data_6JCF
# 
_entry.id   6JCF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.380 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6JCF         pdb_00006jcf 10.2210/pdb6jcf/pdb 
WWPDB D_1300010840 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6JCF 
_pdbx_database_status.recvd_initial_deposition_date   2019-01-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Park, J.H.' 1 0000-0001-5690-9705 
'Han, J.'    2 0000-0001-7388-1900 
'Kim, T.H.'  3 0000-0002-6102-9814 
'Yun, J.H.'  4 0000-0001-7570-369X 
'Lee, W.'    5 0000-0003-2347-1262 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CH 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Int J Mol Sci' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1422-0067 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            20 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Non-Cryogenic Structure and Dynamics of HIV-1 Integrase Catalytic Core Domain by X-ray Free-Electron Lasers.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.3390/ijms20081943 
_citation.pdbx_database_id_PubMed   31010024 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Park, J.H.' 1  ?                   
primary 'Yun, J.H.'  2  0000-0001-7570-369X 
primary 'Shi, Y.'    3  0000-0003-4682-3195 
primary 'Han, J.'    4  ?                   
primary 'Li, X.'     5  ?                   
primary 'Jin, Z.'    6  ?                   
primary 'Kim, T.'    7  ?                   
primary 'Park, J.'   8  ?                   
primary 'Park, S.'   9  ?                   
primary 'Liu, H.'    10 0000-0001-7324-6632 
primary 'Lee, W.'    11 ?                   
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6JCF 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     72.080 
_cell.length_a_esd                 ? 
_cell.length_b                     72.080 
_cell.length_b_esd                 ? 
_cell.length_c                     65.192 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6JCF 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Integrase        17838.338 1  ? F185K 'HIV-1 Integrase catalytic core domain' ? 
2 non-polymer nat 'CACODYLATE ION' 136.989   2  ? ?     ?                                       ? 
3 water       nat water            18.015    29 ? ?     ?                                       ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA
CWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
TKE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA
CWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
TKE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   HIS n 
1 3   GLY n 
1 4   GLN n 
1 5   VAL n 
1 6   ASP n 
1 7   CYS n 
1 8   SER n 
1 9   PRO n 
1 10  GLY n 
1 11  ILE n 
1 12  TRP n 
1 13  GLN n 
1 14  LEU n 
1 15  ASP n 
1 16  CYS n 
1 17  THR n 
1 18  HIS n 
1 19  LEU n 
1 20  GLU n 
1 21  GLY n 
1 22  LYS n 
1 23  VAL n 
1 24  ILE n 
1 25  LEU n 
1 26  VAL n 
1 27  ALA n 
1 28  VAL n 
1 29  HIS n 
1 30  VAL n 
1 31  ALA n 
1 32  SER n 
1 33  GLY n 
1 34  TYR n 
1 35  ILE n 
1 36  GLU n 
1 37  ALA n 
1 38  GLU n 
1 39  VAL n 
1 40  ILE n 
1 41  PRO n 
1 42  ALA n 
1 43  GLU n 
1 44  THR n 
1 45  GLY n 
1 46  GLN n 
1 47  GLU n 
1 48  THR n 
1 49  ALA n 
1 50  TYR n 
1 51  PHE n 
1 52  LEU n 
1 53  LEU n 
1 54  LYS n 
1 55  LEU n 
1 56  ALA n 
1 57  GLY n 
1 58  ARG n 
1 59  TRP n 
1 60  PRO n 
1 61  VAL n 
1 62  LYS n 
1 63  THR n 
1 64  VAL n 
1 65  HIS n 
1 66  THR n 
1 67  ASP n 
1 68  ASN n 
1 69  GLY n 
1 70  SER n 
1 71  ASN n 
1 72  PHE n 
1 73  THR n 
1 74  SER n 
1 75  THR n 
1 76  THR n 
1 77  VAL n 
1 78  LYS n 
1 79  ALA n 
1 80  ALA n 
1 81  CYS n 
1 82  TRP n 
1 83  TRP n 
1 84  ALA n 
1 85  GLY n 
1 86  ILE n 
1 87  LYS n 
1 88  GLN n 
1 89  GLU n 
1 90  PHE n 
1 91  GLY n 
1 92  ILE n 
1 93  PRO n 
1 94  TYR n 
1 95  ASN n 
1 96  PRO n 
1 97  GLN n 
1 98  SER n 
1 99  GLN n 
1 100 GLY n 
1 101 VAL n 
1 102 ILE n 
1 103 GLU n 
1 104 SER n 
1 105 MET n 
1 106 ASN n 
1 107 LYS n 
1 108 GLU n 
1 109 LEU n 
1 110 LYS n 
1 111 LYS n 
1 112 ILE n 
1 113 ILE n 
1 114 GLY n 
1 115 GLN n 
1 116 VAL n 
1 117 ARG n 
1 118 ASP n 
1 119 GLN n 
1 120 ALA n 
1 121 GLU n 
1 122 HIS n 
1 123 LEU n 
1 124 LYS n 
1 125 THR n 
1 126 ALA n 
1 127 VAL n 
1 128 GLN n 
1 129 MET n 
1 130 ALA n 
1 131 VAL n 
1 132 PHE n 
1 133 ILE n 
1 134 HIS n 
1 135 ASN n 
1 136 LYS n 
1 137 LYS n 
1 138 ARG n 
1 139 LYS n 
1 140 GLY n 
1 141 GLY n 
1 142 ILE n 
1 143 GLY n 
1 144 GLY n 
1 145 TYR n 
1 146 SER n 
1 147 ALA n 
1 148 GLY n 
1 149 GLU n 
1 150 ARG n 
1 151 ILE n 
1 152 VAL n 
1 153 ASP n 
1 154 ILE n 
1 155 ILE n 
1 156 ALA n 
1 157 THR n 
1 158 ASP n 
1 159 ILE n 
1 160 GLN n 
1 161 THR n 
1 162 LYS n 
1 163 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   163 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 pol 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human immunodeficiency virus 1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11676 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    F2WR52_9HIV1 
_struct_ref.pdbx_db_accession          F2WR52 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;HGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAC
WWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQT
KE
;
_struct_ref.pdbx_align_begin           51 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6JCF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 163 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             F2WR52 
_struct_ref_seq.db_align_beg                  51 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  212 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       51 
_struct_ref_seq.pdbx_auth_seq_align_end       212 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6JCF GLY A 1   ? UNP F2WR52 ?   ?   'expression tag'      50  1 
1 6JCF LYS A 136 ? UNP F2WR52 PHE 185 'engineered mutation' 185 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                'C4 H7 N O4'     133.103 
