data_6JDA # _entry.id 6JDA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6JDA pdb_00006jda 10.2210/pdb6jda/pdb WWPDB D_1300010709 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6JDA _pdbx_database_status.recvd_initial_deposition_date 2019-01-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Thanuja, G.' 1 0000-0002-3162-8138 'Ramaswamy, S.' 2 0000-0002-6709-190X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Omega' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2470-1343 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 5 _citation.language ? _citation.page_first 30923 _citation.page_last 30926 _citation.title 'Structure and Function of N‐Acetylmannosamine Kinases from Pathogenic Bacteria.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsomega.0c03699 _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Thanuja, G.' 1 0000-0002-3162-8138 primary 'Ramaswamy, S.' 2 0000-0002-6709-190X # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6JDA _cell.details ? _cell.formula_units_Z ? _cell.length_a 103.816 _cell.length_a_esd ? _cell.length_b 173.732 _cell.length_b_esd ? _cell.length_c 48.060 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6JDA _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'N-acetylmannosamine kinase' 30689.037 1 2.7.1.60 ? ? 'ROK kinase' 2 non-polymer man 2-acetamido-2-deoxy-alpha-D-mannopyranose 221.208 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 7 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ManNAc kinase,N-acetyl-D-mannosamine kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRCLALDIGGTKIASAIVTDGKIEQRQQIATPQADAANAMHDTLANILALYAGQFDYVAVASTGIINHGVLTALNPKNLG GLAEFPLKESIARHTDKPIGLLNDVQAAACAEYKDEDKNAVQNFVFITVSTGVGGGIILERRLLTEPNGVAGHIGHTLAD PNGPVCGCGRVGCVEAVAAGRAIEAVSSQWNPPCTPKQAFELFRKNDEKATALIQRSASAIANLIADLVIGLDVQKVVVG GSVGLAEGYLPLVKQYLNTMPHFYHCTVEQARHGQDAGLLGAAWWVADCLK ; _entity_poly.pdbx_seq_one_letter_code_can ;MRCLALDIGGTKIASAIVTDGKIEQRQQIATPQADAANAMHDTLANILALYAGQFDYVAVASTGIINHGVLTALNPKNLG GLAEFPLKESIARHTDKPIGLLNDVQAAACAEYKDEDKNAVQNFVFITVSTGVGGGIILERRLLTEPNGVAGHIGHTLAD PNGPVCGCGRVGCVEAVAAGRAIEAVSSQWNPPCTPKQAFELFRKNDEKATALIQRSASAIANLIADLVIGLDVQKVVVG GSVGLAEGYLPLVKQYLNTMPHFYHCTVEQARHGQDAGLLGAAWWVADCLK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 CYS n 1 4 LEU n 1 5 ALA n 1 6 LEU n 1 7 ASP n 1 8 ILE n 1 9 GLY n 1 10 GLY n 1 11 THR n 1 12 LYS n 1 13 ILE n 1 14 ALA n 1 15 SER n 1 16 ALA n 1 17 ILE n 1 18 VAL n 1 19 THR n 1 20 ASP n 1 21 GLY n 1 22 LYS n 1 23 ILE n 1 24 GLU n 1 25 GLN n 1 26 ARG n 1 27 GLN n 1 28 GLN n 1 29 ILE n 1 30 ALA n 1 31 THR n 1 32 PRO n 1 33 GLN n 1 34 ALA n 1 35 ASP n 1 36 ALA n 1 37 ALA n 1 38 ASN n 1 39 ALA n 1 40 MET n 1 41 HIS n 1 42 ASP n 1 43 THR n 1 44 LEU n 1 45 ALA n 1 46 ASN n 1 47 ILE n 1 48 LEU n 1 49 ALA n 1 50 LEU n 1 51 TYR n 1 52 ALA n 1 53 GLY n 1 54 GLN n 1 55 PHE n 1 56 ASP n 1 57 TYR n 1 58 VAL n 1 59 ALA n 1 60 VAL n 1 61 ALA n 1 62 SER n 1 63 THR n 1 64 GLY n 1 65 ILE n 1 66 ILE n 1 67 ASN n 1 68 HIS n 1 69 GLY n 1 70 VAL n 1 71 LEU n 1 72 THR n 1 73 ALA n 1 74 LEU n 1 75 ASN n 1 76 PRO n 1 77 LYS n 1 78 ASN n 1 79 LEU n 1 80 GLY n 1 81 GLY n 1 82 LEU n 1 83 ALA n 1 84 GLU n 1 85 PHE n 1 86 PRO n 1 87 LEU n 1 88 LYS n 1 89 GLU n 1 90 SER n 1 91 ILE n 1 92 ALA n 1 93 ARG n 1 94 HIS n 1 95 THR n 1 96 ASP n 1 97 LYS n 1 98 PRO n 1 99 ILE n 1 100 GLY n 1 101 LEU n 1 102 LEU n 1 103 ASN n 1 104 ASP n 1 105 VAL n 1 106 GLN n 1 107 ALA n 1 108 ALA n 1 109 ALA n 1 110 CYS n 1 111 ALA n 1 112 GLU n 1 113 TYR n 1 114 LYS n 1 115 ASP n 1 116 GLU n 1 117 ASP n 1 118 LYS n 1 119 ASN n 1 120 ALA n 1 121 VAL n 1 122 GLN n 1 123 ASN n 1 124 PHE n 1 125 VAL n 1 126 PHE n 1 127 ILE n 1 128 THR n 1 129 VAL n 1 130 SER n 1 131 THR n 1 132 GLY n 1 133 VAL n 1 134 GLY n 1 135 GLY n 1 136 GLY n 1 137 ILE n 1 138 ILE n 1 139 LEU n 1 140 GLU n 1 141 ARG n 1 142 ARG n 1 143 LEU n 1 144 LEU n 1 145 THR n 1 146 GLU n 1 147 PRO n 1 148 ASN n 1 149 GLY n 1 150 VAL n 1 151 ALA n 1 152 GLY n 1 153 HIS n 1 154 ILE n 1 155 GLY n 1 156 HIS n 1 157 THR n 1 158 LEU n 1 159 ALA n 1 160 ASP n 1 161 PRO n 1 162 ASN n 1 163 GLY n 1 164 PRO n 1 165 VAL n 1 166 CYS n 1 167 GLY n 1 168 CYS n 1 169 GLY n 1 170 ARG n 1 171 VAL n 1 172 GLY n 1 173 CYS n 1 174 VAL n 1 175 GLU n 1 176 ALA n 1 177 VAL n 1 178 ALA n 1 179 ALA n 1 180 GLY n 1 181 ARG n 1 182 ALA n 1 183 ILE n 1 184 GLU n 1 185 ALA n 1 186 VAL n 1 187 SER n 1 188 SER n 1 189 GLN n 1 190 TRP n 1 191 ASN n 1 192 PRO n 1 193 PRO n 1 194 CYS n 1 195 THR n 1 196 PRO n 1 197 LYS n 1 198 GLN n 1 199 ALA n 1 200 PHE n 1 201 GLU n 1 202 LEU n 1 203 PHE n 1 204 ARG n 1 205 LYS n 1 206 ASN n 1 207 ASP n 1 208 GLU n 1 209 LYS n 1 210 ALA n 1 211 THR n 1 212 ALA n 1 213 LEU n 1 214 ILE n 1 215 GLN n 1 216 ARG n 1 217 SER n 1 218 ALA n 1 219 SER n 1 220 ALA n 1 221 ILE n 1 222 ALA n 1 223 ASN n 1 224 LEU n 1 225 ILE n 1 226 ALA n 1 227 ASP n 1 228 LEU n 1 229 VAL n 1 230 ILE n 1 231 GLY n 1 232 LEU n 1 233 ASP n 1 234 VAL n 1 235 GLN n 1 236 LYS n 1 237 VAL n 1 238 VAL n 1 239 VAL n 1 240 GLY n 1 241 GLY n 1 242 SER n 1 243 VAL n 1 244 GLY n 1 245 LEU n 1 246 ALA n 1 247 GLU n 1 248 GLY n 1 249 TYR n 1 250 LEU n 1 251 PRO n 1 252 LEU n 1 253 VAL n 1 254 LYS n 1 255 GLN n 1 256 TYR n 1 257 LEU n 1 258 ASN n 1 259 THR n 1 260 MET n 1 261 PRO n 1 262 HIS n 1 263 PHE n 1 264 TYR n 1 265 HIS n 1 266 CYS n 1 267 THR n 1 268 VAL n 1 269 GLU n 1 270 GLN n 1 271 ALA n 1 272 ARG n 1 273 HIS n 1 274 GLY n 1 275 GLN n 1 276 ASP n 1 277 ALA n 1 278 GLY n 1 279 LEU n 1 280 LEU n 1 281 GLY n 1 282 ALA n 1 283 ALA n 1 284 TRP n 1 285 TRP n 1 286 VAL n 1 287 ALA n 1 288 ASP n 1 289 CYS n 1 290 LEU n 1 291 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 291 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene nanK _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pasteurella multocida' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 747 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A2K0XYW4_PASMD _struct_ref.pdbx_db_accession A0A2K0XYW4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRCLALDIGGTKIASAIVTDGKIEQRQQIATPQADAANAMHDTLANILALYAGQFDYVAVASTGIINHGVLTALNPKNLG GLAEFPLKESIARHTDKPIGLLNDVQAAACAEYKDEDKNAVQNFVFITVSTGVGGGIILERRLLTEPNGVAGHIGHTLAD PNGPVCGCGRVGCVEAVAAGRAIEAVSSQWNPPCTPKQAFELFRKNDEKATALIQRSASAIANLIADLVIGLDVQKVVVG GSVGLAEGYLPLVKQYLNTMPHFYHCTVEQARHGQDAGLLGAAWWVADCLK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6JDA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 291 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A2K0XYW4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 291 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 291 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BM3 'D-saccharide, alpha linking' . 2-acetamido-2-deoxy-alpha-D-mannopyranose ;N-acetyl-alpha-D-mannosamine; 2-acetamido-2-deoxy-alpha-D-mannose; 2-acetamido-2-deoxy-D-mannose; 2-acetamido-2-deoxy-mannose; 2-(ACETYLAMINO)-2-DEOXY-ALPHA-D-MANNOPYRANOSE ; 'C8 H15 N O6' 221.208 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6JDA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.53 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 65.20 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M lithium citrate tribasic tetrahydrate, 20%(w/v) PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-07-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97857 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97857 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 1' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6JDA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.900 _reflns.d_resolution_low 48.060 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9983 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.200 _reflns.pdbx_Rmerge_I_obs 0.085 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 28 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.094 _reflns.pdbx_Rpim_I_all 0.038 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 62338 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.900 _reflns_shell.d_res_low 3.080 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 9925 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1573 _reflns_shell.percent_possible_all 99.800 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.447 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.300 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 3.700 _reflns_shell.pdbx_Rrim_I_all 0.489 _reflns_shell.pdbx_Rpim_I_all 0.196 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.881 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 137.530 _refine.B_iso_mean 63.5832 _refine.B_iso_min 29.410 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6JDA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.9000 _refine.ls_d_res_low 44.5590 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9970 _refine.ls_number_reflns_R_free 471 _refine.ls_number_reflns_R_work 9499 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.3000 _refine.ls_percent_reflns_R_free 4.7200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1966 _refine.ls_R_factor_R_free 0.2472 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1939 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2aa4 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.8500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.9000 _refine_hist.d_res_low 44.5590 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 2182 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 291 _refine_hist.pdbx_B_iso_mean_ligand 57.68 _refine_hist.pdbx_B_iso_mean_solvent 50.56 _refine_hist.pdbx_number_atoms_protein 2153 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.9002 3.3197 3262 . 131 3131 100.0000 . . . 0.3963 0.0000 0.2770 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.3197 4.1820 3304 . 167 3137 100.0000 . . . 0.2661 0.0000 0.2022 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 4.1820 44.5638 3404 . 173 3231 98.0000 . . . 0.2057 0.0000 0.1671 . . . . . . 3 . . . # _struct.entry_id 6JDA _struct.title 'Crystal structure of N-acetyl mannosmaine kinase in complex with N-acetylmannosamine in Pasteurella multocida' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6JDA _struct_keywords.text 'Kinase, ManNAc binding protein, two domain protein, SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 35 ? TYR A 51 ? ASP A 35 TYR A 51 1 ? 17 HELX_P HELX_P2 AA2 ASN A 75 ? GLY A 80 ? ASN A 75 GLY A 80 5 ? 6 HELX_P HELX_P3 AA3 PRO A 86 ? ALA A 92 ? PRO A 86 ALA A 92 1 ? 7 HELX_P HELX_P4 AA4 ASP A 104 ? LYS A 114 ? ASP A 104 LYS A 114 1 ? 11 HELX_P HELX_P5 AA5 HIS A 153 ? THR A 157 ? HIS A 153 THR A 157 5 ? 5 HELX_P HELX_P6 AA6 CYS A 173 ? ALA A 179 ? CYS A 173 ALA A 179 1 ? 7 HELX_P HELX_P7 AA7 ALA A 179 ? SER A 188 ? ALA A 179 SER A 188 1 ? 10 HELX_P HELX_P8 AA8 THR A 195 ? LYS A 205 ? THR A 195 LYS A 205 1 ? 11 HELX_P HELX_P9 AA9 ASP A 207 ? ASP A 233 ? ASP A 207 ASP A 233 1 ? 27 HELX_P HELX_P10 AB1 GLY A 241 ? LEU A 245 ? GLY A 241 LEU A 245 1 ? 5 HELX_P HELX_P11 AB2 GLY A 248 ? THR A 259 ? GLY A 248 THR A 259 1 ? 12 HELX_P HELX_P12 AB3 PRO A 261 ? HIS A 265 ? PRO A 261 HIS A 265 5 ? 5 HELX_P HELX_P13 AB4 HIS A 273 ? GLN A 275 ? HIS A 273 GLN A 275 5 ? 3 HELX_P HELX_P14 AB5 ASP A 276 ? ASP A 288 ? ASP A 276 ASP A 288 1 ? 13 HELX_P HELX_P15 AB6 CYS A 289 ? LYS A 291 ? CYS A 289 LYS A 291 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 156 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 156 A ZN 302 1_555 ? ? ? ? ? ? ? 1.972 ? ? metalc2 metalc ? ? A CYS 166 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 166 A ZN 302 1_555 ? ? ? ? ? ? ? 2.522 ? ? metalc3 metalc ? ? A CYS 168 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 168 A ZN 302 1_555 ? ? ? ? ? ? ? 2.495 ? ? metalc4 metalc ? ? A CYS 173 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 173 A ZN 302 1_555 ? ? ? ? ? ? ? 2.451 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 146 A . ? GLU 146 A PRO 147 A ? PRO 147 A 1 -7.53 2 ASN 191 A . ? ASN 191 A PRO 192 A ? PRO 192 A 1 3.73 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? parallel AA3 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 22 ? ALA A 30 ? LYS A 22 ALA A 30 AA1 2 LYS A 12 ? THR A 19 ? LYS A 12 THR A 19 AA1 3 CYS A 3 ? ILE A 8 ? CYS A 3 ILE A 8 AA1 4 TYR A 57 ? SER A 62 ? TYR A 57 SER A 62 AA1 5 ILE A 99 ? ASN A 103 ? ILE A 99 ASN A 103 AA2 1 ILE A 65 ? ASN A 67 ? ILE A 65 ASN A 67 AA2 2 VAL A 70 ? THR A 72 ? VAL A 70 THR A 72 AA2 3 GLU A 84 ? PHE A 85 ? GLU A 84 PHE A 85 AA3 1 VAL A 133 ? LEU A 139 ? VAL A 133 LEU A 139 AA3 2 ASN A 123 ? VAL A 129 ? ASN A 123 VAL A 129 AA3 3 LYS A 236 ? GLY A 240 ? LYS A 236 GLY A 240 AA3 4 THR A 267 ? GLN A 270 ? THR A 267 GLN A 270 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 24 ? O GLU A 24 N ILE A 17 ? N ILE A 17 AA1 2 3 O VAL A 18 ? O VAL A 18 N CYS A 3 ? N CYS A 3 AA1 3 4 N LEU A 4 ? N LEU A 4 O ALA A 59 ? O ALA A 59 AA1 4 5 N VAL A 60 ? N VAL A 60 O GLY A 100 ? O GLY A 100 AA2 1 2 N ILE A 65 ? N ILE A 65 O THR A 72 ? O THR A 72 AA2 2 3 N LEU A 71 ? N LEU A 71 O PHE A 85 ? O PHE A 85 AA3 1 2 O ILE A 138 ? O ILE A 138 N PHE A 124 ? N PHE A 124 AA3 2 3 N ILE A 127 ? N ILE A 127 O VAL A 238 ? O VAL A 238 AA3 3 4 N VAL A 239 ? N VAL A 239 O GLU A 269 ? O GLU A 269 # _atom_sites.entry_id 6JDA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009632 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005756 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020807 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 CYS 110 110 110 CYS CYS A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 HIS 153 153 153 HIS HIS A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 HIS 156 156 156 HIS HIS A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 PRO 161 161 161 PRO PRO A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 CYS 166 166 166 CYS CYS A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 CYS 168 168 168 CYS CYS A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 CYS 173 173 173 CYS CYS A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 GLN 189 189 189 GLN GLN A . n A 1 190 TRP 190 190 190 TRP TRP A . n A 1 191 ASN 191 191 191 ASN ASN A . n A 1 192 PRO 192 192 192 PRO PRO A . n A 1 193 PRO 193 193 193 PRO PRO A . n A 1 194 CYS 194 194 194 CYS CYS A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 PRO 196 196 196 PRO PRO A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 GLN 198 198 198 GLN GLN A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 PHE 200 200 200 PHE PHE A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 PHE 203 203 203 PHE PHE A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 LYS 205 205 205 LYS LYS A . n A 1 206 ASN 206 206 206 ASN ASN A . n A 1 207 ASP 207 207 207 ASP ASP A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 THR 211 211 211 THR THR A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 ILE 214 214 214 ILE ILE A . n A 1 215 GLN 215 215 215 GLN GLN A . n A 1 216 ARG 216 216 216 ARG ARG A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 SER 219 219 219 SER SER A . n A 1 220 ALA 220 220 220 ALA ALA A . n A 1 221 ILE 221 221 221 ILE ILE A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 ASN 223 223 223 ASN ASN A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 VAL 229 229 229 VAL VAL A . n A 1 230 ILE 230 230 230 ILE ILE A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 ASP 233 233 233 ASP ASP A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 GLN 235 235 235 GLN GLN A . n A 1 236 LYS 236 236 236 LYS LYS A . n A 1 237 VAL 237 237 237 VAL VAL A . n A 1 238 VAL 238 238 238 VAL VAL A . n A 1 239 VAL 239 239 239 VAL VAL A . n A 1 240 GLY 240 240 240 GLY GLY A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 SER 242 242 242 SER SER A . n A 1 243 VAL 243 243 243 VAL VAL A . n A 1 244 GLY 244 244 244 GLY GLY A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 ALA 246 246 246 ALA ALA A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 GLY 248 248 248 GLY GLY A . n A 1 249 TYR 249 249 249 TYR TYR A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 PRO 251 251 251 PRO PRO A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 VAL 253 253 253 VAL VAL A . n A 1 254 LYS 254 254 254 LYS LYS A . n A 1 255 GLN 255 255 255 GLN GLN A . n A 1 256 TYR 256 256 256 TYR TYR A . n A 1 257 LEU 257 257 257 LEU LEU A . n A 1 258 ASN 258 258 258 ASN ASN A . n A 1 259 THR 259 259 259 THR THR A . n A 1 260 MET 260 260 260 MET MET A . n A 1 261 PRO 261 261 261 PRO PRO A . n A 1 262 HIS 262 262 262 HIS HIS A . n A 1 263 PHE 263 263 263 PHE PHE A . n A 1 264 TYR 264 264 264 TYR TYR A . n A 1 265 HIS 265 265 265 HIS HIS A . n A 1 266 CYS 266 266 266 CYS CYS A . n A 1 267 THR 267 267 267 THR THR A . n A 1 268 VAL 268 268 268 VAL VAL A . n A 1 269 GLU 269 269 269 GLU GLU A . n A 1 270 GLN 270 270 270 GLN GLN A . n A 1 271 ALA 271 271 271 ALA ALA A . n A 1 272 ARG 272 272 272 ARG ARG A . n A 1 273 HIS 273 273 273 HIS HIS A . n A 1 274 GLY 274 274 274 GLY GLY A . n A 1 275 GLN 275 275 275 GLN GLN A . n A 1 276 ASP 276 276 276 ASP ASP A . n A 1 277 ALA 277 277 277 ALA ALA A . n A 1 278 GLY 278 278 278 GLY GLY A . n A 1 279 LEU 279 279 279 LEU LEU A . n A 1 280 LEU 280 280 280 LEU LEU A . n A 1 281 GLY 281 281 281 GLY GLY A . n A 1 282 ALA 282 282 282 ALA ALA A . n A 1 283 ALA 283 283 283 ALA ALA A . n A 1 284 TRP 284 284 284 TRP TRP A . n A 1 285 TRP 285 285 285 TRP TRP A . n A 1 286 VAL 286 286 286 VAL VAL A . n A 1 287 ALA 287 287 287 ALA ALA A . n A 1 288 ASP 288 288 288 ASP ASP A . n A 1 289 CYS 289 289 289 CYS CYS A . n A 1 290 LEU 290 290 290 LEU LEU A . n A 1 291 LYS 291 291 291 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BM3 1 301 301 BM3 BM3 A . C 3 ZN 1 302 1 ZN ZN A . D 4 GOL 1 303 301 GOL GOL A . E 5 HOH 1 401 3 HOH HOH A . E 5 HOH 2 402 1 HOH HOH A . E 5 HOH 3 403 4 HOH HOH A . E 5 HOH 4 404 7 HOH HOH A . E 5 HOH 5 405 2 HOH HOH A . E 5 HOH 6 406 6 HOH HOH A . E 5 HOH 7 407 5 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4910 ? 1 MORE -21 ? 1 'SSA (A^2)' 23140 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_555 -x,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 24.0300000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 156 ? A HIS 156 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 SG ? A CYS 166 ? A CYS 166 ? 1_555 101.6 ? 2 ND1 ? A HIS 156 ? A HIS 156 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 SG ? A CYS 168 ? A CYS 168 ? 1_555 114.1 ? 3 SG ? A CYS 166 ? A CYS 166 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 SG ? A CYS 168 ? A CYS 168 ? 1_555 111.0 ? 4 ND1 ? A HIS 156 ? A HIS 156 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 SG ? A CYS 173 ? A CYS 173 ? 1_555 116.6 ? 5 SG ? A CYS 166 ? A CYS 166 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 SG ? A CYS 173 ? A CYS 173 ? 1_555 110.2 ? 6 SG ? A CYS 168 ? A CYS 168 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 SG ? A CYS 173 ? A CYS 173 ? 1_555 103.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-02-05 2 'Structure model' 1 1 2020-07-29 3 'Structure model' 1 2 2020-12-16 4 'Structure model' 1 3 2023-11-22 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Structure summary' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Structure summary' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp 2 2 'Structure model' entity 3 2 'Structure model' pdbx_chem_comp_identifier 4 2 'Structure model' pdbx_entity_nonpoly 5 2 'Structure model' struct_site 6 2 'Structure model' struct_site_gen 7 3 'Structure model' chem_comp 8 3 'Structure model' citation 9 4 'Structure model' chem_comp_atom 10 4 'Structure model' chem_comp_bond 11 4 'Structure model' database_2 12 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_chem_comp.name' 2 2 'Structure model' '_entity.pdbx_description' 3 2 'Structure model' '_pdbx_entity_nonpoly.name' 4 3 'Structure model' '_chem_comp.pdbx_synonyms' 5 3 'Structure model' '_citation.country' 6 3 'Structure model' '_citation.journal_abbrev' 7 3 'Structure model' '_citation.journal_id_CSD' 8 3 'Structure model' '_citation.journal_id_ISSN' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 3 'Structure model' '_citation.pdbx_database_id_DOI' 13 3 'Structure model' '_citation.title' 14 3 'Structure model' '_citation.year' 15 4 'Structure model' '_database_2.pdbx_DOI' 16 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.14_3211: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.2 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 6JDA _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 79 ? ? -144.64 34.37 2 1 THR A 95 ? ? -171.81 143.04 3 1 LEU A 102 ? ? -170.10 143.66 4 1 ASP A 117 ? ? -49.69 91.18 5 1 LYS A 118 ? ? -64.18 4.94 6 1 SER A 130 ? ? -130.16 -134.04 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 96 ? CB ? A ASP 96 CB 2 1 Y 1 A ASP 96 ? CG ? A ASP 96 CG 3 1 Y 1 A ASP 96 ? OD1 ? A ASP 96 OD1 4 1 Y 1 A ASP 96 ? OD2 ? A ASP 96 OD2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BM3 C1 C N S 74 BM3 O1 O N N 75 BM3 C2 C N S 76 BM3 N2 N N N 77 BM3 C7 C N N 78 BM3 O7 O N N 79 BM3 C8 C N N 80 BM3 C3 C N R 81 BM3 O3 O N N 82 BM3 C4 C N S 83 BM3 O4 O N N 84 BM3 C5 C N R 85 BM3 C6 C N N 86 BM3 O6 O N N 87 BM3 O5 O N N 88 BM3 H1 H N N 89 BM3 HO1 H N N 90 BM3 H2 H N N 91 BM3 HN2 H N N 92 BM3 H3 H N N 93 BM3 H81 H N N 94 BM3 H82 H N N 95 BM3 H83 H N N 96 BM3 HO3 H N N 97 BM3 H4 H N N 98 BM3 HO4 H N N 99 BM3 H5 H N N 100 BM3 H61 H N N 101 BM3 H62 H N N 102 BM3 HO6 H N N 103 CYS N N N N 104 CYS CA C N R 105 CYS C C N N 106 CYS O O N N 107 CYS CB C N N 108 CYS SG S N N 109 CYS OXT O N N 110 CYS H H N N 111 CYS H2 H N N 112 CYS HA H N N 113 CYS HB2 H N N 114 CYS HB3 H N N 115 CYS HG H N N 116 CYS HXT H N N 117 GLN N N N N 118 GLN CA C N S 119 GLN C C N N 120 GLN O O N N 121 GLN CB C N N 122 GLN CG C N N 123 GLN CD C N N 124 GLN OE1 O N N 125 GLN NE2 N N N 126 GLN OXT O N N 127 GLN H H N N 128 GLN H2 H N N 129 GLN HA H N N 130 GLN HB2 H N N 131 GLN HB3 H N N 132 GLN HG2 H N N 133 GLN HG3 H N N 134 GLN HE21 H N N 135 GLN HE22 H N N 136 GLN HXT H N N 137 GLU N N N N 138 GLU CA C N S 139 GLU C C N N 140 GLU O O N N 141 GLU CB C N N 142 GLU CG C N N 143 GLU CD C N N 144 GLU OE1 O N N 145 GLU OE2 O N N 146 GLU OXT O N N 147 GLU H H N N 148 GLU H2 H N N 149 GLU HA H N N 150 GLU HB2 H N N 151 GLU HB3 H N N 152 GLU HG2 H N N 153 GLU HG3 H N N 154 GLU HE2 H N N 155 GLU HXT H N N 156 GLY N N N N 157 GLY CA C N N 158 GLY C C N N 159 GLY O O N N 160 GLY OXT O N N 161 GLY H H N N 162 GLY H2 H N N 163 GLY HA2 H N N 164 GLY HA3 H N N 165 GLY HXT H N N 166 GOL C1 C N N 167 GOL O1 O N N 168 GOL C2 C N N 169 GOL O2 O N N 170 GOL C3 C N N 171 GOL O3 O N N 172 GOL H11 H N N 173 GOL H12 H N N 174 GOL HO1 H N N 175 GOL H2 H N N 176 GOL HO2 H N N 177 GOL H31 H N N 178 GOL H32 H N N 179 GOL HO3 H N N 180 HIS N N N N 181 HIS CA C N S 182 HIS C C N N 183 HIS O O N N 184 HIS CB C N N 185 HIS CG C Y N 186 HIS ND1 N Y N 187 HIS CD2 C Y N 188 HIS CE1 C Y N 189 HIS NE2 N Y N 190 HIS OXT O N N 191 HIS H H N N 192 HIS H2 H N N 193 HIS HA H N N 194 HIS HB2 H N N 195 HIS HB3 H N N 196 HIS HD1 H N N 197 HIS HD2 H N N 198 HIS HE1 H N N 199 HIS HE2 H N N 200 HIS HXT H N N 201 HOH O O N N 202 HOH H1 H N N 203 HOH H2 H N N 204 ILE N N N N 205 ILE CA C N S 206 ILE C C N N 207 ILE O O N N 208 ILE CB C N S 209 ILE CG1 C N N 210 ILE CG2 C N N 211 ILE CD1 C N N 212 ILE OXT O N N 213 ILE H H N N 214 ILE H2 H N N 215 ILE HA H N N 216 ILE HB H N N 217 ILE HG12 H N N 218 ILE HG13 H N N 219 ILE HG21 H N N 220 ILE HG22 H N N 221 ILE HG23 H N N 222 ILE HD11 H N N 223 ILE HD12 H N N 224 ILE HD13 H N N 225 ILE HXT H N N 226 LEU N N N N 227 LEU CA C N S 228 LEU C C N N 229 LEU O O N N 230 LEU CB C N N 231 LEU CG C N N 232 LEU CD1 C N N 233 LEU CD2 C N N 234 LEU OXT O N N 235 LEU H H N N 236 LEU H2 H N N 237 LEU HA H N N 238 LEU HB2 H N N 239 LEU HB3 H N N 240 LEU HG H N N 241 LEU HD11 H N N 242 LEU HD12 H N N 243 LEU HD13 H N N 244 LEU HD21 H N N 245 LEU HD22 H N N 246 LEU HD23 H N N 247 LEU HXT H N N 248 LYS N N N N 249 LYS CA C N S 250 LYS C C N N 251 LYS O O N N 252 LYS CB C N N 253 LYS CG C N N 254 LYS CD C N N 255 LYS CE C N N 256 LYS NZ N N N 257 LYS OXT O N N 258 LYS H H N N 259 LYS H2 H N N 260 LYS HA H N N 261 LYS HB2 H N N 262 LYS HB3 H N N 263 LYS HG2 H N N 264 LYS HG3 H N N 265 LYS HD2 H N N 266 LYS HD3 H N N 267 LYS HE2 H N N 268 LYS HE3 H N N 269 LYS HZ1 H N N 270 LYS HZ2 H N N 271 LYS HZ3 H N N 272 LYS HXT H N N 273 MET N N N N 274 MET CA C N S 275 MET C C N N 276 MET O O N N 277 MET CB C N N 278 MET CG C N N 279 MET SD S N N 280 MET CE C N N 281 MET OXT O N N 282 MET H H N N 283 MET H2 H N N 284 MET HA H N N 285 MET HB2 H N N 286 MET HB3 H N N 287 MET HG2 H N N 288 MET HG3 H N N 289 MET HE1 H N N 290 MET HE2 H N N 291 MET HE3 H N N 292 MET HXT H N N 293 PHE N N N N 294 PHE CA C N S 295 PHE C C N N 296 PHE O O N N 297 PHE CB C N N 298 PHE CG C Y N 299 PHE CD1 C Y N 300 PHE CD2 C Y N 301 PHE CE1 C Y N 302 PHE CE2 C Y N 303 PHE CZ C Y N 304 PHE OXT O N N 305 PHE H H N N 306 PHE H2 H N N 307 PHE HA H N N 308 PHE HB2 H N N 309 PHE HB3 H N N 310 PHE HD1 H N N 311 PHE HD2 H N N 312 PHE HE1 H N N 313 PHE HE2 H N N 314 PHE HZ H N N 315 PHE HXT H N N 316 PRO N N N N 317 PRO CA C N S 318 PRO C C N N 319 PRO O O N N 320 PRO CB C N N 321 PRO CG C N N 322 PRO CD C N N 323 PRO OXT O N N 324 PRO H H N N 325 PRO HA H N N 326 PRO HB2 H N N 327 PRO HB3 H N N 328 PRO HG2 H N N 329 PRO HG3 H N N 330 PRO HD2 H N N 331 PRO HD3 H N N 332 PRO HXT H N N 333 SER N N N N 334 SER CA C N S 335 SER C C N N 336 SER O O N N 337 SER CB C N N 338 SER OG O N N 339 SER OXT O N N 340 SER H H N N 341 SER H2 H N N 342 SER HA H N N 343 SER HB2 H N N 344 SER HB3 H N N 345 SER HG H N N 346 SER HXT H N N 347 THR N N N N 348 THR CA C N S 349 THR C C N N 350 THR O O N N 351 THR CB C N R 352 THR OG1 O N N 353 THR CG2 C N N 354 THR OXT O N N 355 THR H H N N 356 THR H2 H N N 357 THR HA H N N 358 THR HB H N N 359 THR HG1 H N N 360 THR HG21 H N N 361 THR HG22 H N N 362 THR HG23 H N N 363 THR HXT H N N 364 TRP N N N N 365 TRP CA C N S 366 TRP C C N N 367 TRP O O N N 368 TRP CB C N N 369 TRP CG C Y N 370 TRP CD1 C Y N 371 TRP CD2 C Y N 372 TRP NE1 N Y N 373 TRP CE2 C Y N 374 TRP CE3 C Y N 375 TRP CZ2 C Y N 376 TRP CZ3 C Y N 377 TRP CH2 C Y N 378 TRP OXT O N N 379 TRP H H N N 380 TRP H2 H N N 381 TRP HA H N N 382 TRP HB2 H N N 383 TRP HB3 H N N 384 TRP HD1 H N N 385 TRP HE1 H N N 386 TRP HE3 H N N 387 TRP HZ2 H N N 388 TRP HZ3 H N N 389 TRP HH2 H N N 390 TRP HXT H N N 391 TYR N N N N 392 TYR CA C N S 393 TYR C C N N 394 TYR O O N N 395 TYR CB C N N 396 TYR CG C Y N 397 TYR CD1 C Y N 398 TYR CD2 C Y N 399 TYR CE1 C Y N 400 TYR CE2 C Y N 401 TYR CZ C Y N 402 TYR OH O N N 403 TYR OXT O N N 404 TYR H H N N 405 TYR H2 H N N 406 TYR HA H N N 407 TYR HB2 H N N 408 TYR HB3 H N N 409 TYR HD1 H N N 410 TYR HD2 H N N 411 TYR HE1 H N N 412 TYR HE2 H N N 413 TYR HH H N N 414 TYR HXT H N N 415 VAL N N N N 416 VAL CA C N S 417 VAL C C N N 418 VAL O O N N 419 VAL CB C N N 420 VAL CG1 C N N 421 VAL CG2 C N N 422 VAL OXT O N N 423 VAL H H N N 424 VAL H2 H N N 425 VAL HA H N N 426 VAL HB H N N 427 VAL HG11 H N N 428 VAL HG12 H N N 429 VAL HG13 H N N 430 VAL HG21 H N N 431 VAL HG22 H N N 432 VAL HG23 H N N 433 VAL HXT H N N 434 ZN ZN ZN N N 435 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BM3 C1 O1 sing N N 70 BM3 C1 C2 sing N N 71 BM3 C1 O5 sing N N 72 BM3 C1 H1 sing N N 73 BM3 O1 HO1 sing N N 74 BM3 C2 N2 sing N N 75 BM3 C2 C3 sing N N 76 BM3 C2 H2 sing N N 77 BM3 N2 C7 sing N N 78 BM3 N2 HN2 sing N N 79 BM3 C7 O7 doub N N 80 BM3 C7 C8 sing N N 81 BM3 C8 H81 sing N N 82 BM3 C8 H82 sing N N 83 BM3 C8 H83 sing N N 84 BM3 C3 O3 sing N N 85 BM3 C3 C4 sing N N 86 BM3 C3 H3 sing N N 87 BM3 O3 HO3 sing N N 88 BM3 C4 O4 sing N N 89 BM3 C4 C5 sing N N 90 BM3 C4 H4 sing N N 91 BM3 O4 HO4 sing N N 92 BM3 C5 C6 sing N N 93 BM3 C5 O5 sing N N 94 BM3 C5 H5 sing N N 95 BM3 C6 O6 sing N N 96 BM3 C6 H61 sing N N 97 BM3 C6 H62 sing N N 98 BM3 O6 HO6 sing N N 99 CYS N CA sing N N 100 CYS N H sing N N 101 CYS N H2 sing N N 102 CYS CA C sing N N 103 CYS CA CB sing N N 104 CYS CA HA sing N N 105 CYS C O doub N N 106 CYS C OXT sing N N 107 CYS CB SG sing N N 108 CYS CB HB2 sing N N 109 CYS CB HB3 sing N N 110 CYS SG HG sing N N 111 CYS OXT HXT sing N N 112 GLN N CA sing N N 113 GLN N H sing N N 114 GLN N H2 sing N N 115 GLN CA C sing N N 116 GLN CA CB sing N N 117 GLN CA HA sing N N 118 GLN C O doub N N 119 GLN C OXT sing N N 120 GLN CB CG sing N N 121 GLN CB HB2 sing N N 122 GLN CB HB3 sing N N 123 GLN CG CD sing N N 124 GLN CG HG2 sing N N 125 GLN CG HG3 sing N N 126 GLN CD OE1 doub N N 127 GLN CD NE2 sing N N 128 GLN NE2 HE21 sing N N 129 GLN NE2 HE22 sing N N 130 GLN OXT HXT sing N N 131 GLU N CA sing N N 132 GLU N H sing N N 133 GLU N H2 sing N N 134 GLU CA C sing N N 135 GLU CA CB sing N N 136 GLU CA HA sing N N 137 GLU C O doub N N 138 GLU C OXT sing N N 139 GLU CB CG sing N N 140 GLU CB HB2 sing N N 141 GLU CB HB3 sing N N 142 GLU CG CD sing N N 143 GLU CG HG2 sing N N 144 GLU CG HG3 sing N N 145 GLU CD OE1 doub N N 146 GLU CD OE2 sing N N 147 GLU OE2 HE2 sing N N 148 GLU OXT HXT sing N N 149 GLY N CA sing N N 150 GLY N H sing N N 151 GLY N H2 sing N N 152 GLY CA C sing N N 153 GLY CA HA2 sing N N 154 GLY CA HA3 sing N N 155 GLY C O doub N N 156 GLY C OXT sing N N 157 GLY OXT HXT sing N N 158 GOL C1 O1 sing N N 159 GOL C1 C2 sing N N 160 GOL C1 H11 sing N N 161 GOL C1 H12 sing N N 162 GOL O1 HO1 sing N N 163 GOL C2 O2 sing N N 164 GOL C2 C3 sing N N 165 GOL C2 H2 sing N N 166 GOL O2 HO2 sing N N 167 GOL C3 O3 sing N N 168 GOL C3 H31 sing N N 169 GOL C3 H32 sing N N 170 GOL O3 HO3 sing N N 171 HIS N CA sing N N 172 HIS N H sing N N 173 HIS N H2 sing N N 174 HIS CA C sing N N 175 HIS CA CB sing N N 176 HIS CA HA sing N N 177 HIS C O doub N N 178 HIS C OXT sing N N 179 HIS CB CG sing N N 180 HIS CB HB2 sing N N 181 HIS CB HB3 sing N N 182 HIS CG ND1 sing Y N 183 HIS CG CD2 doub Y N 184 HIS ND1 CE1 doub Y N 185 HIS ND1 HD1 sing N N 186 HIS CD2 NE2 sing Y N 187 HIS CD2 HD2 sing N N 188 HIS CE1 NE2 sing Y N 189 HIS CE1 HE1 sing N N 190 HIS NE2 HE2 sing N N 191 HIS OXT HXT sing N N 192 HOH O H1 sing N N 193 HOH O H2 sing N N 194 ILE N CA sing N N 195 ILE N H sing N N 196 ILE N H2 sing N N 197 ILE CA C sing N N 198 ILE CA CB sing N N 199 ILE CA HA sing N N 200 ILE C O doub N N 201 ILE C OXT sing N N 202 ILE CB CG1 sing N N 203 ILE CB CG2 sing N N 204 ILE CB HB sing N N 205 ILE CG1 CD1 sing N N 206 ILE CG1 HG12 sing N N 207 ILE CG1 HG13 sing N N 208 ILE CG2 HG21 sing N N 209 ILE CG2 HG22 sing N N 210 ILE CG2 HG23 sing N N 211 ILE CD1 HD11 sing N N 212 ILE CD1 HD12 sing N N 213 ILE CD1 HD13 sing N N 214 ILE OXT HXT sing N N 215 LEU N CA sing N N 216 LEU N H sing N N 217 LEU N H2 sing N N 218 LEU CA C sing N N 219 LEU CA CB sing N N 220 LEU CA HA sing N N 221 LEU C O doub N N 222 LEU C OXT sing N N 223 LEU CB CG sing N N 224 LEU CB HB2 sing N N 225 LEU CB HB3 sing N N 226 LEU CG CD1 sing N N 227 LEU CG CD2 sing N N 228 LEU CG HG sing N N 229 LEU CD1 HD11 sing N N 230 LEU CD1 HD12 sing N N 231 LEU CD1 HD13 sing N N 232 LEU CD2 HD21 sing N N 233 LEU CD2 HD22 sing N N 234 LEU CD2 HD23 sing N N 235 LEU OXT HXT sing N N 236 LYS N CA sing N N 237 LYS N H sing N N 238 LYS N H2 sing N N 239 LYS CA C sing N N 240 LYS CA CB sing N N 241 LYS CA HA sing N N 242 LYS C O doub N N 243 LYS C OXT sing N N 244 LYS CB CG sing N N 245 LYS CB HB2 sing N N 246 LYS CB HB3 sing N N 247 LYS CG CD sing N N 248 LYS CG HG2 sing N N 249 LYS CG HG3 sing N N 250 LYS CD CE sing N N 251 LYS CD HD2 sing N N 252 LYS CD HD3 sing N N 253 LYS CE NZ sing N N 254 LYS CE HE2 sing N N 255 LYS CE HE3 sing N N 256 LYS NZ HZ1 sing N N 257 LYS NZ HZ2 sing N N 258 LYS NZ HZ3 sing N N 259 LYS OXT HXT sing N N 260 MET N CA sing N N 261 MET N H sing N N 262 MET N H2 sing N N 263 MET CA C sing N N 264 MET CA CB sing N N 265 MET CA HA sing N N 266 MET C O doub N N 267 MET C OXT sing N N 268 MET CB CG sing N N 269 MET CB HB2 sing N N 270 MET CB HB3 sing N N 271 MET CG SD sing N N 272 MET CG HG2 sing N N 273 MET CG HG3 sing N N 274 MET SD CE sing N N 275 MET CE HE1 sing N N 276 MET CE HE2 sing N N 277 MET CE HE3 sing N N 278 MET OXT HXT sing N N 279 PHE N CA sing N N 280 PHE N H sing N N 281 PHE N H2 sing N N 282 PHE CA C sing N N 283 PHE CA CB sing N N 284 PHE CA HA sing N N 285 PHE C O doub N N 286 PHE C OXT sing N N 287 PHE CB CG sing N N 288 PHE CB HB2 sing N N 289 PHE CB HB3 sing N N 290 PHE CG CD1 doub Y N 291 PHE CG CD2 sing Y N 292 PHE CD1 CE1 sing Y N 293 PHE CD1 HD1 sing N N 294 PHE CD2 CE2 doub Y N 295 PHE CD2 HD2 sing N N 296 PHE CE1 CZ doub Y N 297 PHE CE1 HE1 sing N N 298 PHE CE2 CZ sing Y N 299 PHE CE2 HE2 sing N N 300 PHE CZ HZ sing N N 301 PHE OXT HXT sing N N 302 PRO N CA sing N N 303 PRO N CD sing N N 304 PRO N H sing N N 305 PRO CA C sing N N 306 PRO CA CB sing N N 307 PRO CA HA sing N N 308 PRO C O doub N N 309 PRO C OXT sing N N 310 PRO CB CG sing N N 311 PRO CB HB2 sing N N 312 PRO CB HB3 sing N N 313 PRO CG CD sing N N 314 PRO CG HG2 sing N N 315 PRO CG HG3 sing N N 316 PRO CD HD2 sing N N 317 PRO CD HD3 sing N N 318 PRO OXT HXT sing N N 319 SER N CA sing N N 320 SER N H sing N N 321 SER N H2 sing N N 322 SER CA C sing N N 323 SER CA CB sing N N 324 SER CA HA sing N N 325 SER C O doub N N 326 SER C OXT sing N N 327 SER CB OG sing N N 328 SER CB HB2 sing N N 329 SER CB HB3 sing N N 330 SER OG HG sing N N 331 SER OXT HXT sing N N 332 THR N CA sing N N 333 THR N H sing N N 334 THR N H2 sing N N 335 THR CA C sing N N 336 THR CA CB sing N N 337 THR CA HA sing N N 338 THR C O doub N N 339 THR C OXT sing N N 340 THR CB OG1 sing N N 341 THR CB CG2 sing N N 342 THR CB HB sing N N 343 THR OG1 HG1 sing N N 344 THR CG2 HG21 sing N N 345 THR CG2 HG22 sing N N 346 THR CG2 HG23 sing N N 347 THR OXT HXT sing N N 348 TRP N CA sing N N 349 TRP N H sing N N 350 TRP N H2 sing N N 351 TRP CA C sing N N 352 TRP CA CB sing N N 353 TRP CA HA sing N N 354 TRP C O doub N N 355 TRP C OXT sing N N 356 TRP CB CG sing N N 357 TRP CB HB2 sing N N 358 TRP CB HB3 sing N N 359 TRP CG CD1 doub Y N 360 TRP CG CD2 sing Y N 361 TRP CD1 NE1 sing Y N 362 TRP CD1 HD1 sing N N 363 TRP CD2 CE2 doub Y N 364 TRP CD2 CE3 sing Y N 365 TRP NE1 CE2 sing Y N 366 TRP NE1 HE1 sing N N 367 TRP CE2 CZ2 sing Y N 368 TRP CE3 CZ3 doub Y N 369 TRP CE3 HE3 sing N N 370 TRP CZ2 CH2 doub Y N 371 TRP CZ2 HZ2 sing N N 372 TRP CZ3 CH2 sing Y N 373 TRP CZ3 HZ3 sing N N 374 TRP CH2 HH2 sing N N 375 TRP OXT HXT sing N N 376 TYR N CA sing N N 377 TYR N H sing N N 378 TYR N H2 sing N N 379 TYR CA C sing N N 380 TYR CA CB sing N N 381 TYR CA HA sing N N 382 TYR C O doub N N 383 TYR C OXT sing N N 384 TYR CB CG sing N N 385 TYR CB HB2 sing N N 386 TYR CB HB3 sing N N 387 TYR CG CD1 doub Y N 388 TYR CG CD2 sing Y N 389 TYR CD1 CE1 sing Y N 390 TYR CD1 HD1 sing N N 391 TYR CD2 CE2 doub Y N 392 TYR CD2 HD2 sing N N 393 TYR CE1 CZ doub Y N 394 TYR CE1 HE1 sing N N 395 TYR CE2 CZ sing Y N 396 TYR CE2 HE2 sing N N 397 TYR CZ OH sing N N 398 TYR OH HH sing N N 399 TYR OXT HXT sing N N 400 VAL N CA sing N N 401 VAL N H sing N N 402 VAL N H2 sing N N 403 VAL CA C sing N N 404 VAL CA CB sing N N 405 VAL CA HA sing N N 406 VAL C O doub N N 407 VAL C OXT sing N N 408 VAL CB CG1 sing N N 409 VAL CB CG2 sing N N 410 VAL CB HB sing N N 411 VAL CG1 HG11 sing N N 412 VAL CG1 HG12 sing N N 413 VAL CG1 HG13 sing N N 414 VAL CG2 HG21 sing N N 415 VAL CG2 HG22 sing N N 416 VAL CG2 HG23 sing N N 417 VAL OXT HXT sing N N 418 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Department of Biotechnology (India)' India BT/IN/Sweden/06/SR/2017-18 1 'Department of Biotechnology (India)' India 'BT/PR12422/MED/31/287/ 2014' 2 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BM3 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpNAca BM3 'COMMON NAME' GMML 1.0 N-acetyl-a-D-mannopyranosamine BM3 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-ManpNAc BM3 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 ManNAc # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 BM3 ? ? BM3 ? ? 'SUBJECT OF INVESTIGATION' ? 2 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-acetamido-2-deoxy-alpha-D-mannopyranose BM3 3 'ZINC ION' ZN 4 GLYCEROL GOL 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2AA4 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? #