data_6J9K # _entry.id 6J9K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6J9K pdb_00006j9k 10.2210/pdb6j9k/pdb WWPDB D_1300010711 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6J9K _pdbx_database_status.recvd_initial_deposition_date 2019-01-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhu, Y.L.' 1 ? 'Gao, A.' 2 ? 'Serganov, A.' 3 ? 'Gao, P.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Mol. Cell' _citation.journal_id_ASTM MOCEFL _citation.journal_id_CSD 2168 _citation.journal_id_ISSN 1097-4164 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 74 _citation.language ? _citation.page_first 296 _citation.page_last 309.e7 _citation.title 'Diverse Mechanisms of CRISPR-Cas9 Inhibition by Type IIC Anti-CRISPR Proteins.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.molcel.2019.01.038 _citation.pdbx_database_id_PubMed 30850331 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhu, Y.' 1 ? primary 'Gao, A.' 2 ? primary 'Zhan, Q.' 3 ? primary 'Wang, Y.' 4 ? primary 'Feng, H.' 5 ? primary 'Liu, S.' 6 ? primary 'Gao, G.' 7 ? primary 'Serganov, A.' 8 ? primary 'Gao, P.' 9 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6J9K _cell.details ? _cell.formula_units_Z ? _cell.length_a 72.022 _cell.length_a_esd ? _cell.length_b 72.022 _cell.length_b_esd ? _cell.length_c 105.230 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6J9K _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man AcrIIC2 14502.387 1 ? ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 3 water nat water 18.015 40 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;S(MSE)ASKNNIFNKYPTIIHGEARGENDEFVVHTRYPRFLARKSFDDNFTGE(MSE)PAKPVNGELGQIGEPRRLAYDS RLGLWLSDFI(MSE)LDNNKPKN(MSE)EDWLGQLKAACDRIAADDL(MSE)LNEDAADLEGWDD ; _entity_poly.pdbx_seq_one_letter_code_can ;SMASKNNIFNKYPTIIHGEARGENDEFVVHTRYPRFLARKSFDDNFTGEMPAKPVNGELGQIGEPRRLAYDSRLGLWLSD FIMLDNNKPKNMEDWLGQLKAACDRIAADDLMLNEDAADLEGWDD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MSE n 1 3 ALA n 1 4 SER n 1 5 LYS n 1 6 ASN n 1 7 ASN n 1 8 ILE n 1 9 PHE n 1 10 ASN n 1 11 LYS n 1 12 TYR n 1 13 PRO n 1 14 THR n 1 15 ILE n 1 16 ILE n 1 17 HIS n 1 18 GLY n 1 19 GLU n 1 20 ALA n 1 21 ARG n 1 22 GLY n 1 23 GLU n 1 24 ASN n 1 25 ASP n 1 26 GLU n 1 27 PHE n 1 28 VAL n 1 29 VAL n 1 30 HIS n 1 31 THR n 1 32 ARG n 1 33 TYR n 1 34 PRO n 1 35 ARG n 1 36 PHE n 1 37 LEU n 1 38 ALA n 1 39 ARG n 1 40 LYS n 1 41 SER n 1 42 PHE n 1 43 ASP n 1 44 ASP n 1 45 ASN n 1 46 PHE n 1 47 THR n 1 48 GLY n 1 49 GLU n 1 50 MSE n 1 51 PRO n 1 52 ALA n 1 53 LYS n 1 54 PRO n 1 55 VAL n 1 56 ASN n 1 57 GLY n 1 58 GLU n 1 59 LEU n 1 60 GLY n 1 61 GLN n 1 62 ILE n 1 63 GLY n 1 64 GLU n 1 65 PRO n 1 66 ARG n 1 67 ARG n 1 68 LEU n 1 69 ALA n 1 70 TYR n 1 71 ASP n 1 72 SER n 1 73 ARG n 1 74 LEU n 1 75 GLY n 1 76 LEU n 1 77 TRP n 1 78 LEU n 1 79 SER n 1 80 ASP n 1 81 PHE n 1 82 ILE n 1 83 MSE n 1 84 LEU n 1 85 ASP n 1 86 ASN n 1 87 ASN n 1 88 LYS n 1 89 PRO n 1 90 LYS n 1 91 ASN n 1 92 MSE n 1 93 GLU n 1 94 ASP n 1 95 TRP n 1 96 LEU n 1 97 GLY n 1 98 GLN n 1 99 LEU n 1 100 LYS n 1 101 ALA n 1 102 ALA n 1 103 CYS n 1 104 ASP n 1 105 ARG n 