CAC non-polymer         . 'CACODYLATE ION' dimethylarsinate 'C2 H6 As O2 -1' 136.989 
CYS 'L-peptide linking' y CYSTEINE         ?                'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ?                'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ?                'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ?                'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ?                'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6JCF 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.74 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.12 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2mM Ammonium sulfate, 0.1M sodiumcacodylate trihydrate, 30% peg 8000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-11-13 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    0.987 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.987 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PAL/PLS BEAMLINE 5C (4A)' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.987 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   '5C (4A)' 
_diffrn_source.pdbx_synchrotron_site       PAL/PLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6JCF 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.15 
_reflns.d_resolution_low                 36.05 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       10934 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.98 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  1.9 
_reflns.pdbx_Rmerge_I_obs                0.0289 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            33.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.15 
_reflns_shell.d_res_low                   2.25 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.9 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1270 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.222 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             1.9 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.861 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6JCF 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.153 
_refine.ls_d_res_low                             36.040 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     10934 
_refine.ls_number_reflns_R_free                  548 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.99 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2022 
_refine.ls_R_factor_R_free                       0.2496 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1997 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1ITG 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.54 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.24 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1106 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             29 
_refine_hist.number_atoms_total               1143 
_refine_hist.d_res_high                       2.153 
_refine_hist.d_res_low                        36.040 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 1133 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.590  ? 1527 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 12.169 ? 665  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.045  ? 175  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 189  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.1534 2.2514  . . 66 1270 100.00 . . . 0.3012 . 0.2176 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2514 2.3700  . . 67 1277 100.00 . . . 0.2514 . 0.1981 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3700 2.5185  . . 70 1274 100.00 . . . 0.2826 . 0.2110 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5185 2.7129  . . 69 1290 100.00 . . . 0.1996 . 0.1862 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7129 2.9858  . . 69 1276 100.00 . . . 0.2489 . 0.2205 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9858 3.4175  . . 70 1304 100.00 . . . 0.2719 . 0.2079 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4175 4.3046  . . 71 1312 100.00 . . . 0.2258 . 0.1869 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3046 36.0450 . . 66 1383 100.00 . . . 0.2599 . 0.1988 . . . . . . . . . . 
# 
_struct.entry_id                     6JCF 
_struct.title                        'Cryogenic structure of HIV-1 Integrase catalytic core domain by synchrotron' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6JCF 
_struct_keywords.text            'HIV, HIV-1, Integrase, cryogenic, VIRAL PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 THR A 44  ? TRP A 59  ? THR A 93  TRP A 108 1 ? 16 
HELX_P HELX_P2 AA2 ASN A 68  ? THR A 73  ? ASN A 117 THR A 122 5 ? 6  
HELX_P HELX_P3 AA3 SER A 74  ? GLY A 85  ? SER A 123 GLY A 134 1 ? 12 
HELX_P HELX_P4 AA4 GLY A 100 ? ARG A 117 ? GLY A 149 ARG A 166 1 ? 18 
HELX_P HELX_P5 AA5 ASP A 118 ? ALA A 120 ? ASP A 167 ALA A 169 5 ? 3  
HELX_P HELX_P6 AA6 HIS A 122 ? LYS A 137 ? HIS A 171 LYS A 186 1 ? 16 
HELX_P HELX_P7 AA7 SER A 146 ? GLN A 160 ? SER A 195 GLN A 209 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 35 ? ILE A 40 ? ILE A 84  ILE A 89  
AA1 2 LYS A 22 ? HIS A 29 ? LYS A 71  HIS A 78  
AA1 3 ILE A 11 ? LEU A 19 ? ILE A 60  LEU A 68  
AA1 4 THR A 63 ? HIS A 65 ? THR A 112 HIS A 114 
AA1 5 LYS A 87 ? GLN A 88 ? LYS A 136 GLN A 137 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLU A 36 ? O GLU A 85  N ALA A 27 ? N ALA A 76  
AA1 2 3 O VAL A 26 ? O VAL A 75  N ASP A 15 ? N ASP A 64  
AA1 3 4 N LEU A 14 ? N LEU A 63  O HIS A 65 ? O HIS A 114 
AA1 4 5 N VAL A 64 ? N VAL A 113 O LYS A 87 ? O LYS A 136 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CAC 301 ? 6 'binding site for residue CAC A 301' 
AC2 Software A CAC 302 ? 5 'binding site for residue CAC A 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 15 ? ASP A 64  . ? 1_555 ? 
