41 39 39 GLU GLU A . n A 1 42 LYS 42 40 40 LYS LYS A . n A 1 43 ASN 43 41 41 ASN ASN A . n A 1 44 SER 44 42 42 SER SER A . n A 1 45 ARG 45 43 43 ARG ARG A . n A 1 46 ASP 46 44 44 ASP ASP A . n A 1 47 THR 47 45 45 THR THR A . n A 1 48 ILE 48 46 46 ILE ILE A . n A 1 49 LYS 49 47 47 LYS LYS A . n A 1 50 THR 50 48 48 THR THR A . n A 1 51 GLU 51 49 49 GLU GLU A . n A 1 52 GLU 52 50 50 GLU GLU A . n A 1 53 GLU 53 51 51 GLU GLU A . n A 1 54 MSE 54 52 52 MSE MSE A . n A 1 55 LYS 55 53 53 LYS LYS A . n A 1 56 PRO 56 54 54 PRO PRO A . n A 1 57 VAL 57 55 55 VAL VAL A . n A 1 58 LEU 58 56 56 LEU LEU A . n A 1 59 ASP 59 57 57 ASP ASP A . n A 1 60 MSE 60 58 58 MSE MSE A . n A 1 61 SER 61 59 59 SER SER A . n A 1 62 ASP 62 60 60 ASP ASP A . n A 1 63 ASP 63 61 61 ASP ASP A . n A 1 64 GLU 64 62 62 GLU GLU A . n A 1 65 VAL 65 63 63 VAL VAL A . n A 1 66 LYS 66 64 64 LYS LYS A . n A 1 67 ALA 67 65 65 ALA ALA A . n A 1 68 LEU 68 66 66 LEU LEU A . n A 1 69 ALA 69 67 67 ALA ALA A . n A 1 70 GLU 70 68 68 GLU GLU A . n A 1 71 LYS 71 69 69 LYS LYS A . n A 1 72 VAL 72 70 70 VAL VAL A . n A 1 73 LEU 73 71 71 LEU LEU A . n A 1 74 LYS 74 72 72 LYS LYS A . n A 1 75 LYS 75 73 73 LYS LYS A . n A 1 76 LEU 76 74 ? ? ? A . n A 1 77 GLU 77 75 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 101 1 ZN ZN A . C 2 ZN 1 102 2 ZN ZN A . D 2 ZN 1 103 3 ZN ZN A . E 2 ZN 1 104 4 ZN ZN A . F 2 ZN 1 105 5 ZN ZN A . G 3 EDO 1 106 6 EDO EDO A . H 4 GOL 1 107 7 GOL GOL A . I 5 HOH 1 201 70 HOH HOH A . I 5 HOH 2 202 54 HOH HOH A . I 5 HOH 3 203 48 HOH HOH A . I 5 HOH 4 204 27 HOH HOH A . I 5 HOH 5 205 49 HOH HOH A . I 5 HOH 6 206 59 HOH HOH A . I 5 HOH 7 207 39 HOH HOH A . I 5 HOH 8 208 40 HOH HOH A . I 5 HOH 9 209 46 HOH HOH A . I 5 HOH 10 210 36 HOH HOH A . I 5 HOH 11 211 52 HOH HOH A . I 5 HOH 12 212 26 HOH HOH A . I 5 HOH 13 213 63 HOH HOH A . I 5 HOH 14 214 25 HOH HOH A . I 5 HOH 15 215 61 HOH HOH A . I 5 HOH 16 216 34 HOH HOH A . I 5 HOH 17 217 35 HOH HOH A . I 5 HOH 18 218 33 HOH HOH A . I 5 HOH 19 219 45 HOH HOH A . I 5 HOH 20 220 42 HOH HOH A . I 5 HOH 21 221 47 HOH HOH A . I 5 HOH 22 222 16 HOH HOH A . I 5 HOH 23 223 68 HOH HOH A . I 5 HOH 24 224 10 HOH HOH A . I 5 HOH 25 225 20 HOH HOH A . I 5 HOH 26 226 15 HOH HOH A . I 5 HOH 27 227 8 HOH HOH A . I 5 HOH 28 228 24 HOH HOH A . I 5 HOH 29 229 41 HOH HOH A . I 5 HOH 30 230 18 HOH HOH A . I 5 HOH 31 231 12 HOH HOH A . I 5 HOH 32 232 37 HOH HOH A . I 5 HOH 33 233 14 HOH HOH A . I 5 HOH 34 234 22 HOH HOH A . I 5 HOH 35 235 55 HOH HOH A . I 5 HOH 36 236 11 HOH HOH A . I 5 HOH 37 237 31 HOH HOH A . I 5 HOH 38 238 29 HOH HOH A . I 5 HOH 39 239 30 HOH HOH A . I 5 HOH 40 240 43 HOH HOH A . I 5 HOH 41 241 79 HOH HOH A . I 5 HOH 42 242 57 HOH HOH A . I 5 HOH 43 243 23 HOH HOH A . I 5 HOH 44 244 73 HOH HOH A . I 5 HOH 45 245 32 HOH HOH A . I 5 HOH 46 246 19 HOH HOH A . I 5 HOH 47 247 69 HOH HOH A . I 5 HOH 48 248 76 HOH HOH A . I 5 HOH 49 249 9 HOH HOH A . I 5 HOH 50 250 71 HOH HOH A . I 5 HOH 51 251 78 HOH HOH A . I 5 HOH 52 252 13 HOH HOH A . I 5 HOH 53 253 56 HOH HOH A . I 5 HOH 54 254 44 HOH HOH A . I 5 HOH 55 255 50 HOH HOH A . I 5 HOH 56 256 53 HOH HOH A . I 5 HOH 57 257 21 HOH HOH A . I 5 HOH 58 258 80 HOH HOH A . I 5 HOH 59 259 64 HOH HOH A . I 5 HOH 60 260 28 HOH HOH A . I 5 HOH 61 261 17 HOH HOH A . I 5 HOH 62 262 51 HOH HOH A . I 5 HOH 63 263 66 HOH HOH A . I 5 HOH 64 264 60 HOH HOH A . I 5 HOH 65 265 84 HOH HOH A . I 5 HOH 66 266 58 HOH HOH A . I 5 HOH 67 267 62 HOH HOH A . I 5 HOH 68 268 74 HOH HOH A . I 5 HOH 69 269 83 HOH HOH A . I 5 HOH 70 270 81 HOH HOH A . I 5 HOH 71 271 72 HOH HOH A . I 5 HOH 72 272 65 HOH HOH A . I 5 HOH 73 273 75 HOH HOH A . I 5 HOH 74 274 77 HOH HOH A . I 5 HOH 75 275 38 HOH HOH A . I 5 HOH 76 276 82 HOH HOH A . I 5 HOH 77 277 67 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6J98 _cell.details ? _cell.formula_units_Z ? _cell.length_a 40.860 _cell.length_a_esd ? _cell.length_b 40.860 _cell.length_b_esd ? _cell.length_c 107.010 