1 106 ILE n 1 107 ALA n 1 108 ALA n 1 109 ASP n 1 110 ASP n 1 111 LEU n 1 112 MSE n 1 113 LEU n 1 114 ASN n 1 115 GLU n 1 116 ASP n 1 117 ALA n 1 118 ALA n 1 119 ASP n 1 120 LEU n 1 121 GLU n 1 122 GLY n 1 123 TRP n 1 124 ASP n 1 125 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 125 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CIJ84_02100 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Neisseria meningitidis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 487 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A3E2QCQ3_NEIME _struct_ref.pdbx_db_accession A0A3E2QCQ3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SKNNIFNKYPTIIHGEARGENDEFVVHTRYPRFLARKSFDDNFTGEMPAKPVNGELGQIGEPRRLAYDSRLGLWLSDFIM LDNNKPKNMEDWLGQLKAACDRIAADDLMLNEDAADLEGWDD ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6J9K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A3E2QCQ3 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 123 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 124 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6J9K SER A 1 ? UNP A0A3E2QCQ3 ? ? 'expression tag' 0 1 1 6J9K MSE A 2 ? UNP A0A3E2QCQ3 ? ? 'see sequence details' 1 2 1 6J9K ALA A 3 ? UNP A0A3E2QCQ3 ? ? 'see sequence details' 2 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6J9K _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.76 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.45 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Tris, ethanol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 193 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-08-22 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9785 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9785 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6J9K _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.23 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8250 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 35.2 _reflns.pdbx_Rmerge_I_obs 0.094 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.23 _reflns_shell.d_res_low 2.3 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 599 _reflns_shell.percent_possible_all 81.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 4.078 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6J9K _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.234 _refine.ls_d_res_low 40.217 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8121 _refine.ls_number_reflns_R_free 813 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.48 _refine.ls_percent_reflns_R_free 10.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2095 _refine.ls_R_factor_R_free 0.2429 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2057 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.29 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.30 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 927 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 40 _refine_hist.number_atoms_total 969 _refine_hist.d_res_high 2.234 _refine_hist.d_res_low 40.217 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 977 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.213 ? 