2  AC1 6 CYS A 16 ? CYS A 65  . ? 1_555 ? 
3  AC1 6 GLU A 43 ? GLU A 92  . ? 1_555 ? 
4  AC1 6 THR A 48 ? THR A 97  . ? 1_555 ? 
5  AC1 6 ASN A 71 ? ASN A 120 . ? 1_555 ? 
6  AC1 6 HOH D .  ? HOH A 404 . ? 1_555 ? 
7  AC2 5 PHE A 72 ? PHE A 121 . ? 1_555 ? 
8  AC2 5 CYS A 81 ? CYS A 130 . ? 1_555 ? 
9  AC2 5 ILE A 86 ? ILE A 135 . ? 1_555 ? 
10 AC2 5 LYS A 87 ? LYS A 136 . ? 1_555 ? 
11 AC2 5 GLN A 88 ? GLN A 137 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6JCF 
_atom_sites.fract_transf_matrix[1][1]   0.013873 
_atom_sites.fract_transf_matrix[1][2]   0.008010 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016020 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015339 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AS 
C  
N  
O  
S  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   50  ?   ?   ?   A . n 
A 1 2   HIS 2   51  ?   ?   ?   A . n 
A 1 3   GLY 3   52  ?   ?   ?   A . n 
A 1 4   GLN 4   53  ?   ?   ?   A . n 
A 1 5   VAL 5   54  ?   ?   ?   A . n 
A 1 6   ASP 6   55  ?   ?   ?   A . n 
A 1 7   CYS 7   56  56  CYS CYS A . n 
A 1 8   SER 8   57  57  SER SER A . n 
A 1 9   PRO 9   58  58  PRO PRO A . n 
A 1 10  GLY 10  59  59  GLY GLY A . n 
A 1 11  ILE 11  60  60  ILE ILE A . n 
A 1 12  TRP 12  61  61  TRP TRP A . n 
A 1 13  GLN 13  62  62  GLN GLN A . n 
A 1 14  LEU 14  63  63  LEU LEU A . n 
A 1 15  ASP 15  64  64  ASP ASP A . n 
A 1 16  CYS 16  65  65  CYS CYS A . n 
A 1 17  THR 17  66  66  THR THR A . n 
A 1 18  HIS 18  67  67  HIS HIS A . n 
A 1 19  LEU 19  68  68  LEU LEU A . n 
A 1 20  GLU 20  69  69  GLU GLU A . n 
A 1 21  GLY 21  70  70  GLY GLY A . n 
A 1 22  LYS 22  71  71  LYS LYS A . n 
A 1 23  VAL 23  72  72  VAL VAL A . n 
A 1 24  ILE 24  73  73  ILE ILE A . n 
A 1 25  LEU 25  74  74  LEU LEU A . n 
A 1 26  VAL 26  75  75  VAL VAL A . n 
A 1 27  ALA 27  76  76  ALA ALA A . n 
A 1 28  VAL 28  77  77  VAL VAL A . n 
A 1 29  HIS 29  78  78  HIS HIS A . n 
A 1 30  VAL 30  79  79  VAL VAL A . n 
A 1 31  ALA 31  80  80  ALA ALA A . n 
A 1 32  SER 32  81  81  SER SER A . n 
A 1 33  GLY 33  82  82  GLY GLY A . n 
A 1 34  TYR 34  83  83  TYR TYR A . n 
A 1 35  ILE 35  84  84  ILE ILE A . n 
A 1 36  GLU 36  85  85  GLU GLU A . n 
A 1 37  ALA 37  86  86  ALA ALA A . n 
A 1 38  GLU 38  87  87  GLU GLU A . n 
A 1 39  VAL 39  88  88  VAL VAL A . n 
A 1 40  ILE 40  89  89  ILE ILE A . n 
A 1 41  PRO 41  90  90  PRO PRO A . n 
A 1 42  ALA 42  91  91  ALA ALA A . n 
A 1 43  GLU 43  92  92  GLU GLU A . n 
A 1 44  THR 44  93  93  THR THR A . n 
A 1 45  GLY 45  94  94  GLY GLY A . n 
A 1 46  GLN 46  95  95  GLN GLN A . n 
A 1 47  GLU 47  96  96  GLU GLU A . n 
A 1 48  THR 48  97  97  THR THR A . n 
A 1 49  ALA 49  98  98  ALA ALA A . n 
A 1 50  TYR 50  99  99  TYR TYR A . n 
A 1 51  PHE 51  100 100 PHE PHE A . n 
A 1 52  LEU 52  101 101 LEU LEU A . n 
A 1 53  LEU 53  102 102 LEU LEU A . n 
A 1 54  LYS 54  103 103 LYS LYS A . n 
A 1 55  LEU 55  104 104 LEU LEU A . n 
A 1 56  ALA 56  105 105 ALA ALA A . n 
A 1 57  GLY 57  106 106 GLY GLY A . n 
A 1 58  ARG 58  107 107 ARG ARG A . n 
A 1 59  TRP 59  108 108 TRP TRP A . n 
A 1 60  PRO 60  109 109 PRO PRO A . n 
A 1 61  VAL 61  110 110 VAL VAL A . n 
A 1 62  LYS 62  111 111 LYS LYS A . n 
A 1 63  THR 63  112 112 THR THR A . n 
A 1 64  VAL 64  113 113 VAL VAL A . n 
A 1 65  HIS 65  114 114 HIS HIS A . n 
A 1 66  THR 66  115 115 THR THR A . n 
A 1 67  ASP 67  116 116 ASP ASP A . n 
A 1 68  ASN 68  117 117 ASN ASN A . n 
A 1 69  GLY 69  118 118 GLY GLY A . n 
A 1 70  SER 70  119 119 SER SER A . n 
A 1 71  ASN 71  120 120 ASN ASN A . n 
A 1 72  PHE 72  121 121 PHE PHE A . n 
A 1 73  THR 73  122 122 THR THR A . n 
A 1 74  SER 74  123 123 SER SER A . n 
A 1 75  THR 75  124 124 THR THR A . n 
A 1 76  THR 76  125 125 THR THR A . n 
A 1 77  VAL 77  126 126 VAL VAL A . n 
A 1 78  LYS 78  127 127 LYS LYS A . n 
A 1 79  ALA 79  128 128 ALA ALA A . n 
A 1 80  ALA 80  129 129 ALA ALA A . n 
A 1 81  CYS 81  130 130 CYS CYS A . n 
A 1 82  TRP 82  131 131 TRP TRP A . n 
A 1 83  TRP 83  132 132 TRP TRP A . n 
A 1 84  ALA 84  133 133 ALA ALA A . n 
A 1 85  GLY 85  134 134 GLY GLY A . n 
A 1 86  ILE 86  135 135 ILE ILE A . n 
A 1 87  LYS 87  136 136 LYS LYS A . n 
A 1 88  GLN 88  137 137 GLN GLN A . n 
A 1 89  GLU 89  138 138 GLU GLU A . n 
A 1 90  PHE 90  139 139 PHE PHE A . n 
A 1 91  GLY 91  140 140 GLY GLY A . n 
A 1 92  ILE 92  141 ?   ?   ?   A . n 
A 1 93  PRO 93  142 ?   ?   ?   A . n 
A 1 94  TYR 94  143 ?   ?   ?   A . n 