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6J98 _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6J98 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.39 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method MICROBATCH _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.05M Zinc Acetate dihydrate, 20% PEG3350, 5% n-dodecyl-N, N-dimethylamine-N-oxide' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9738 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-1A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9738 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-1A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6J98 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.56 _reflns.d_resolution_low 38.17 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12894 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20 _reflns.pdbx_Rmerge_I_obs 0.111 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.95 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.56 _reflns_shell.d_res_low 1.601 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 925 _reflns_shell.percent_possible_all 98.98 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.6 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.18 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.63 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -0.63 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 1.27 _refine.B_iso_max ? _refine.B_iso_mean 16.651 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.954 _refine.correlation_coeff_Fo_to_Fc_free 0.948 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6J98 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.56 _refine.ls_d_res_low 38.17 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12894 _refine.ls_number_reflns_R_free 697 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.71 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.17862 _refine.ls_R_factor_R_free 0.19622 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.17762 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.074 _refine.pdbx_overall_ESU_R_Free 0.073 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.264 _refine.overall_SU_ML 0.047 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 607 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 77 _refine_hist.number_atoms_total 699 _refine_hist.d_res_high 1.56 _refine_hist.d_res_low 38.17 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.013 626 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.017 588 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.781 1.672 840 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.586 1.599 1379 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.709 5.000 74 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 26.153 25.484 31 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 10.293 15.000 107 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 24.230 15.000 2 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.084 0.200 79 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 668 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 110 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.648 1.507 299 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.600 1.499 298 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.388 2.252 372 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.392 2.259 373 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.628 1.771 327 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.624 1.774 328 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.718 2.541 469 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 4.600 19.057 724 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 4.536 18.723 714 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.560 _refine_ls_shell.d_res_low 1.601 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 49 _refine_ls_shell.number_reflns_R_work 