1323 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.994 ? 375 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.086 ? 134 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 182 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2342 2.3742 . . 114 1022 85.00 . . . 0.3515 . 0.3092 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3742 2.5575 . . 135 1218 100.00 . . . 0.3481 . 0.2797 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5575 2.8148 . . 135 1213 100.00 . . . 0.3053 . 0.2432 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8148 3.2219 . . 137 1227 100.00 . . . 0.2687 . 0.2073 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2219 4.0587 . . 141 1265 100.00 . . . 0.2178 . 0.1872 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0587 40.2235 . . 151 1363 100.00 . . . 0.2331 . 0.2013 . . . . . . . . . . # _struct.entry_id 6J9K _struct.title Apo-AcrIIC2 _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6J9K _struct_keywords.text 'AcrIIC2, HYDROLASE INHIBITOR' _struct_keywords.pdbx_keywords 'HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 4 ? ASN A 10 ? SER A 3 ASN A 9 1 ? 7 HELX_P HELX_P2 AA2 ASN A 91 ? ASP A 119 ? ASN A 90 ASP A 118 1 ? 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLU 49 C ? ? ? 1_555 A MSE 50 N ? ? A GLU 48 A MSE 49 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? A MSE 50 C ? ? ? 1_555 A PRO 51 N ? ? A MSE 49 A PRO 50 1_555 ? ? ? ? ? ? ? 1.351 ? ? covale3 covale both ? A ILE 82 C ? ? ? 1_555 A MSE 83 N ? ? A ILE 81 A MSE 82 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale4 covale both ? A MSE 83 C ? ? ? 1_555 A LEU 84 N ? ? A MSE 82 A LEU 83 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale5 covale both ? A ASN 91 C ? ? ? 1_555 A MSE 92 N ? ? A ASN 90 A MSE 91 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale6 covale both ? A MSE 92 C ? ? ? 1_555 A GLU 93 N ? ? A MSE 91 A GLU 92 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale7 covale both ? A LEU 111 C ? ? ? 1_555 A MSE 112 N ? ? A LEU 110 A MSE 111 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale8 covale both ? A MSE 112 C ? ? ? 1_555 A LEU 113 N ? ? A MSE 111 A LEU 112 1_555 ? ? ? ? ? ? ? 1.332 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 33 A . ? TYR 32 A PRO 34 A ? PRO 33 A 1 -5.17 2 GLU 64 A . ? GLU 63 A PRO 65 A ? PRO 64 A 1 -2.48 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 15 ? GLY A 18 ? ILE A 14 GLY A 17 AA1 2 GLU A 26 ? HIS A 30 ? GLU A 25 HIS A 29 AA1 3 PHE A 36 ? PHE A 42 ? PHE A 35 PHE A 41 AA1 4 LEU A 76 ? MSE A 83 ? LEU A 75 MSE A 82 AA1 5 ARG A 67 ? ASP A 71 ? ARG A 66 ASP A 70 AA1 6 GLU A 58 ? ILE A 62 ? GLU A 57 ILE A 61 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 18 ? N GLY A 17 O PHE A 27 ? O PHE A 26 AA1 2 3 N HIS A 30 ? N HIS A 29 O PHE A 36 ? O PHE A 35 AA1 3 4 N SER A 41 ? N SER A 40 O TRP A 77 ? O TRP A 76 AA1 4 5 O LEU A 78 ? O LEU A 77 N TYR A 70 ? N TYR A 69 AA1 5 6 O ASP A 71 ? O ASP A 70 N GLU A 58 ? N GLU A 57 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id MG _struct_site.pdbx_auth_seq_id 202 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'binding site for residue MG A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ASP A 110 ? ASP A 109 . ? 