A 1 95  ASN 95  144 ?   ?   ?   A . n 
A 1 96  PRO 96  145 ?   ?   ?   A . n 
A 1 97  GLN 97  146 ?   ?   ?   A . n 
A 1 98  SER 98  147 ?   ?   ?   A . n 
A 1 99  GLN 99  148 148 GLN GLN A . n 
A 1 100 GLY 100 149 149 GLY GLY A . n 
A 1 101 VAL 101 150 150 VAL VAL A . n 
A 1 102 ILE 102 151 151 ILE ILE A . n 
A 1 103 GLU 103 152 152 GLU GLU A . n 
A 1 104 SER 104 153 153 SER SER A . n 
A 1 105 MET 105 154 154 MET MET A . n 
A 1 106 ASN 106 155 155 ASN ASN A . n 
A 1 107 LYS 107 156 156 LYS LYS A . n 
A 1 108 GLU 108 157 157 GLU GLU A . n 
A 1 109 LEU 109 158 158 LEU LEU A . n 
A 1 110 LYS 110 159 159 LYS LYS A . n 
A 1 111 LYS 111 160 160 LYS LYS A . n 
A 1 112 ILE 112 161 161 ILE ILE A . n 
A 1 113 ILE 113 162 162 ILE ILE A . n 
A 1 114 GLY 114 163 163 GLY GLY A . n 
A 1 115 GLN 115 164 164 GLN GLN A . n 
A 1 116 VAL 116 165 165 VAL VAL A . n 
A 1 117 ARG 117 166 166 ARG ARG A . n 
A 1 118 ASP 118 167 167 ASP ASP A . n 
A 1 119 GLN 119 168 168 GLN GLN A . n 
A 1 120 ALA 120 169 169 ALA ALA A . n 
A 1 121 GLU 121 170 170 GLU GLU A . n 
A 1 122 HIS 122 171 171 HIS HIS A . n 
A 1 123 LEU 123 172 172 LEU LEU A . n 
A 1 124 LYS 124 173 173 LYS LYS A . n 
A 1 125 THR 125 174 174 THR THR A . n 
A 1 126 ALA 126 175 175 ALA ALA A . n 
A 1 127 VAL 127 176 176 VAL VAL A . n 
A 1 128 GLN 128 177 177 GLN GLN A . n 
A 1 129 MET 129 178 178 MET MET A . n 
A 1 130 ALA 130 179 179 ALA ALA A . n 
A 1 131 VAL 131 180 180 VAL VAL A . n 
A 1 132 PHE 132 181 181 PHE PHE A . n 
A 1 133 ILE 133 182 182 ILE ILE A . n 
A 1 134 HIS 134 183 183 HIS HIS A . n 
A 1 135 ASN 135 184 184 ASN ASN A . n 
A 1 136 LYS 136 185 185 LYS LYS A . n 
A 1 137 LYS 137 186 186 LYS LYS A . n 
A 1 138 ARG 138 187 187 ARG ARG A . n 
A 1 139 LYS 139 188 188 LYS LYS A . n 
A 1 140 GLY 140 189 ?   ?   ?   A . n 
A 1 141 GLY 141 190 ?   ?   ?   A . n 
A 1 142 ILE 142 191 ?   ?   ?   A . n 
A 1 143 GLY 143 192 ?   ?   ?   A . n 
A 1 144 GLY 144 193 ?   ?   ?   A . n 
A 1 145 TYR 145 194 194 TYR TYR A . n 
A 1 146 SER 146 195 195 SER SER A . n 
A 1 147 ALA 147 196 196 ALA ALA A . n 
A 1 148 GLY 148 197 197 GLY GLY A . n 
A 1 149 GLU 149 198 198 GLU GLU A . n 
A 1 150 ARG 150 199 199 ARG ARG A . n 
A 1 151 ILE 151 200 200 ILE ILE A . n 
A 1 152 VAL 152 201 201 VAL VAL A . n 
A 1 153 ASP 153 202 202 ASP ASP A . n 
A 1 154 ILE 154 203 203 ILE ILE A . n 
A 1 155 ILE 155 204 204 ILE ILE A . n 
A 1 156 ALA 156 205 205 ALA ALA A . n 
A 1 157 THR 157 206 206 THR THR A . n 
A 1 158 ASP 158 207 207 ASP ASP A . n 
A 1 159 ILE 159 208 208 ILE ILE A . n 
A 1 160 GLN 160 209 209 GLN GLN A . n 
A 1 161 THR 161 210 ?   ?   ?   A . n 
A 1 162 LYS 162 211 ?   ?   ?   A . n 
A 1 163 GLU 163 212 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CAC 1  301 301 CAC CAC A . 
C 2 CAC 1  302 401 CAC CAC A . 
D 3 HOH 1  401 10  HOH HOH A . 
D 3 HOH 2  402 9   HOH HOH A . 
D 3 HOH 3  403 4   HOH HOH A . 
D 3 HOH 4  404 5   HOH HOH A . 
D 3 HOH 5  405 7   HOH HOH A . 
D 3 HOH 6  406 20  HOH HOH A . 
D 3 HOH 7  407 14  HOH HOH A . 
D 3 HOH 8  408 2   HOH HOH A . 
D 3 HOH 9  409 1   HOH HOH A . 
D 3 HOH 10 410 15  HOH HOH A . 
D 3 HOH 11 411 6   HOH HOH A . 
D 3 HOH 12 412 22  HOH HOH A . 
D 3 HOH 13 413 11  HOH HOH A . 
D 3 HOH 14 414 13  HOH HOH A . 
D 3 HOH 15 415 3   HOH HOH A . 
D 3 HOH 16 416 19  HOH HOH A . 
D 3 HOH 17 417 21  HOH HOH A . 
D 3 HOH 18 418 24  HOH HOH A . 
D 3 HOH 19 419 27  HOH HOH A . 
D 3 HOH 20 420 25  HOH HOH A . 
D 3 HOH 21 421 8   HOH HOH A . 
D 3 HOH 22 422 29  HOH HOH A . 
D 3 HOH 23 423 23  HOH HOH A . 
D 3 HOH 24 424 26  HOH HOH A . 
D 3 HOH 25 425 28  HOH HOH A . 
D 3 HOH 26 426 18  HOH HOH A . 
D 3 HOH 27 427 16  HOH HOH A . 
D 3 HOH 28 428 12  HOH HOH A . 
D 3 HOH 29 429 17  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3890  ? 
1 MORE         -3    ? 
1 'SSA (A^2)'  12960 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 6_554 -x,-x+y,-z-2/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 
0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -43.4613333333 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-07-17 
2 'Structure model' 1 1 2023-11-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Database references'    
3 2 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom                
2 2 'Structure model' chem_comp_bond                
3 2 'Structure model' database_2                    
4 2 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_database_2.pdbx_DOI'                