925 _refine_ls_shell.percent_reflns_obs 98.98 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.261 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.210 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6J98 _struct.title 'Crystal structure of P8 from Lactobacillus rhamnosus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6J98 _struct_keywords.text 'Lactobacillus Rhamnosus, P8, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 3 ? H N N 4 ? I N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0E3CPJ0_LACRH _struct_ref.pdbx_db_accession A0A0E3CPJ0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MATVDPEKTLFLDEPMNKVFDWSNSEAPVRDALWDYYMEKNSRDTIKTEEEMKPVLDMSDDEVKALAEKVLKK _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6J98 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0E3CPJ0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 73 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6J98 GLY A 1 ? UNP A0A0E3CPJ0 ? ? 'expression tag' -1 1 1 6J98 SER A 2 ? UNP A0A0E3CPJ0 ? ? 'expression tag' 0 2 1 6J98 LEU A 76 ? UNP A0A0E3CPJ0 ? ? 'expression tag' 74 3 1 6J98 GLU A 77 ? UNP A0A0E3CPJ0 ? ? 'expression tag' 75 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 760 ? 1 MORE -109 ? 1 'SSA (A^2)' 5680 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 12 ? GLU A 16 ? LEU A 10 GLU A 14 5 ? 5 HELX_P HELX_P2 AA2 PRO A 17 ? PHE A 22 ? PRO A 15 PHE A 20 1 ? 6 HELX_P HELX_P3 AA3 PRO A 30 ? ASN A 43 ? PRO A 28 ASN A 41 1 ? 14 HELX_P HELX_P4 AA4 ASP A 46 ? LYS A 55 ? ASP A 44 LYS A 53 1 ? 10 HELX_P HELX_P5 AA5 PRO A 56 ? MSE A 60 ? PRO A 54 MSE A 58 5 ? 5 HELX_P HELX_P6 AA6 SER A 61 ? LEU A 73 ? SER A 59 LEU A 71 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A SER 2 C ? ? ? 1_555 A MSE 3 N ? ? A SER 0 A MSE 1 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale2 covale both ? A MSE 3 C ? ? ? 1_555 A ALA 4 N ? ? A MSE 1 A ALA 2 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale3 covale both ? A PRO 17 C ? ? ? 1_555 A MSE 18 N ? ? A PRO 15 A MSE 16 1_555 ? ? ? ? ? ? ? 1.310 ? ? covale4 covale both ? A MSE 18 C ? ? ? 1_555 A ASN 19 N ? ? A MSE 16 A ASN 17 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale5 covale both ? A TYR 39 C ? ? ? 1_555 A MSE 40 N ? ? A TYR 37 A MSE 38 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale6 covale both ? A MSE 40 C ? ? ? 1_555 A GLU 41 N ? ? A MSE 38 A GLU 39 1_555 ? ? ? ? ? ? ? 1.315 ? ? covale7 covale both ? A GLU 53 C ? ? ? 1_555 A MSE 54 N ? ? A GLU 51 A MSE 52 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale8 covale both ? A MSE 54 C ? ? ? 1_555 A LYS 55 N ? ? A MSE 52 A LYS 53 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale9 covale both ? A ASP 59 C ? ? ? 1_555 A MSE 60 N ? ? A ASP 57 A MSE 58 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale10 covale both ? A MSE 60 C ? ? ? 1_555 A SER 61 N ? ? A MSE 58 A SER 59 1_555 ? ? ? ? ? ? ? 1.328 ? ? metalc1 metalc ? ? A GLY 1 N ? ? ? 1_555 B ZN . ZN ? ? A GLY -1 A ZN 101 1_555 ? ? ? ? ? ? ? 2.102 ? ? metalc2 metalc ? ? A GLY 1 O ? ? ? 1_555 B ZN . ZN ? ? A GLY -1 A ZN 101 1_555 ? ? ? ? ? ? ? 2.110 ? ? metalc3 metalc ? ? A ASP 7 OD2 ? ? ? 1_555 D ZN . ZN ? ? A ASP 5 A ZN 103 1_555 ? ? ? ? ? ? ? 1.893 ? ? metalc4 metalc ? ? A ASP 7 OD2 ? ? ? 1_555 D ZN . ZN ? ? A ASP 5 A ZN 103 7_645 ? ? ? ? ? ? ? 1.893 ? ? metalc5 metalc ? ? A GLU 9 OE2 ? ? ? 1_555 C ZN . ZN ? ? A GLU 7 A ZN 102 1_555 ? ? ? ? ? ? ? 1.971 ? ? metalc6 metalc ? ? A GLU 16 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 14 A ZN 102 1_555 ? ? ? ? ? ? ? 2.018 ? ? metalc7 metalc ? ? A LYS 20 NZ ? ? ? 1_555 C ZN . ZN ? ? A LYS 18 A ZN 102 1_555 ? ? ? ? ? ? ? 2.206 ? ? metalc8 metalc ? ? A ASP 33 OD2 ? ? ? 1_555 F ZN . ZN ? ? A ASP 31 A ZN 105 1_555 ? ? ? ? ? ? ? 2.200 ? ? metalc9 metalc ? ? A ASP 37 OD1 ? ? ? 1_555 E ZN . ZN ? ? A ASP 35 A ZN 104 1_555 ? ? ? ? ? ? ? 2.454 ? ? metalc10 metalc ? ? A ASP 37 OD2 ? ? ? 1_555 E ZN . ZN ? ? A ASP 35 A ZN 104 1_555 ? ? ? ? ? ? ? 2.137 ? ? metalc11 metalc ? ? A GLU 41 OE2 ? ? ? 1_555 E ZN . ZN ? ? A GLU 39 A ZN 104 1_555 ? ? ? ? ? ? ? 1.937 ? ? metalc12 metalc ? ? A GLU 52 OE2 ? ? ? 1_555 D ZN . ZN ? ? A GLU 50 A ZN 103 1_455 ? ? ? ? ? ? ? 2.019 ? ? metalc13 metalc ? ? A ASP 62 OD2 ? ? ? 1_555 E ZN . ZN ? ? A ASP 60 A ZN 104 5_544 ? ? ? ? ? ? ? 1.913 ? ? metalc14 metalc ? ? A GLU 64 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 62 A ZN 101 1_455 ? ? ? ? ? ? ? 2.252 ? ? metalc15 metalc ? ? A GLU 64 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 62 A ZN 101 1_455 ? ? ? ? ? ? ? 2.152 ? ? metalc16 metalc ? ? B ZN . ZN ? ? ? 1_555 I HOH . O ? ? A ZN 101 A HOH 212 5_644 ? ? ? ? ? ? ? 2.113 ? ? metalc17 metalc ? ? B ZN . ZN ? ? ? 1_555 I HOH . O ? ? A ZN 101 A HOH 219 1_655 ? ? ? ? ? ? ? 2.162 ? ? metalc18 metalc ? ? C ZN . ZN ? ? ? 1_555 I HOH . O ? ? A ZN 102 A HOH 262 1_555 ? ? ? ? ? ? ? 1.983 ? ? metalc19 metalc ? ? E ZN . ZN ? ? ? 1_555 I HOH . O ? ? A ZN 104 A HOH 249 1_555 ? ? ? ? ? ? ? 2.161 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 N ? A GLY 1 ? A GLY -1 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 O ? A GLY 1 ? A GLY -1 ? 1_555 81.4 ? 2 N ? A GLY 1 ? A GLY -1 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE1 ? A GLU 64 ? A GLU 62 ? 1_555 100.3 ? 3 O ? A GLY 1 ? A GLY -1 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE1 ? A GLU 64 ? A GLU 62 ? 1_555 26.7 ? 4 N ? A GLY 1 ? A GLY -1 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE2 ? A GLU 64 ? A GLU 62 ? 1_555 102.1 ? 5 O ? A GLY 1 ? A GLY -1 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE2 ? A GLU 64 ? A GLU 62 ? 1_555 29.4 ? 6 OE1 ? A GLU 64 ? A GLU 62 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE2 ? A GLU 64 ? A GLU 62 ? 1_555 2.7 ? 7 N ? A GLY 1 ? A GLY -1 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 O ? I HOH . ? A HOH 212 ? 5_644 95.5 ? 8 O ? A GLY 1 ? A GLY -1 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 O ? I HOH . ? A HOH 212 ? 5_644 89.7 ? 9 OE1 ? A GLU 64 ? A GLU 62 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 O ? I HOH . ? A HOH 212 ? 5_644 69.4 ? 10 OE2 ? A GLU 64 ? A GLU 62 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 O ? I HOH . ? A HOH 212 ? 5_644 67.3 ? 11 N ? A GLY 1 ? A GLY -1 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 O ? I HOH . ? A HOH 219 ? 1_655 94.6 ? 12 O ? A GLY 1 ? A GLY -1 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 O ? I HOH . ? A HOH 219 ? 1_655 175.5 ? 13 OE1 ? A GLU 64 ? A GLU 62 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 O ? I HOH . ? A HOH 219 ? 1_655 157.6 ? 14 OE2 ? A GLU 64 ? A GLU 62 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 O ? I HOH . ? A HOH 219 ? 1_655 154.9 ? 15 O ? I HOH . ? A HOH 212 ? 5_644 ZN ? B ZN . ? A ZN 101 ? 1_555 O ? I HOH . ? A HOH 219 ? 1_655 92.8 ? 16 OD2 ? A ASP 7 ? A ASP 5 ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 OD2 ? A ASP 7 ? A ASP 5 ? 1_555 0.0 ? 17 OD2 ? A ASP 7 ? A ASP 5 ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 OE2 ? A GLU 52 ? A GLU 50 ? 1_555 63.9 ? 18 OD2 ? A ASP 7 ? A ASP 5 ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 OE2 ? A GLU 52 ? A GLU 50 ? 1_555 63.9 ? 19 OE2 ? A GLU 9 ? A GLU 7 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 OE1 ? A GLU 16 ? A GLU 14 ? 1_555 119.4 ? 20 OE2 ? A GLU 9 ? A GLU 7 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NZ ? A LYS 20 ? A LYS 18 ? 1_555 114.1 ? 21 OE1 ? A GLU 16 ? A GLU 14 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NZ ? A LYS 20 ? A LYS 18 ? 1_555 107.9 ? 22 OE2 ? A GLU 9 ? A GLU 7 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 O ? I HOH . ? A HOH 262 ? 1_555 105.2 ? 23 OE1 ? A GLU 16 ? A GLU 14 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 O ? I HOH . ? A HOH 262 ? 1_555 98.9 ? 24 NZ ? A LYS 20 ? A LYS 18 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 O ? I HOH . ? A HOH 262 ? 1_555 110.0 ? 25 OD1 ? A ASP 37 ? A ASP 35 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 OD2 ? A ASP 37 ? A ASP 35 ? 1_555 54.5 ? 26 OD1 ? A ASP 37 ? A ASP 35 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 OE2 ? A GLU 41 ? A GLU 39 ? 1_555 104.3 ? 27 OD2 ? A ASP 37 ? A ASP 35 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 OE2 ? A GLU 41 ? A GLU 39 ? 1_555 136.8 ? 28 OD1 ? A ASP 37 ? A ASP 35 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 OD2 ? A ASP 62 ? A ASP 60 ? 1_555 46.2 ? 29 OD2 ? A ASP 37 ? A ASP 35 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 OD2 ? A ASP 62 ? A ASP 60 ? 1_555 8.3 ? 30 OE2 ? A GLU 41 ? A GLU 39 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 OD2 ? A ASP 62 ? A ASP 60 ? 1_555 133.7 ? 31 OD1 ? A ASP 37 ? A ASP 35 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 O ? I HOH . ? A HOH 249 ? 1_555 141.3 ? 32 OD2 ? A ASP 37 ? A ASP 35 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 O ? I HOH . ? A HOH 249 ? 1_555 89.3 ? 33 OE2 ? A GLU 41 ? A GLU 39 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 O ? I HOH . ? A HOH 249 ? 1_555 92.9 ? 34 OD2 ? A ASP 62 ? A ASP 60 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 O ? I HOH . ? A HOH 249 ? 1_555 97.4 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 3 ? . . . . MSE A 1 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 18 ? . . . . MSE A 16 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 40 ? . . . . MSE A 38 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 54 ? . . . . MSE A 52 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 60 ? . . . . MSE A 58 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 101 ? 4 'binding site for residue ZN A 101' AC2 Software A ZN 102 ? 4 'binding site for residue ZN A 102' AC3 Software A ZN 103 ? 4 'binding site for residue ZN A 103' AC4 Software A ZN 104 ? 4 'binding site for residue ZN A 104' AC5 Software A ZN 105 ? 2 'binding site for residue ZN A 105' AC6 Software A EDO 106 ? 7 'binding site for residue EDO A 106' AC7 Software A GOL 107 ? 9 'binding site for residue GOL A 107' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLY A 1 ? GLY A -1 . ? 1_555 ? 2 AC1 4 GLU A 64 ? GLU A 62 . ? 1_655 ? 3 AC1 4 HOH I . ? HOH A 212 . ? 5_644 ? 4 AC1 4 HOH I . ? HOH A 219 . ? 1_655 ? 5 AC2 4 GLU A 9 ? GLU A 7 . ? 1_555 ? 6 AC2 4 GLU A 16 ? GLU A 14 . ? 1_555 ? 7 AC2 4 LYS A 20 ? LYS A 18 . ? 1_555 ? 8 AC2 4 HOH I . ? HOH A 262 . ? 1_555 ? 9 AC3 4 ASP A 7 ? ASP A 5 . ? 1_555 ? 10 AC3 4 ASP A 7 ? ASP A 5 . ? 7_645 ? 11 AC3 4 GLU A 52 ? GLU A 50 . ? 7_655 ? 12 AC3 4 GLU A 52 ? GLU A 50 . ? 1_655 ? 13 AC4 4 ASP A 37 ? ASP A 35 . ? 1_555 ? 14 AC4 4 GLU A 41 ? GLU A 39 . ? 1_555 ? 15 AC4 4 ASP A 62 ? ASP A 60 . ? 5_554 ? 16 AC4 4 HOH I . ? HOH A 249 . ? 1_555 ? 17 AC5 2 ASP A 33 ? ASP A 31 . ? 1_555 ? 18 AC5 2 GLU A 70 ? GLU A 68 . ? 5_554 ? 19 AC6 7 ALA A 4 ? ALA A 2 . ? 1_455 ? 20 AC6 7 TYR A 39 ? TYR A 37 . ? 1_555 ? 21 AC6 7 GLU A 53 ? GLU A 51 . ? 1_555 ? 22 AC6 7 MSE A 60 ? MSE A 58 . ? 1_555 ? 23 AC6 7 LEU A 68 ? LEU A 66 . ? 1_555 ? 24 AC6 7 HOH I . ? HOH A 217 . ? 1_455 ? 25 AC6 7 HOH I . ? HOH A 232 . ? 1_555 ? 26 AC7 9 ASN A 19 ? ASN A 17 . ? 1_555 ? 27 AC7 9 PHE A 22 ? PHE A 20 . ? 1_555 ? 28 AC7 9 ASP A 23 ? ASP A 21 . ? 8_554 ? 29 AC7 9 ASP A 23 ? ASP A 21 . ? 1_555 ? 30 AC7 9 SER A 25 ? SER A 23 . ? 1_555 ? 31 AC7 9 ASN A 26 ? ASN A 24 . ? 1_555 ? 32 AC7 9 LYS A 74 ? LYS A 72 . ? 8_554 ? 33 AC7 9 HOH I . ? HOH A 201 . ? 8_554 ? 34 AC7 9 HOH I . ? HOH A 213 . ? 8_554 ? # _pdbx_entry_details.entry_id 6J98 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 3 A MSE 1 ? MET 'modified residue' 2 A MSE 18 A MSE 16 ? MET 'modified residue' 3 A MSE 40 A MSE 38 ? MET 'modified residue' 4 A MSE 54 A MSE 52 ? MET 'modified residue' 5 A MSE 60 A MSE 58 ? MET 'modified residue' # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A ZN 103 ? D ZN . 2 1 A HOH 234 ? I HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 74 ? A LEU 76 2 1 Y 1 A GLU 75 ? A GLU 77 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 EDO C1 C N N 74 EDO O1 O N N 75 EDO C2 C N N 76 EDO O2 O N N 77 EDO H11 H N N 78 EDO H12 H N N 79 EDO HO1 H N N 80 EDO H21 H N N 81 EDO H22 H N N 82 EDO HO2 H N N 83 GLU N N N N 84 GLU CA C N S 85 GLU C C N N 86 GLU O O N N 87 GLU CB C N N 88 GLU CG C N N 89 GLU CD C N N 90 GLU OE1 O N N 91 GLU OE2 O N N 92 GLU OXT O N N 93 GLU H H N N 94 GLU H2 H N N 95 GLU HA H N N 96 GLU HB2 H N N 97 GLU HB3 H N N 98 GLU HG2 H N N 99 GLU HG3 H N N 100 GLU HE2 H N N 101 GLU HXT H N N 102 GLY N N N N 103 GLY CA C N N 104 GLY C C N N 105 GLY O O N N 106 GLY OXT O N N 107 GLY H H N N 108 GLY H2 H N N 109 GLY HA2 H N N 110 GLY HA3 H N N 111 GLY HXT H N N 112 GOL C1 C N N 113 GOL O1 O N N 114 GOL C2 C N N 115 GOL O2 O N N 116 GOL C3 C N N 117 GOL O3 O N N 118 GOL H11 H N N 119 GOL H12 H N N 120 GOL HO1 H N N 121 GOL H2 H N N 122 GOL HO2 H N N 123 GOL H31 H N N 124 GOL H32 H N N 125 GOL HO3 H N N 126 HOH O O N N 127 HOH H1 H N N 128 HOH H2 H N N 129 ILE N N N N 130 ILE CA C N S 131 ILE C C N N 132 ILE O O N N 133 ILE CB C N S 134 ILE CG1 C N N 135 ILE CG2 C N N 136 ILE CD1 C N N 137 ILE OXT O N N 138 ILE H H N N 139 ILE H2 H N N 140 ILE HA H N N 141 ILE HB H N N 142 ILE HG12 H N N 143 ILE HG13 H N N 144 ILE HG21 H N N 145 ILE HG22 H N N 146 ILE HG23 H N N 147 ILE HD11 H N N 148 ILE HD12 H N N 149 ILE HD13 H N N 150 ILE HXT H N N 151 LEU N N N N 152 LEU CA C N S 153 LEU C C N N 154 LEU O O N N 155 LEU CB C N N 156 LEU CG C N N 157 LEU CD1 C N N 158 LEU CD2 C N N 159 LEU OXT O N N 160 LEU H H N N 161 LEU H2 H N N 162 LEU HA H N N 163 LEU HB2 H N N 164 LEU HB3 H N N 165 LEU HG H N N 166 LEU HD11 H N N 167 LEU HD12 H N N 168 LEU HD13 H N N 169 LEU HD21 H N N 170 LEU HD22 H N N 171 LEU HD23 H N N 172 LEU HXT H N N 173 LYS N N N N 174 LYS CA C N S 175 LYS C C N N 176 LYS O O N N 177 LYS CB C N N 178 LYS CG C N N 179 LYS CD C N N 180 LYS CE C N N 181 LYS NZ N N N 182 LYS OXT O N N 183 LYS H H N N 184 LYS H2 H N N 185 LYS HA H N N 186 LYS HB2 H N N 187 LYS HB3 H N N 188 LYS HG2 H N N 189 LYS HG3 H N N 190 LYS HD2 H N N 191 LYS HD3 H N N 192 LYS HE2 H N N 193 LYS HE3 H N N 194 LYS HZ1 H N N 195 LYS HZ2 H N N 196 LYS HZ3 H N N 197 LYS HXT H N N 198 MSE N N N N 199 MSE CA C N S 200 MSE C C N N 201 MSE O O N N 202 MSE OXT O N N 203 MSE CB C N N 204 MSE CG C N N 205 MSE SE SE N N 206 MSE CE C N N 207 MSE H H N N 208 MSE H2 H N N 209 MSE HA H N N 210 MSE HXT H N N 211 MSE HB2 H N N 212 MSE HB3 H N N 213 MSE HG2 H N N 214 MSE HG3 H N N 215 MSE HE1 H N N 216 MSE HE2 H N N 217 MSE HE3 H N N 218 PHE N N N N 219 PHE CA C N S 220 PHE C C N N 221 PHE O O N N 222 PHE CB C N N 223 PHE CG C Y N 224 PHE CD1 C Y N 225 PHE CD2 C Y N 226 PHE CE1 C Y N 227 PHE CE2 C Y N 228 PHE CZ C Y N 229 PHE OXT O N N 230 PHE H H N N 231 PHE H2 H N N 232 PHE HA H N N 233 PHE HB2 H N N 234 PHE HB3 H N N 235 PHE HD1 H N N 236 PHE HD2 H N N 237 PHE HE1 H N N 238 PHE HE2 H N N 239 PHE HZ H N N 240 PHE HXT H N N 241 PRO N N N N 242 PRO CA C N S 243 PRO C C N N 244 PRO O O N N 245 PRO CB C N N 246 PRO CG C N N 247 PRO CD C N N 248 PRO OXT O N N 249 PRO H H N N 250 PRO HA H N N 251 PRO HB2 H N N 252 PRO HB3 H N N 253 PRO HG2 H N N 254 PRO HG3 H N N 255 PRO HD2 H N N 256 PRO HD3 H N N 257 PRO HXT H N N 258 SER N N N N 259 SER CA C N S 260 SER C C N N 261 SER O O N N 262 SER CB C N N 263 SER OG O N N 264 SER OXT O N N 265 SER H H N N 266 SER H2 H N N 267 SER HA H N N 268 SER HB2 H N N 269 SER HB3 H N N 270 SER HG H N N 271 SER HXT H N N 272 THR N N N N 273 THR CA C N S 274 THR C C N N 275 THR O O N N 276 THR CB C N R 277 THR OG1 O N N 278 THR CG2 C N N 279 THR OXT O N N 280 THR H H N N 281 THR H2 H N N 282 THR HA H N N 283 THR HB H N N 284 THR HG1 H N N 285 THR HG21 H N N 286 THR HG22 H N N 287 THR HG23 H N N 288 THR HXT H N N 289 TRP N N N N 290 TRP CA C N S 291 TRP C C N N 292 TRP O O N N 293 TRP CB C N N 294 TRP CG C Y N 295 TRP CD1 C Y N 296 TRP CD2 C Y N 297 TRP NE1 N Y N 298 TRP CE2 C Y N 299 TRP CE3 C Y N 300 TRP CZ2 C Y N 301 TRP CZ3 C Y N 302 TRP CH2 C Y N 303 TRP OXT O N N 304 TRP H H N N 305 TRP H2 H N N 306 TRP HA H N N 307 TRP HB2 H N N 308 TRP HB3 H N N 309 TRP HD1 H N N 310 TRP HE1 H N N 311 TRP HE3 H N N 312 TRP HZ2 H N N 313 TRP HZ3 H N N 314 TRP HH2 H N N 315 TRP HXT H N N 316 TYR N N N N 317 TYR CA C N S 318 TYR C C N N 319 TYR O O N N 320 TYR CB C N N 321 TYR CG C Y N 322 TYR CD1 C Y N 323 TYR CD2 C Y N 324 TYR CE1 C Y N 325 TYR CE2 C Y N 326 TYR CZ C Y N 327 TYR OH O N N 328 TYR OXT O N N 329 TYR H H N N 330 TYR H2 H N N 331 TYR HA H N N 332 TYR HB2 H N N 333 TYR HB3 H N N 334 TYR HD1 H N N 335 TYR HD2 H N N 336 TYR HE1 H N N 337 TYR HE2 H N N 338 TYR HH H N N 339 TYR HXT H N N 340 VAL N N N N 341 VAL CA C N S 342 VAL C C N N 343 VAL O O N N 344 VAL CB C N N 345 VAL CG1 C N N 346 VAL CG2 C N N 347 VAL OXT O N N 348 VAL H H N N 349 VAL H2 H N N 350 VAL HA H N N 351 VAL HB H N N 352 VAL HG11 H N N 353 VAL HG12 H N N 354 VAL HG13 H N N 355 VAL HG21 H N N 356 VAL HG22 H N N 357 VAL HG23 H N N 358 VAL HXT H N N 359 ZN ZN ZN N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 EDO C1 O1 sing N N 70 EDO C1 C2 sing N N 71 EDO C1 H11 sing N N 72 EDO C1 H12 sing N N 73 EDO O1 HO1 sing N N 74 EDO C2 O2 sing N N 75 EDO C2 H21 sing N N 76 EDO C2 H22 sing N N 77 EDO O2 HO2 sing N N 78 GLU N CA sing N N 79 GLU N H sing N N 80 GLU N H2 sing N N 81 GLU CA C sing N N 82 GLU CA CB sing N N 83 GLU CA HA sing N N 84 GLU C O doub N N 85 GLU C OXT sing N N 86 GLU CB CG sing N N 87 GLU CB HB2 sing N N 88 GLU CB HB3 sing N N 89 GLU CG CD sing N N 90 GLU CG HG2 sing N N 91 GLU CG HG3 sing N N 92 GLU CD OE1 doub N N 93 GLU CD OE2 sing N N 94 GLU OE2 HE2 sing N N 95 GLU OXT HXT sing N N 96 GLY N CA sing N N 97 GLY N H sing N N 98 GLY N H2 sing N N 99 GLY CA C sing N N 100 GLY CA HA2 sing N N 101 GLY CA HA3 sing N N 102 GLY C O doub N N 103 GLY C OXT sing N N 104 GLY OXT HXT sing N N 105 GOL C1 O1 sing N N 106 GOL C1 C2 sing N N 107 GOL C1 H11 sing N N 108 GOL C1 H12 sing N N 109 GOL O1 HO1 sing N N 110 GOL C2 O2 sing N N 111 GOL C2 C3 sing N N 112 GOL C2 H2 sing N N 113 GOL O2 HO2 sing N N 114 GOL C3 O3 sing N N 115 GOL C3 H31 sing N N 116 GOL C3 H32 sing N N 117 GOL O3 HO3 sing N N 118 HOH O H1 sing N N 119 HOH O H2 sing N N 120 ILE N CA sing N N 121 ILE N H sing N N 122 ILE N H2 sing N N 123 ILE CA C sing N N 124 ILE CA CB sing N N 125 ILE CA HA sing N N 126 ILE C O doub N N 127 ILE C OXT sing N N 128 ILE CB CG1 sing N N 129 ILE CB CG2 sing N N 130 ILE CB HB sing N N 131 ILE CG1 CD1 sing N N 132 ILE CG1 HG12 sing N N 133 ILE CG1 HG13 sing N N 134 ILE CG2 HG21 sing N N 135 ILE CG2 HG22 sing N N 136 ILE CG2 HG23 sing N N 137 ILE CD1 HD11 sing N N 138 ILE CD1 HD12 sing N N 139 ILE CD1 HD13 sing N N 140 ILE OXT HXT sing N N 141 LEU N CA sing N N 142 LEU N H sing N N 143 LEU N H2 sing N N 144 LEU CA C sing N N 145 LEU CA CB sing N N 146 LEU CA HA sing N N 147 LEU C O doub N N 148 LEU C OXT sing N N 149 LEU CB CG sing N N 150 LEU CB HB2 sing N N 151 LEU CB HB3 sing N N 152 LEU CG CD1 sing N N 153 LEU CG CD2 sing N N 154 LEU CG HG sing N N 155 LEU CD1 HD11 sing N N 156 LEU CD1 HD12 sing N N 157 LEU CD1 HD13 sing N N 158 LEU CD2 HD21 sing N N 159 LEU CD2 HD22 sing N N 160 LEU CD2 HD23 sing N N 161 LEU OXT HXT sing N N 162 LYS N CA sing N N 163 LYS N H sing N N 164 LYS N H2 sing N N 165 LYS CA C sing N N 166 LYS CA CB sing N N 167 LYS CA HA sing N N 168 LYS C O doub N N 169 LYS C OXT sing N N 170 LYS CB CG sing N N 171 LYS CB HB2 sing N N 172 LYS CB HB3 sing N N 173 LYS CG CD sing N N 174 LYS CG HG2 sing N N 175 LYS CG HG3 sing N N 176 LYS CD CE sing N N 177 LYS CD HD2 sing N N 178 LYS CD HD3 sing N N 179 LYS CE NZ sing N N 180 LYS CE HE2 sing N N 181 LYS CE HE3 sing N N 182 LYS NZ HZ1 sing N N 183 LYS NZ HZ2 sing N N 184 LYS NZ HZ3 sing N N 185 LYS OXT HXT sing N N 186 MSE N CA sing N N 187 MSE N H sing N N 188 MSE N H2 sing N N 189 MSE CA C sing N N 190 MSE CA CB sing N N 191 MSE CA HA sing N N 192 MSE C O doub N N 193 MSE C OXT sing N N 194 MSE OXT HXT sing N N 195 MSE CB CG sing N N 196 MSE CB HB2 sing N N 197 MSE CB HB3 sing N N 198 MSE CG SE sing N N 199 MSE CG HG2 sing N N 200 MSE CG HG3 sing N N 201 MSE SE CE sing N N 202 MSE CE HE1 sing N N 203 MSE CE HE2 sing N N 204 MSE CE HE3 sing N N 205 PHE N CA sing N N 206 PHE N H sing N N 207 PHE N H2 sing N N 208 PHE CA C sing N N 209 PHE CA CB sing N N 210 PHE CA HA sing N N 211 PHE C O doub N N 212 PHE C OXT sing N N 213 PHE CB CG sing N N 214 PHE CB HB2 sing N N 215 PHE CB HB3 sing N N 216 PHE CG CD1 doub Y N 217 PHE CG CD2 sing Y N 218 PHE CD1 CE1 sing Y N 219 PHE CD1 HD1 sing N N 220 PHE CD2 CE2 doub Y N 221 PHE CD2 HD2 sing N N 222 PHE CE1 CZ doub Y N 223 PHE CE1 HE1 sing N N 224 PHE CE2 CZ sing Y N 225 PHE CE2 HE2 sing N N 226 PHE CZ HZ sing N N 227 PHE OXT HXT sing N N 228 PRO N CA sing N N 229 PRO N CD sing N N 230 PRO N H sing N N 231 PRO CA C sing N N 232 PRO CA CB sing N N 233 PRO CA HA sing N N 234 PRO C O doub N N 235 PRO C OXT sing N N 236 PRO CB CG sing N N 237 PRO CB HB2 sing N N 238 PRO CB HB3 sing N N 239 PRO CG CD sing N N 240 PRO CG HG2 sing N N 241 PRO CG HG3 sing N N 242 PRO CD HD2 sing N N 243 PRO CD HD3 sing N N 244 PRO OXT HXT sing N N 245 SER N CA sing N N 246 SER N H sing N N 247 SER N H2 sing N N 248 SER CA C sing N N 249 SER CA CB sing N N 250 SER CA HA sing N N 251 SER C O doub N N 252 SER C OXT sing N N 253 SER CB OG sing N N 254 SER CB HB2 sing N N 255 SER CB HB3 sing N N 256 SER OG HG sing N N 257 SER OXT HXT sing N N 258 THR N CA sing N N 259 THR N H sing N N 260 THR N H2 sing N N 261 THR CA C sing N N 262 THR CA CB sing N N 263 THR CA HA sing N N 264 THR C O doub N N 265 THR C OXT sing N N 266 THR CB OG1 sing N N 267 THR CB CG2 sing N N 268 THR CB HB sing N N 269 THR OG1 HG1 sing N N 270 THR CG2 HG21 sing N N 271 THR CG2 HG22 sing N N 272 THR CG2 HG23 sing N N 273 THR OXT HXT sing N N 274 TRP N CA sing N N 275 TRP N H sing N N 276 TRP N H2 sing N N 277 TRP CA C sing N N 278 TRP CA CB sing N N 279 TRP CA HA sing N N 280 TRP C O doub N N 281 TRP C OXT sing N N 282 TRP CB CG sing N N 283 TRP CB HB2 sing N N 284 TRP CB HB3 sing N N 285 TRP CG CD1 doub Y N 286 TRP CG CD2 sing Y N 287 TRP CD1 NE1 sing Y N 288 TRP CD1 HD1 sing N N 289 TRP CD2 CE2 doub Y N 290 TRP CD2 CE3 sing Y N 291 TRP NE1 CE2 sing Y N 292 TRP NE1 HE1 sing N N 293 TRP CE2 CZ2 sing Y N 294 TRP CE3 CZ3 doub Y N 295 TRP CE3 HE3 sing N N 296 TRP CZ2 CH2 doub Y N 297 TRP CZ2 HZ2 sing N N 298 TRP CZ3 CH2 sing Y N 299 TRP CZ3 HZ3 sing N N 300 TRP CH2 HH2 sing N N 301 TRP OXT HXT sing N N 302 TYR N CA sing N N 303 TYR N H sing N N 304 TYR N H2 sing N N 305 TYR CA C sing N N 306 TYR CA CB sing N N 307 TYR CA HA sing N N 308 TYR C O doub N N 309 TYR C OXT sing N N 310 TYR CB CG sing N N 311 TYR CB HB2 sing N N 312 TYR CB HB3 sing N N 313 TYR CG CD1 doub Y N 314 TYR CG CD2 sing Y N 315 TYR CD1 CE1 sing Y N 316 TYR CD1 HD1 sing N N 317 TYR CD2 CE2 doub Y N 318 TYR CD2 HD2 sing N N 319 TYR CE1 CZ doub Y N 320 TYR CE1 HE1 sing N N 321 TYR CE2 CZ sing Y N 322 TYR CE2 HE2 sing N N 323 TYR CZ OH sing N N 324 TYR OH HH sing N N 325 TYR OXT HXT sing N N 326 VAL N CA sing N N 327 VAL N H sing N N 328 VAL N H2 sing N N 329 VAL CA C sing N N 330 VAL CA CB sing N N 331 VAL CA HA sing N N 332 VAL C O doub N N 333 VAL C OXT sing N N 334 VAL CB CG1 sing N N 335 VAL CB CG2 sing N N 336 VAL CB HB sing N N 337 VAL CG1 HG11 sing N N 338 VAL CG1 HG12 sing N N 339 VAL CG1 HG13 sing N N 340 VAL CG2 HG21 sing N N 341 VAL CG2 HG22 sing N N 342 VAL CG2 HG23 sing N N 343 VAL OXT HXT sing N N 344 # _atom_sites.entry_id 6J98 _atom_sites.fract_transf_matrix[1][1] 0.024474 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.024474 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009345 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE ZN # loop_ #