1_555 ? 2 AC1 2 ASN A 114 ? ASN A 113 . ? 1_555 ? # _atom_sites.entry_id 6J9K _atom_sites.fract_transf_matrix[1][1] 0.013885 _atom_sites.fract_transf_matrix[1][2] 0.008016 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016033 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009503 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 0 ? ? ? A . n A 1 2 MSE 2 1 ? ? ? A . n A 1 3 ALA 3 2 ? ? ? A . n A 1 4 SER 4 3 3 SER SER A . n A 1 5 LYS 5 4 4 LYS LYS A . n A 1 6 ASN 6 5 5 ASN ASN A . n A 1 7 ASN 7 6 6 ASN ASN A . n A 1 8 ILE 8 7 7 ILE ILE A . n A 1 9 PHE 9 8 8 PHE PHE A . n A 1 10 ASN 10 9 9 ASN ASN A . n A 1 11 LYS 11 10 10 LYS LYS A . n A 1 12 TYR 12 11 11 TYR TYR A . n A 1 13 PRO 13 12 12 PRO PRO A . n A 1 14 THR 14 13 13 THR THR A . n A 1 15 ILE 15 14 14 ILE ILE A . n A 1 16 ILE 16 15 15 ILE ILE A . n A 1 17 HIS 17 16 16 HIS HIS A . n A 1 18 GLY 18 17 17 GLY GLY A . n A 1 19 GLU 19 18 18 GLU GLU A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 ARG 21 20 20 ARG ARG A . n A 1 22 GLY 22 21 21 GLY GLY A . n A 1 23 GLU 23 22 22 GLU GLU A . n A 1 24 ASN 24 23 23 ASN ASN A . n A 1 25 ASP 25 24 24 ASP ASP A . n A 1 26 GLU 26 25 25 GLU GLU A . n A 1 27 PHE 27 26 26 PHE PHE A . n A 1 28 VAL 28 27 27 VAL VAL A . n A 1 29 VAL 29 28 28 VAL VAL A . n A 1 30 HIS 30 29 29 HIS HIS A . n A 1 31 THR 31 30 30 THR THR A . n A 1 32 ARG 32 31 31 ARG ARG A . n A 1 33 TYR 33 32 32 TYR TYR A . n A 1 34 PRO 34 33 33 PRO PRO A . n A 1 35 ARG 35 34 34 ARG ARG A . n A 1 36 PHE 36 35 35 PHE PHE A . n A 1 37 LEU 37 36 36 LEU LEU A . n A 1 38 ALA 38 37 37 ALA ALA A . n A 1 39 ARG 39 38 38 ARG ARG A . n A 1 40 LYS 40 39 39 LYS LYS A . n A 1 41 SER 41 40 40 SER SER A . n A 1 42 PHE 42 41 41 PHE PHE A . n A 1 43 ASP 43 42 42 ASP ASP A . n A 1 44 ASP 44 43 43 ASP ASP A . n A 1 45 ASN 45 44 44 ASN ASN A . n A 1 46 PHE 46 45 45 PHE PHE A . n A 1 47 THR 47 46 46 THR THR A . n A 1 48 GLY 48 47 47 GLY GLY A . n A 1 49 GLU 49 48 48 GLU GLU A . n A 1 50 MSE 50 49 49 MSE MSE A . n A 1 51 PRO 51 50 50 PRO PRO A . n A 1 52 ALA 52 51 51 ALA ALA A . n A 1 53 LYS 53 52 52 LYS LYS A . n A 1 54 PRO 54 53 53 PRO PRO A . n A 1 55 VAL 55 54 54 VAL VAL A . n A 1 56 ASN 56 55 55 ASN ASN A . n A 1 57 GLY 57 56 56 GLY GLY A . n A 1 58 GLU 58 57 57 GLU GLU A . n A 1 59 LEU 59 58 58 LEU LEU A . n A 1 60 GLY 60 59 59 GLY GLY A . n A 1 61 GLN 61 60 60 GLN GLN A . n A 1 62 ILE 62 61 61 ILE ILE A . n A 1 63 GLY 63 62 62 GLY GLY A . n A 1 64 GLU 64 63 63 GLU GLU A . n A 1 65 PRO 65 64 64 PRO PRO A . n A 1 66 ARG 66 65 65 ARG ARG A . n A 1 67 ARG 67 66 66 ARG ARG A . n A 1 68 LEU 68 67 67 LEU LEU A . n A 1 69 ALA 69 68 68 ALA ALA A . n A 1 70 TYR 70 69 69 TYR TYR A . n A 1 71 ASP 71 70 70 ASP ASP A . n A 1 72 SER 72 71 71 SER SER A . n A 1 73 ARG 73 72 72 ARG ARG A . n A 1 74 LEU 74 73 73 LEU LEU A . n A 1 75 GLY 75 74 74 GLY GLY A . n A 1 76 LEU 76 75 75 LEU LEU A . n A 1 77 TRP 77 76 76 TRP TRP A . n A 1 78 