2 2 'Structure model' '_database_2.pdbx_database_accession' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 27.0323 -26.9694 -16.6558 0.2314 0.2680 0.2869 0.0069  -0.0243 0.0088  3.1900 0.4711 2.3659 1.1886 
-0.3484 0.0242  0.0096  -0.3971 -0.3143 -0.0497 -0.1438 -0.1020 -0.1167 0.4138  0.0007  
'X-RAY DIFFRACTION' 2 ? refined 20.5964 -27.0410 -6.6278  0.5517 0.8755 0.3801 -0.1050 0.0280  -0.0793 3.8583 0.3086 0.7316 0.2879 
-1.5956 -0.2572 0.2932  -1.8170 0.5984  0.3256  -0.2017 0.0168  -0.2266 0.6345  0.0313  
'X-RAY DIFFRACTION' 3 ? refined 11.2938 -25.5052 -13.2507 0.2642 0.4330 0.3353 0.0657  -0.0556 -0.0826 3.2239 0.6762 2.6312 1.4062 
0.5517  0.5453  -0.1546 -0.6181 0.3909  0.2164  -0.0535 0.2873  -0.3141 -0.5773 -0.0049 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 56 through 133 )
;
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 134 through 168 )
;
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 169 through 209 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(1.14_3260: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .                  4 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot     ? ? ? .                  5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD1 A ASN 120 ? ? C1 A CAC 301 ? ? 1.38 
2 1 SG  A CYS 65  ? ? AS A CAC 301 ? ? 2.11 
3 1 SG  A CYS 130 ? ? AS A CAC 302 ? ? 2.12 
4 1 O   A HOH 412 ? ? O  A HOH 420 ? ? 2.15 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 N 1 A CAC 301 ? O1 ? B CAC 1 O1 
2 1 N 1 A CAC 302 ? O1 ? C CAC 1 O1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 50  ? A GLY 1   
2  1 Y 1 A HIS 51  ? A HIS 2   
3  1 Y 1 A GLY 52  ? A GLY 3   
4  1 Y 1 A GLN 53  ? A GLN 4   
5  1 Y 1 A VAL 54  ? A VAL 5   
6  1 Y 1 A ASP 55  ? A ASP 6   
7  1 Y 1 A ILE 141 ? A ILE 92  
8  1 Y 1 A PRO 142 ? A PRO 93  
9  1 Y 1 A TYR 143 ? A TYR 94  
10 1 Y 1 A ASN 144 ? A ASN 95  
11 1 Y 1 A PRO 145 ? A PRO 96  
12 1 Y 1 A GLN 146 ? A GLN 97  
13 1 Y 1 A SER 147 ? A SER 98  
14 1 Y 1 A GLY 189 ? A GLY 140 
15 1 Y 1 A GLY 190 ? A GLY 141 
16 1 Y 1 A ILE 191 ? A ILE 142 
17 1 Y 1 A GLY 192 ? A GLY 143 
18 1 Y 1 A GLY 193 ? A GLY 144 
19 1 Y 1 A THR 210 ? A THR 161 
20 1 Y 1 A LYS 211 ? A LYS 162 
21 1 Y 1 A GLU 212 ? A GLU 163 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CAC AS   AS N N 74  
CAC O1   O  N N 75  
CAC O2   O  N N 76  
CAC C1   C  N N 77  
CAC C2   C  N N 78  
CAC H11  H  N N 79  
CAC H12  H  N N 80  
CAC H13  H  N N 81  
CAC H21  H  N N 82  
CAC H22  H  N N 83  
CAC H23  H  N N 84  
CYS N    N  N N 85  
CYS CA   C  N R 86  
CYS C    C  N N 87  
CYS O    O  N N 88  
CYS CB   C  N N 89  
CYS SG   S  N N 90  
CYS OXT  O  N N 91  
CYS H    H  N N 92  
CYS H2   H  N N 93  
CYS HA   H  N N 94  
CYS HB2  H  N N 95  
CYS HB3  H  N N 96  
CYS HG   H  N N 97  
CYS HXT  H  N N 98  
GLN N    N  N N 99  
GLN CA   C  N S 100 
GLN C    C  N N 101 
GLN O    O  N N 102 
GLN CB   C  N N 103 
GLN CG   C  N N 104 
GLN CD   C  N N 105 
GLN OE1  O  N N 106 
GLN NE2  N  N N 107 
GLN OXT  O  N N 108 
GLN H    H  N N 109 
GLN H2   H  N N 110 
GLN HA   H  N N 111 
GLN HB2  H  N N 112 
GLN HB3  H  N N 113 
GLN HG2  H  N N 114 
GLN HG3  H  N N 115 
GLN HE21 H  N N 116 
GLN HE22 H  N N 117 
GLN HXT  H  N N 118 
GLU N    N  N N 119 
GLU CA   C  N S 120 
GLU C    C  N N 121 
GLU O    O  N N 122 
GLU CB   C  N N 123 
GLU CG   C  N N 124 
GLU CD   C  N N 125 
GLU OE1  O  N N 126 
GLU OE2  O  N N 127 
GLU OXT  O  N N 128 
GLU H    H  N N 129 
GLU H2   H  N N 130 
GLU HA   H  N N 131 
GLU HB2  H  N N 132 
GLU HB3  H  N N 133 
GLU HG2  H  N N 134 
GLU HG3  H  N N 135 
GLU HE2  H  N N 136 
GLU HXT  H  N N 137 
GLY N    N  N N 138 
GLY CA   C  N N 139 
GLY C    C  N N 140 
GLY O    O  N N 141 
GLY OXT  O  N N 142 
GLY H    H  N N 143 
GLY H2   H  N N 144 
GLY HA2  H  N N 145 
GLY HA3  H  N N 146 
GLY HXT  H  N N 147 
HIS N    N  N N 148 
HIS CA   C  N S 149 
HIS C    C  N N 150 
HIS O    O  N N 151 
HIS CB   C  N N 152 
HIS CG   C  Y N 153 
HIS ND1  N  Y N 154 
HIS CD2  C  Y N 155 
HIS CE1  C  Y N 156 
HIS NE2  N  Y N 157 
HIS OXT  O  N N 158 
HIS H    H  N N 159 
HIS H2   H  N N 160 
HIS HA   H  N N 161 
HIS HB2  H  N N 162 
HIS HB3  H  N N 163 
HIS HD1  H  N N 164 
HIS HD2  H  N N 165 
HIS HE1  H  N N 166 
HIS HE2  H  N N 167 
HIS HXT  H  N N 168 
HOH O    O  N N 169 
HOH H1   H  N N 170 
HOH H2   H  N N 171 
ILE N    N  N N 172 
ILE CA   C  N S 173 
ILE C    C  N N 174 
ILE O    O  N N 175 
ILE CB   C  N S 176 
ILE CG1  C  N N 177 
ILE CG2  C  N N 178 
ILE CD1  C  N N 179 
ILE OXT  O  N N 180 
ILE H    H  N N 181 
ILE H2   H  N N 182 
ILE HA   H  N N 183 
ILE HB   H  N N 184 
ILE HG12 H  N N 185 
ILE HG13 H  N N 186 
ILE HG21 H  N N 187 
ILE HG22 H  N N 188 
ILE HG23 H  N N 189 
ILE HD11 H  N N 190 
ILE HD12 H  N N 191 
ILE HD13 H  N N 192 
ILE HXT  H  N N 193 
LEU N    N  N N 194 
LEU CA   C  N S 195 
LEU C    C  N N 196 
LEU O    O  N N 197 
LEU CB   C  N N 198 
LEU CG   C  N N 199 
LEU CD1  C  N N 200 
LEU CD2  C  N N 201 
LEU OXT  O  N N 202 
LEU H    H  N N 203 
LEU H2   H  N N 204 
LEU HA   H  N N 205 
LEU HB2  H  N N 206 
LEU HB3  H  N N 207 
LEU HG   H  N N 208 
LEU HD11 H  N N 209 
LEU HD12 H  N N 210 
LEU HD13 H  N N 211 
LEU HD21 H  N N 212 
LEU HD22 H  N N 213 
LEU HD23 H  N N 214 
LEU HXT  H  N N 215 
LYS N    N  N N 216 
LYS CA   C  N S 217 
LYS C    C  N N 218 
LYS O    O  N N 219 
LYS CB   C  N N 220 
LYS CG   C  N N 221 
LYS CD   C  N N 222 
LYS CE   C  N N 223 
LYS NZ   N  N N 224 
LYS OXT  O  N N 225 
LYS H    H  N N 226 
LYS H2   H  N N 227 
LYS HA   H  N N 228 
LYS HB2  H  N N 229 
LYS HB3  H  N N 230 
LYS HG2  H  N N 231 
LYS HG3  H  N N 232 
LYS HD2  H  N N 233 
LYS HD3  H  N N 234 
LYS HE2  H  N N 235 
LYS HE3  H  N N 236 
LYS HZ1  H  N N 237 
LYS HZ2  H  N N 238 
LYS HZ3  H  N N 239 
LYS HXT  H  N N 240 
MET N    N  N N 241 
MET CA   C  N S 242 
MET C    C  N N 243 
MET O    O  N N 244 
MET CB   C  N N 245 
MET CG   C  N N 246 
MET SD   S  N N 247 
MET CE   C  N N 248 
MET OXT  O  N N 249 
MET H    H  N N 250 
MET H2   H  N N 251 
MET HA   H  N N 252 
MET HB2  H  N N 253 
MET HB3  H  N N 254 
MET HG2  H  N N 255 
MET HG3  H  N N 256 
MET HE1  H  N N 257 
MET HE2  H  N N 258 
MET HE3  H  N N 259 
MET HXT  H  N N 260 
PHE N    N  N N 261 
PHE CA   C  N S 262 
PHE C    C  N N 263 
PHE O    O  N N 264 
PHE CB   C  N N 265 
PHE CG   C  Y N 266 
PHE CD1  C  Y N 267 
PHE CD2  C  Y N 268 
PHE CE1  C  Y N 269 
PHE CE2  C  Y N 270 
PHE CZ   C  Y N 271 
PHE OXT  O  N N 272 
PHE H    H  N N 273 
PHE H2   H  N N 274 
PHE HA   H  N N 275 
PHE HB2  H  N N 276 
PHE HB3  H  N N 277 
PHE HD1  H  N N 278 
PHE HD2  H  N N 279 
PHE HE1  H  N N 280 
PHE HE2  H  N N 281 
PHE HZ   H  N N 282 
PHE HXT  H  N N 283 
PRO N    N  N N 284 
PRO CA   C  N S 285 
PRO C    C  N N 286 
PRO O    O  N N 287 
PRO CB   C  N N 288 
PRO CG   C  N N 289 
PRO CD   C  N N 290 
PRO OXT  O  N N 291 
PRO H    H  N N 292 
PRO HA   H  N N 293 
PRO HB2  H  N N 294 
PRO HB3  H  N N 295 
PRO HG2  H  N N 296 
PRO HG3  H  N N 297 
PRO HD2  H  N N 298 
PRO HD3  H  N N 299 
PRO HXT  H  N N 300 
SER N    N  N N 301 
SER CA   C  N S 302 
SER C    C  N N 303 
SER O    O  N N 304 
SER CB   C  N N 305 
SER OG   O  N N 306 
SER OXT  O  N N 307 
SER H    H  N N 308 
SER H2   H  N N 309 
SER HA   H  N N 310 
SER HB2  H  N N 311 
SER HB3  H  N N 312 
SER HG   H  N N 313 
SER HXT  H  N N 314 
THR N    N  N N 315 
THR CA   C  N S 316 
THR C    C  N N 317 
THR O    O  N N 318 
THR CB   C  N R 319 
THR OG1  O  N N 320 
THR CG2  C  N N 321 
THR OXT  O  N N 322 
THR H    H  N N 323 
THR H2   H  N N 324 
THR HA   H  N N 325 
THR HB   H  N N 326 
THR HG1  H  N N 327 
THR HG21 H  N N 328 
THR HG22 H  N N 329 
THR HG23 H  N N 330 
THR HXT  H  N N 331 
TRP N    N  N N 332 
TRP CA   C  N S 333 
TRP C    C  N N 334 
TRP O    O  N N 335 
TRP CB   C  N N 336 
TRP CG   C  Y N 337 
TRP CD1  C  Y N 338 
TRP CD2  C  Y N 339 
TRP NE1  N  Y N 340 
TRP CE2  C  Y N 341 
TRP CE3  C  Y N 342 
TRP CZ2  C  Y N 343 
TRP CZ3  C  Y N 344 
TRP CH2  C  Y N 345 
TRP OXT  O  N N 346 
TRP H    H  N N 347 
TRP H2   H  N N 348 
TRP HA   H  N N 349 
TRP HB2  H  N N 350 
TRP HB3  H  N N 351 
TRP HD1  H  N N 352 
TRP HE1  H  N N 353 
TRP HE3  H  N N 354 
TRP HZ2  H  N N 355 
TRP HZ3  H  N N 356 
TRP HH2  H  N N 357 
TRP HXT  H  N N 358 
TYR N    N  N N 359 
TYR CA   C  N S 360 
TYR C    C  N N 361 
TYR O    O  N N 362 
TYR CB   C  N N 363 
TYR CG   C  Y N 364 
TYR CD1  C  Y N 365 
TYR CD2  C  Y N 366 
TYR CE1  C  Y N 367 
TYR CE2  C  Y N 368 
TYR CZ   C  Y N 369 
TYR OH   O  N N 370 
TYR OXT  O  N N 371 
TYR H    H  N N 372 
TYR H2   H  N N 373 
TYR HA   H  N N 374 
TYR HB2  H  N N 375 
TYR HB3  H  N N 376 
TYR HD1  H  N N 377 
TYR HD2  H  N N 378 
TYR HE1  H  N N 379 
TYR HE2  H  N N 380 
TYR HH   H  N N 381 
TYR HXT  H  N N 382 
VAL N    N  N N 383 
VAL CA   C  N S 384 
VAL C    C  N N 385 
VAL O    O  N N 386 
VAL CB   C  N N 387 
VAL CG1  C  N N 388 
VAL CG2  C  N N 389 
VAL OXT  O  N N 390 
VAL H    H  N N 391 
VAL H2   H  N N 392 
VAL HA   H  N N 393 
VAL HB   H  N N 394 
VAL HG11 H  N N 395 
VAL HG12 H  N N 396 
VAL HG13 H  N N 397 
VAL HG21 H  N N 398 
VAL HG22 H  N N 399 
VAL HG23 H  N N 400 
VAL HXT  H  N N 401 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CAC AS  O1   doub N N 70  
CAC AS  O2   sing N N 71  
CAC AS  C1   sing N N 72  
CAC AS  C2   sing N N 73  
CAC C1  H11  sing N N 74  
CAC C1  H12  sing N N 75  
CAC C1  H13  sing N N 76  
CAC C2  H21  sing N N 77  
CAC C2  H22  sing N N 78  
CAC C2  H23  sing N N 79  
CYS N   CA   sing N N 80  
CYS N   H    sing N N 81  
CYS N   H2   sing N N 82  
CYS CA  C    sing N N 83  
CYS CA  CB   sing N N 84  
CYS CA  HA   sing N N 85  
CYS C   O    doub N N 86  
CYS C   OXT  sing N N 87  
CYS CB  SG   sing N N 88  
CYS CB  HB2  sing N N 89  
CYS CB  HB3  sing N N 90  
CYS SG  HG   sing N N 91  
CYS OXT HXT  sing N N 92  
GLN N   CA   sing N N 93  
GLN N   H    sing N N 94  
GLN N   H2   sing N N 95  
GLN CA  C    sing N N 96  
GLN CA  CB   sing N N 97  
GLN CA  HA   sing N N 98  
GLN C   O    doub N N 99  
GLN C   OXT  sing N N 100 
GLN CB  CG   sing N N 101 
GLN CB  HB2  sing N N 102 
GLN CB  HB3  sing N N 103 
GLN CG  CD   sing N N 104 
GLN CG  HG2  sing N N 105 
GLN CG  HG3  sing N N 106 
GLN CD  OE1  doub N N 107 
GLN CD  NE2  sing N N 108 
GLN NE2 HE21 sing N N 109 
GLN NE2 HE22 sing N N 110 
GLN OXT HXT  sing N N 111 
GLU N   CA   sing N N 112 
GLU N   H    sing N N 113 
GLU N   H2   sing N N 114 
GLU CA  C    sing N N 115 
GLU CA  CB   sing N N 116 
GLU CA  HA   sing N N 117 
GLU C   O    doub N N 118 
GLU C   OXT  sing N N 119 
GLU CB  CG   sing N N 120 
GLU CB  HB2  sing N N 121 
GLU CB  HB3  sing N N 122 
GLU CG  CD   sing N N 123 
GLU CG  HG2  sing N N 124 
GLU CG  HG3  sing N N 125 
GLU CD  OE1  doub N N 126 
GLU CD  OE2  sing N N 127 
GLU OE2 HE2  sing N N 128 
GLU OXT HXT  sing N N 129 
GLY N   CA   sing N N 130 
GLY N   H    sing N N 131 
GLY N   H2   sing N N 132 
GLY CA  C    sing N N 133 
GLY CA  HA2  sing N N 134 
GLY CA  HA3  sing N N 135 
GLY C   O    doub N N 136 
GLY C   OXT  sing N N 137 
GLY OXT HXT  sing N N 138 
HIS N   CA   sing N N 139 
HIS N   H    sing N N 140 
HIS N   H2   sing N N 141 
HIS CA  C    sing N N 142 
HIS CA  CB   sing N N 143 
HIS CA  HA   sing N N 144 
HIS C   O    doub N N 145 
HIS C   OXT  sing N N 146 
HIS CB  CG   sing N N 147 
HIS CB  HB2  sing N N 148 
HIS CB  HB3  sing N N 149 
HIS CG  ND1  sing Y N 150 
HIS CG  CD2  doub Y N 151 
HIS ND1 CE1  doub Y N 152 
HIS ND1 HD1  sing N N 153 
HIS CD2 NE2  sing Y N 154 
HIS CD2 HD2  sing N N 155 
HIS CE1 NE2  sing Y N 156 
HIS CE1 HE1  sing N N 157 
HIS NE2 HE2  sing N N 158 
HIS OXT HXT  sing N N 159 
HOH O   H1   sing N N 160 
HOH O   H2   sing N N 161 
ILE N   CA   sing N N 162 
ILE N   H    sing N N 163 
ILE N   H2   sing N N 164 
ILE CA  C    sing N N 165 
ILE CA  CB   sing N N 166 
ILE CA  HA   sing N N 167 
ILE C   O    doub N N 168 
ILE C   OXT  sing N N 169 
ILE CB  CG1  sing N N 170 
ILE CB  CG2  sing N N 171 
ILE CB  HB   sing N N 172 
ILE CG1 CD1  sing N N 173 
ILE CG1 HG12 sing N N 174 
ILE CG1 HG13 sing N N 175 
ILE CG2 HG21 sing N N 176 
ILE CG2 HG22 sing N N 177 
ILE CG2 HG23 sing N N 178 
ILE CD1 HD11 sing N N 179 
ILE CD1 HD12 sing N N 180 
ILE CD1 HD13 sing N N 181 
ILE OXT HXT  sing N N 182 
LEU N   CA   sing N N 183 
LEU N   H    sing N N 184 
LEU N   H2   sing N N 185 
LEU CA  C    sing N N 186 
LEU CA  CB   sing N N 187 
LEU CA  HA   sing N N 188 
LEU C   O    doub N N 189 
LEU C   OXT  sing N N 190 
LEU CB  CG   sing N N 191 
LEU CB  HB2  sing N N 192 
LEU CB  HB3  sing N N 193 
LEU CG  CD1  sing N N 194 
LEU CG  CD2  sing N N 195 
LEU CG  HG   sing N N 196 
LEU CD1 HD11 sing N N 197 
LEU CD1 HD12 sing N N 198 
LEU CD1 HD13 sing N N 199 
LEU CD2 HD21 sing N N 200 
LEU CD2 HD22 sing N N 201 
LEU CD2 HD23 sing N N 202 
LEU OXT HXT  sing N N 203 
LYS N   CA   sing N N 204 
LYS N   H    sing N N 205 
LYS N   H2   sing N N 206 
LYS CA  C    sing N N 207 
LYS CA  CB   sing N N 208 
LYS CA  HA   sing N N 209 
LYS C   O    doub N N 210 
LYS C   OXT  sing N N 211 
LYS CB  CG   sing N N 212 
LYS CB  HB2  sing N N 213 
LYS CB  HB3  sing N N 214 
LYS CG  CD   sing N N 215 
LYS CG  HG2  sing N N 216 
LYS CG  HG3  sing N N 217 
LYS CD  CE   sing N N 218 
LYS CD  HD2  sing N N 219 
LYS CD  HD3  sing N N 220 
LYS CE  NZ   sing N N 221 
LYS CE  HE2  sing N N 222 
LYS CE  HE3  sing N N 223 
LYS NZ  HZ1  sing N N 224 
LYS NZ  HZ2  sing N N 225 
LYS NZ  HZ3  sing N N 226 
LYS OXT HXT  sing N N 227 
MET N   CA   sing N N 228 
MET N   H    sing N N 229 
MET N   H2   sing N N 230 
MET CA  C    sing N N 231 
MET CA  CB   sing N N 232 
MET CA  HA   sing N N 233 
MET C   O    doub N N 234 
MET C   OXT  sing N N 235 
MET CB  CG   sing N N 236 
MET CB  HB2  sing N N 237 
MET CB  HB3  sing N N 238 
MET CG  SD   sing N N 239 
MET CG  HG2  sing N N 240 
MET CG  HG3  sing N N 241 
MET SD  CE   sing N N 242 
MET CE  HE1  sing N N 243 
MET CE  HE2  sing N N 244 
MET CE  HE3  sing N N 245 
MET OXT HXT  sing N N 246 
PHE N   CA   sing N N 247 
PHE N   H    sing N N 248 
PHE N   H2   sing N N 249 
PHE CA  C    sing N N 250 
PHE CA  CB   sing N N 251 
PHE CA  HA   sing N N 252 
PHE C   O    doub N N 253 
PHE C   OXT  sing N N 254 
PHE CB  CG   sing N N 255 
PHE CB  HB2  sing N N 256 
PHE CB  HB3  sing N N 257 
PHE CG  CD1  doub Y N 258 
PHE CG  CD2  sing Y N 259 
PHE CD1 CE1  sing Y N 260 
PHE CD1 HD1  sing N N 261 
PHE CD2 CE2  doub Y N 262 
PHE CD2 HD2  sing N N 263 
PHE CE1 CZ   doub Y N 264 
PHE CE1 HE1  sing N N 265 
PHE CE2 CZ   sing Y N 266 
PHE CE2 HE2  sing N N 267 
PHE CZ  HZ   sing N N 268 
PHE OXT HXT  sing N N 269 
PRO N   CA   sing N N 270 
PRO N   CD   sing N N 271 
PRO N   H    sing N N 272 
PRO CA  C    sing N N 273 
PRO CA  CB   sing N N 274 
PRO CA  HA   sing N N 275 
PRO C   O    doub N N 276 
PRO C   OXT  sing N N 277 
PRO CB  CG   sing N N 278 
PRO CB  HB2  sing N N 279 
PRO CB  HB3  sing N N 280 
PRO CG  CD   sing N N 281 
PRO CG  HG2  sing N N 282 
PRO CG  HG3  sing N N 283 
PRO CD  HD2  sing N N 284 
PRO CD  HD3  sing N N 285 
PRO OXT HXT  sing N N 286 
SER N   CA   sing N N 287 
SER N   H    sing N N 288 
SER N   H2   sing N N 289 
SER CA  C    sing N N 290 
SER CA  CB   sing N N 291 
SER CA  HA   sing N N 292 
SER C   O    doub N N 293 
SER C   OXT  sing N N 294 
SER CB  OG   sing N N 295 
SER CB  HB2  sing N N 296 
SER CB  HB3  sing N N 297 
SER OG  HG   sing N N 298 
SER OXT HXT  sing N N 299 
THR N   CA   sing N N 300 
THR N   H    sing N N 301 
THR N   H2   sing N N 302 
THR CA  C    sing N N 303 
THR CA  CB   sing N N 304 
THR CA  HA   sing N N 305 
THR C   O    doub N N 306 
THR C   OXT  sing N N 307 
THR CB  OG1  sing N N 308 
THR CB  CG2  sing N N 309 
THR CB  HB   sing N N 310 
THR OG1 HG1  sing N N 311 
THR CG2 HG21 sing N N 312 
THR CG2 HG22 sing N N 313 
THR CG2 HG23 sing N N 314 
THR OXT HXT  sing N N 315 
TRP N   CA   sing N N 316 
TRP N   H    sing N N 317 
TRP N   H2   sing N N 318 
TRP CA  C    sing N N 319 
TRP CA  CB   sing N N 320 
TRP CA  HA   sing N N 321 
TRP C   O    doub N N 322 
TRP C   OXT  sing N N 323 
TRP CB  CG   sing N N 324 
TRP CB  HB2  sing N N 325 
TRP CB  HB3  sing N N 326 
TRP CG  CD1  doub Y N 327 
TRP CG  CD2  sing Y N 328 
TRP CD1 NE1  sing Y N 329 
TRP CD1 HD1  sing N N 330 
TRP CD2 CE2  doub Y N 331 
TRP CD2 CE3  sing Y N 332 
TRP NE1 CE2  sing Y N 333 
TRP NE1 HE1  sing N N 334 
TRP CE2 CZ2  sing Y N 335 
TRP CE3 CZ3  doub Y N 336 
TRP CE3 HE3  sing N N 337 
TRP CZ2 CH2  doub Y N 338 
TRP CZ2 HZ2  sing N N 339 
TRP CZ3 CH2  sing Y N 340 
TRP CZ3 HZ3  sing N N 341 
TRP CH2 HH2  sing N N 342 
TRP OXT HXT  sing N N 343 
TYR N   CA   sing N N 344 
TYR N   H    sing N N 345 
TYR N   H2   sing N N 346 
TYR CA  C    sing N N 347 
TYR CA  CB   sing N N 348 
TYR CA  HA   sing N N 349 
TYR C   O    doub N N 350 
TYR C   OXT  sing N N 351 
TYR CB  CG   sing N N 352 
TYR CB  HB2  sing N N 353 
TYR CB  HB3  sing N N 354 
TYR CG  CD1  doub Y N 355 
TYR CG  CD2  sing Y N 356 
TYR CD1 CE1  sing Y N 357 
TYR CD1 HD1  sing N N 358 
TYR CD2 CE2  doub Y N 359 
TYR CD2 HD2  sing N N 360 
TYR CE1 CZ   doub Y N 361 
TYR CE1 HE1  sing N N 362 
TYR CE2 CZ   sing Y N 363 
TYR CE2 HE2  sing N N 364 
TYR CZ  OH   sing N N 365 
TYR OH  HH   sing N N 366 
TYR OXT HXT  sing N N 367 
VAL N   CA   sing N N 368 
VAL N   H    sing N N 369 
VAL N   H2   sing N N 370 
VAL CA  C    sing N N 371 
VAL CA  CB   sing N N 372 
VAL CA  HA   sing N N 373 
VAL C   O    doub N N 374 
VAL C   OXT  sing N N 375 
VAL CB  CG1  sing N N 376 
VAL CB  CG2  sing N N 377 
VAL CB  HB   sing N N 378 
VAL CG1 HG11 sing N N 379 
VAL CG1 HG12 sing N N 380 
VAL CG1 HG13 sing N N 381 
VAL CG2 HG21 sing N N 382 
VAL CG2 HG22 sing N N 383 
VAL CG2 HG23 sing N N 384 
VAL OXT HXT  sing N N 385 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CACODYLATE ION' CAC 
3 water            HOH 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   1ITG 
_pdbx_initial_refinement_model.details          ? 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#