LEU 78 77 77 LEU LEU A . n A 1 79 SER 79 78 78 SER SER A . n A 1 80 ASP 80 79 79 ASP ASP A . n A 1 81 PHE 81 80 80 PHE PHE A . n A 1 82 ILE 82 81 81 ILE ILE A . n A 1 83 MSE 83 82 82 MSE MSE A . n A 1 84 LEU 84 83 83 LEU LEU A . n A 1 85 ASP 85 84 84 ASP ASP A . n A 1 86 ASN 86 85 85 ASN ASN A . n A 1 87 ASN 87 86 86 ASN ASN A . n A 1 88 LYS 88 87 87 LYS ALA A . n A 1 89 PRO 89 88 88 PRO PRO A . n A 1 90 LYS 90 89 89 LYS LYS A . n A 1 91 ASN 91 90 90 ASN ASN A . n A 1 92 MSE 92 91 91 MSE MSE A . n A 1 93 GLU 93 92 92 GLU GLU A . n A 1 94 ASP 94 93 93 ASP ASP A . n A 1 95 TRP 95 94 94 TRP TRP A . n A 1 96 LEU 96 95 95 LEU LEU A . n A 1 97 GLY 97 96 96 GLY GLY A . n A 1 98 GLN 98 97 97 GLN GLN A . n A 1 99 LEU 99 98 98 LEU LEU A . n A 1 100 LYS 100 99 99 LYS LYS A . n A 1 101 ALA 101 100 100 ALA ALA A . n A 1 102 ALA 102 101 101 ALA ALA A . n A 1 103 CYS 103 102 102 CYS CYS A . n A 1 104 ASP 104 103 103 ASP ASP A . n A 1 105 ARG 105 104 104 ARG ARG A . n A 1 106 ILE 106 105 105 ILE ILE A . n A 1 107 ALA 107 106 106 ALA ALA A . n A 1 108 ALA 108 107 107 ALA ALA A . n A 1 109 ASP 109 108 108 ASP ASP A . n A 1 110 ASP 110 109 109 ASP ASP A . n A 1 111 LEU 111 110 110 LEU LEU A . n A 1 112 MSE 112 111 111 MSE MSE A . n A 1 113 LEU 113 112 112 LEU LEU A . n A 1 114 ASN 114 113 113 ASN ASN A . n A 1 115 GLU 115 114 114 GLU GLU A . n A 1 116 ASP 116 115 115 ASP ASP A . n A 1 117 ALA 117 116 116 ALA ALA A . n A 1 118 ALA 118 117 117 ALA ALA A . n A 1 119 ASP 119 118 118 ASP ASP A . n A 1 120 LEU 120 119 ? ? ? A . n A 1 121 GLU 121 120 ? ? ? A . n A 1 122 GLY 122 121 ? ? ? A . n A 1 123 TRP 123 122 ? ? ? A . n A 1 124 ASP 124 123 ? ? ? A . n A 1 125 ASP 125 124 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 201 1 MG MG A . C 2 MG 1 202 2 MG MG A . D 3 HOH 1 301 24 HOH HOH A . D 3 HOH 2 302 27 HOH HOH A . D 3 HOH 3 303 44 HOH HOH A . D 3 HOH 4 304 26 HOH HOH A . D 3 HOH 5 305 6 HOH HOH A . D 3 HOH 6 306 1 HOH HOH A . D 3 HOH 7 307 37 HOH HOH A . D 3 HOH 8 308 17 HOH HOH A . D 3 HOH 9 309 5 HOH HOH A . D 3 HOH 10 310 2 HOH HOH A . D 3 HOH 11 311 12 HOH HOH A . D 3 HOH 12 312 16 HOH HOH A . D 3 HOH 13 313 48 HOH HOH A . D 3 HOH 14 314 43 HOH HOH A . D 3 HOH 15 315 11 HOH HOH A . D 3 HOH 16 316 25 HOH HOH A . D 3 HOH 17 317 41 HOH HOH A . D 3 HOH 18 318 47 HOH HOH A . D 3 HOH 19 319 38 HOH HOH A . D 3 HOH 20 320 35 HOH HOH A . D 3 HOH 21 321 7 HOH HOH A . D 3 HOH 22 322 28 HOH HOH A . D 3 HOH 23 323 40 HOH HOH A . D 3 HOH 24 324 21 HOH HOH A . D 3 HOH 25 325 4 HOH HOH A . D 3 HOH 26 326 29 HOH HOH A . D 3 HOH 27 327 31 HOH HOH A . D 3 HOH 28 328 22 HOH HOH A . D 3 HOH 29 329 23 HOH HOH A . D 3 HOH 30 330 36 HOH HOH A . D 3 HOH 31 331 34 HOH HOH A . D 3 HOH 32 332 30 HOH HOH A . D 3 HOH 33 333 45 HOH HOH A . D 3 HOH 34 334 39 HOH HOH A . D 3 HOH 35 335 32 HOH HOH A . D 3 HOH 36 336 46 HOH HOH A . D 3 HOH 37 337 49 HOH HOH A . D 3 HOH 38 338 33 HOH HOH A . D 3 HOH 39 339 15 HOH HOH A . D 3 HOH 40 340 42 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 50 A MSE 49 ? MET 'modified residue' 2 A MSE 83 A MSE 82 ? MET 'modified residue' 3 A MSE 92 A MSE 91 ? MET 'modified residue' 4 A MSE 112 A MSE 111 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2910 ? 1 MORE -30 ? 1 'SSA (A^2)' 13080 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 105.2300000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id MG _pdbx_struct_special_symmetry.auth_seq_id 201 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id MG _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-03-06 2 'Structure model' 1 1 2019-03-20 3 'Structure model' 1 2 2019-05-01 4 'Structure model' 1 3 2022-03-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Author supporting evidence' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 4 'Structure model' '_database_2.pdbx_DOI' 14 4 'Structure model' '_database_2.pdbx_database_accession' 15 4 'Structure model' '_pdbx_audit_support.funding_organization' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 19.7370 31.5123 49.0192 0.4202 0.3810 0.2923 0.1128 0.0924 -0.0627 7.4710 5.6801 5.5117 -0.0714 3.4946 -0.8582 -0.4766 -0.1804 -0.1263 -0.2456 0.1629 -0.1677 0.1276 0.3837 0.1690 'X-RAY DIFFRACTION' 2 ? refined 10.3573 22.5998 33.5109 1.1093 0.7199 1.0689 0.0691 -0.1136 -0.2169 2.0279 8.8903 7.5604 -6.3606 -6.5150 1.3161 -0.4492 0.3816 -2.8489 -1.6158 0.0757 1.1090 1.1729 0.5209 -0.0322 'X-RAY DIFFRACTION' 3 ? refined 17.0968 39.7605 37.3196 0.6283 0.4327 0.4342 0.0334 0.1009 0.0466 5.2496 7.1426 6.6617 -2.1355 -0.1125 0.1597 0.2874 0.5256 0.6985 -0.9302 -0.2734 -0.3958 -0.5696 0.4830 -0.0403 'X-RAY DIFFRACTION' 4 ? refined 17.9883 22.6509 39.8217 0.9028 0.6256 0.4921 0.0915 0.0573 -0.0767 5.8623 2.0194 7.7583 1.0996 -0.3162 -4.8348 -0.0155 -0.1684 -0.5992 -1.5115 -0.1809 -0.4052 1.5135 -0.2681 0.0906 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 3 through 41 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 42 through 56 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 57 through 97 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 98 through 118 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.1_1168 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 4 # _pdbx_entry_details.compound_details ? _pdbx_entry_details.entry_id 6J9K _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;Sequence of AcrIIC2 was based on protein sequence of published literature (Pawluk et al., PMID: 27984730), in which reisdues 'MA' at terminal were reported. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 87 ? CG ? A LYS 88 CG 2 1 Y 1 A LYS 87 ? CD ? A LYS 88 CD 3 1 Y 1 A LYS 87 ? CE ? A LYS 88 CE 4 1 Y 1 A LYS 87 ? NZ ? A LYS 88 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 0 ? A SER 1 2 1 Y 1 A MSE 1 ? A MSE 2 3 1 Y 1 A ALA 2 ? A ALA 3 4 1 Y 1 A LEU 119 ? A LEU 120 5 1 Y 1 A GLU 120 ? A GLU 121 6 1 Y 1 A GLY 121 ? A GLY 122 7 1 Y 1 A TRP 122 ? A TRP 123 8 1 Y 1 A ASP 123 ? A ASP 124 9 1 Y 1 A ASP 124 ? A ASP 125 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' 'United States' R01GM112940 1 'National Science Foundation (China)' China 91753133 2 'National Science Foundation (China)' China 31670903 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #