data_6JDL # _entry.id 6JDL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.318 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6JDL WWPDB D_1300010927 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6JDL _pdbx_database_status.recvd_initial_deposition_date 2019-02-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jain, D.' 1 0000-0002-8631-7230 'Banerjee, P.' 2 ? Chanchal 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Chem.Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1554-8937 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 1515 _citation.page_last 1527 _citation.title 'Sensor I Regulated ATPase Activity of FleQ Is Essential for Motility to Biofilm Transition inPseudomonas aeruginosa.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acschembio.9b00255 _citation.pdbx_database_id_PubMed 31268665 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Banerjee, P.' 1 ? primary Chanchal 2 ? primary 'Jain, D.' 3 0000-0002-8631-7230 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6JDL _cell.details ? _cell.formula_units_Z ? _cell.length_a 105.011 _cell.length_a_esd ? _cell.length_b 105.011 _cell.length_b_esd ? _cell.length_c 43.191 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6JDL _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nitrogen assimilation regulatory protein' 29532.865 1 ? H287A 'Central domain' ? 2 non-polymer syn 'PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER' 523.247 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 75 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Regulatory protein,Sigma-54-dependent Fis family transcriptional regulator,Transcriptional regulator FleQ' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSLFRSLVGTSRAIQQVRQMMQQVADTDASVLILGESGTGKEVVARNLHYHSKRREGPFVPVNCGAIPAELLESELF GHEKGAFTGAITSRAGRFELANGGTLFLDEIGDMPLPMQVKLLRVLQERTFERVGSNKTQNVDVRIIAATAKNLEKMIED GTFREDLYYRLNVFPIEMAPLRERVEDIALLLNELISRMEHEKRGSIRFNSAAIMSLCRHDWPGNVRELANLVERLAIMH PYGVIGVGELPKKFRHVDDEDEQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSLFRSLVGTSRAIQQVRQMMQQVADTDASVLILGESGTGKEVVARNLHYHSKRREGPFVPVNCGAIPAELLESELF GHEKGAFTGAITSRAGRFELANGGTLFLDEIGDMPLPMQVKLLRVLQERTFERVGSNKTQNVDVRIIAATAKNLEKMIED GTFREDLYYRLNVFPIEMAPLRERVEDIALLLNELISRMEHEKRGSIRFNSAAIMSLCRHDWPGNVRELANLVERLAIMH PYGVIGVGELPKKFRHVDDEDEQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 LEU n 1 7 PHE n 1 8 ARG n 1 9 SER n 1 10 LEU n 1 11 VAL n 1 12 GLY n 1 13 THR n 1 14 SER n 1 15 ARG n 1 16 ALA n 1 17 ILE n 1 18 GLN n 1 19 GLN n 1 20 VAL n 1 21 ARG n 1 22 GLN n 1 23 MET n 1 24 MET n 1 25 GLN n 1 26 GLN n 1 27 VAL n 1 28 ALA n 1 29 ASP n 1 30 THR n 1 31 ASP n 1 32 ALA n 1 33 SER n 1 34 VAL n 1 35 LEU n 1 36 ILE n 1 37 LEU n 1 38 GLY n 1 39 GLU n 1 40 SER n 1 41 GLY n 1 42 THR n 1 43 GLY n 1 44 LYS n 1 45 GLU n 1 46 VAL n 1 47 VAL n 1 48 ALA n 1 49 ARG n 1 50 ASN n 1 51 LEU n 1 52 HIS n 1 53 TYR n 1 54 HIS n 1 55 SER n 1 56 LYS n 1 57 ARG n 1 58 ARG n 1 59 GLU n 1 60 GLY n 1 61 PRO n 1 62 PHE n 1 63 VAL n 1 64 PRO n 1 65 VAL n 1 66 ASN n 1 67 CYS n 1 68 GLY n 1 69 ALA n 1 70 ILE n 1 71 PRO n 1 72 ALA n 1 73 GLU n 1 74 LEU n 1 75 LEU n 1 76 GLU n 1 77 SER n 1 78 GLU n 1 79 LEU n 1 80 PHE n 1 81 GLY n 1 82 HIS n 1 83 GLU n 1 84 LYS n 1 85 GLY n 1 86 ALA n 1 87 PHE n 1 88 THR n 1 89 GLY n 1 90 ALA n 1 91 ILE n 1 92 THR n 1 93 SER n 1 94 ARG n 1 95 ALA n 1 96 GLY n 1 97 ARG n 1 98 PHE n 1 99 GLU n 1 100 LEU n 1 101 ALA n 1 102 ASN n 1 103 GLY n 1 104 GLY n 1 105 THR n 1 106 LEU n 1 107 PHE n 1 108 LEU n 1 109 ASP n 1 110 GLU n 1 111 ILE n 1 112 GLY n 1 113 ASP n 1 114 MET n 1 115 PRO n 1 116 LEU n 1 117 PRO n 1 118 MET n 1 119 GLN n 1 120 VAL n 1 121 LYS n 1 122 LEU n 1 123 LEU n 1 124 ARG n 1 125 VAL n 1 126 LEU n 1 127 GLN n 1 128 GLU n 1 129 ARG n 1 130 THR n 1 131 PHE n 1 132 GLU n 1 133 ARG n 1 134 VAL n 1 135 GLY n 1 136 SER n 1 137 ASN n 1 138 LYS n 1 139 THR n 1 140 GLN n 1 141 ASN n 1 142 VAL n 1 143 ASP n 1 144 VAL n 1 145 ARG n 1 146 ILE n 1 147 ILE n 1 148 ALA n 1 149 ALA n 1 150 THR n 1 151 ALA n 1 152 LYS n 1 153 ASN n 1 154 LEU n 1 155 GLU n 1 156 LYS n 1 157 MET n 1 158 ILE n 1 159 GLU n 1 160 ASP n 1 161 GLY n 1 162 THR n 1 163 PHE n 1 164 ARG n 1 165 GLU n 1 166 ASP n 1 167 LEU n 1 168 TYR n 1 169 TYR n 1 170 ARG n 1 171 LEU n 1 172 ASN n 1 173 VAL n 1 174 PHE n 1 175 PRO n 1 176 ILE n 1 177 GLU n 1 178 MET n 1 179 ALA n 1 180 PRO n 1 181 LEU n 1 182 ARG n 1 183 GLU n 1 184 ARG n 1 185 VAL n 1 186 GLU n 1 187 ASP n 1 188 ILE n 1 189 ALA n 1 190 LEU n 1 191 LEU n 1 192 LEU n 1 193 ASN n 1 194 GLU n 1 195 LEU n 1 196 ILE n 1 197 SER n 1 198 ARG n 1 199 MET n 1 200 GLU n 1 201 HIS n 1 202 GLU n 1 203 LYS n 1 204 ARG n 1 205 GLY n 1 206 SER n 1 207 ILE n 1 208 ARG n 1 209 PHE n 1 210 ASN n 1 211 SER n 1 212 ALA n 1 213 ALA n 1 214 ILE n 1 215 MET n 1 216 SER n 1 217 LEU n 1 218 CYS n 1 219 ARG n 1 220 HIS n 1 221 ASP n 1 222 TRP n 1 223 PRO n 1 224 GLY n 1 225 ASN n 1 226 VAL n 1 227 ARG n 1 228 GLU n 1 229 LEU n 1 230 ALA n 1 231 ASN n 1 232 LEU n 1 233 VAL n 1 234 GLU n 1 235 ARG n 1 236 LEU n 1 237 ALA n 1 238 ILE n 1 239 MET n 1 240 HIS n 1 241 PRO n 1 242 TYR n 1 243 GLY n 1 244 VAL n 1 245 ILE n 1 246 GLY n 1 247 VAL n 1 248 GLY n 1 249 GLU n 1 250 LEU n 1 251 PRO n 1 252 LYS n 1 253 LYS n 1 254 PHE n 1 255 ARG n 1 256 HIS n 1 257 VAL n 1 258 ASP n 1 259 ASP n 1 260 GLU n 1 261 ASP n 1 262 GLU n 1 263 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 263 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ;ntrC_1, fleQ, ntrC_2, C8257_22345, CAZ10_06755, CGU42_27830, DZ940_07790, DZ962_01740, NCTC13719_04150, PAERUG_E15_London_28_01_14_04909, PAMH19_4438, RW109_RW109_05080 ; _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q51460_PSEAI _struct_ref.pdbx_db_accession Q51460 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LFRSLVGTSRAIQQVRQMMQQVADTDASVLILGESGTGKEVVARNLHYHSKRREGPFVPVNCGAIPAELLESELFGHEKG AFTGAITSRAGRFELANGGTLFLDEIGDMPLPMQVKLLRVLQERTFERVGSNKTQNVDVRIIAATHKNLEKMIEDGTFRE DLYYRLNVFPIEMAPLRERVEDIALLLNELISRMEHEKRGSIRFNSAAIMSLCRHDWPGNVRELANLVERLAIMHPYGVI GVGELPKKFRHVDDEDEQ ; _struct_ref.pdbx_align_begin 142 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6JDL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 263 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q51460 _struct_ref_seq.db_align_beg 142 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 399 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 142 _struct_ref_seq.pdbx_auth_seq_align_end 399 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6JDL GLY A 1 ? UNP Q51460 ? ? 'expression tag' 137 1 1 6JDL PRO A 2 ? UNP Q51460 ? ? 'expression tag' 138 2 1 6JDL LEU A 3 ? UNP Q51460 ? ? 'expression tag' 139 3 1 6JDL GLY A 4 ? UNP Q51460 ? ? 'expression tag' 140 4 1 6JDL SER A 5 ? UNP Q51460 ? ? 'expression tag' 141 5 1 6JDL ALA A 151 ? UNP Q51460 HIS 287 'engineered mutation' 287 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight AGS non-polymer . 'PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER' ;ATP-GAMMA-S; ADENOSINE 5'-(3-THIOTRIPHOSPHATE); ADENOSINE 5'-(GAMMA-THIOTRIPHOSPHATE); ADENOSINE-5'-DIPHOSPHATE MONOTHIOPHOSPHATE ; 'C10 H16 N5 O12 P3 S' 523.247 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6JDL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.33 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 281 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M SODIUM THIOCYANATE, 22% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-06-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.966 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.966 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6JDL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.249 _reflns.d_resolution_low 45.5 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13175 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.5 _reflns.pdbx_Rmerge_I_obs 0.096 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.25 _reflns_shell.d_res_low 2.32 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.8 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6JDL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.249 _refine.ls_d_res_low 45.471 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13156 _refine.ls_number_reflns_R_free 623 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.99 _refine.ls_percent_reflns_R_free 4.74 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1775 _refine.ls_R_factor_R_free 0.2449 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1744 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5EXP _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.88 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.28 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1990 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.number_atoms_solvent 75 _refine_hist.number_atoms_total 2097 _refine_hist.d_res_high 2.249 _refine_hist.d_res_low 45.471 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 2065 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.169 ? 2791 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.407 ? 789 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.048 ? 312 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 361 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2493 2.4756 . . 135 3124 100.00 . . . 0.2791 . 0.2210 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4756 2.8338 . . 178 3096 100.00 . . . 0.3017 . 0.1991 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8338 3.5701 . . 181 3084 100.00 . . . 0.2760 . 0.1903 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5701 45.4804 . . 129 3229 100.00 . . . 0.1927 . 0.1507 . . . . . . . . . . # _struct.entry_id 6JDL _struct.title 'Central domain of FleQ H287A mutant in complex with ATPgS and Mg' _struct.pdbx_descriptor 'Nitrogen assimilation regulatory protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6JDL _struct_keywords.text 'FleQ, Pseudomonas, AAA+, NtrC, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 14 ? ASP A 29 ? SER A 150 ASP A 165 1 ? 16 HELX_P HELX_P2 AA2 GLY A 43 ? HIS A 54 ? GLY A 179 HIS A 190 1 ? 12 HELX_P HELX_P3 AA3 PRO A 71 ? GLU A 73 ? PRO A 207 GLU A 209 5 ? 3 HELX_P HELX_P4 AA4 LEU A 74 ? GLY A 81 ? LEU A 210 GLY A 217 1 ? 8 HELX_P HELX_P5 AA5 GLY A 96 ? ALA A 101 ? GLY A 232 ALA A 237 1 ? 6 HELX_P HELX_P6 AA6 GLU A 110 ? MET A 114 ? GLU A 246 MET A 250 5 ? 5 HELX_P HELX_P7 AA7 PRO A 115 ? ARG A 129 ? PRO A 251 ARG A 265 1 ? 15 HELX_P HELX_P8 AA8 ASN A 153 ? ASP A 160 ? ASN A 289 ASP A 296 1 ? 8 HELX_P HELX_P9 AA9 ARG A 164 ? ASN A 172 ? ARG A 300 ASN A 308 1 ? 9 HELX_P HELX_P10 AB1 PRO A 180 ? GLU A 186 ? PRO A 316 GLU A 322 5 ? 7 HELX_P HELX_P11 AB2 ASP A 187 ? GLU A 202 ? ASP A 323 GLU A 338 1 ? 16 HELX_P HELX_P12 AB3 ASN A 210 ? ARG A 219 ? ASN A 346 ARG A 355 1 ? 10 HELX_P HELX_P13 AB4 GLY A 224 ? HIS A 240 ? GLY A 360 HIS A 376 1 ? 17 HELX_P HELX_P14 AB5 GLY A 246 ? LEU A 250 ? GLY A 382 LEU A 386 5 ? 5 HELX_P HELX_P15 AB6 PRO A 251 ? ARG A 255 ? PRO A 387 ARG A 391 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A GLU 45 OE1 ? ? ? 1_555 C MG . MG ? ? A GLU 181 A MG 402 1_555 ? ? ? ? ? ? ? 2.647 ? metalc2 metalc ? ? B AGS . O2G ? ? ? 1_555 C MG . MG ? ? A AGS 401 A MG 402 1_555 ? ? ? ? ? ? ? 2.264 ? metalc3 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 402 A HOH 516 1_555 ? ? ? ? ? ? ? 2.393 ? metalc4 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 402 A HOH 534 6_554 ? ? ? ? ? ? ? 2.530 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 62 ? ASN A 66 ? PHE A 198 ASN A 202 AA1 2 GLY A 104 ? ASP A 109 ? GLY A 240 ASP A 245 AA1 3 VAL A 144 ? THR A 150 ? VAL A 280 THR A 286 AA1 4 VAL A 34 ? LEU A 37 ? VAL A 170 LEU A 173 AA1 5 PHE A 174 ? GLU A 177 ? PHE A 310 GLU A 313 AA2 1 THR A 130 ? PHE A 131 ? THR A 266 PHE A 267 AA2 2 GLN A 140 ? ASN A 141 ? GLN A 276 ASN A 277 AA3 1 ILE A 207 ? PHE A 209 ? ILE A 343 PHE A 345 AA3 2 GLY A 243 ? ILE A 245 ? GLY A 379 ILE A 381 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 63 ? N VAL A 199 O THR A 105 ? O THR A 241 AA1 2 3 N LEU A 108 ? N LEU A 244 O ILE A 147 ? O ILE A 283 AA1 3 4 O ALA A 148 ? O ALA A 284 N ILE A 36 ? N ILE A 172 AA1 4 5 N LEU A 37 ? N LEU A 173 O ILE A 176 ? O ILE A 312 AA2 1 2 N PHE A 131 ? N PHE A 267 O GLN A 140 ? O GLN A 276 AA3 1 2 N ARG A 208 ? N ARG A 344 O ILE A 245 ? O ILE A 381 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A AGS 401 ? 23 'binding site for residue AGS A 401' AC2 Software A MG 402 ? 4 'binding site for residue MG A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 23 SER A 9 ? SER A 145 . ? 1_555 ? 2 AC1 23 LEU A 10 ? LEU A 146 . ? 1_555 ? 3 AC1 23 VAL A 11 ? VAL A 147 . ? 1_555 ? 4 AC1 23 SER A 40 ? SER A 176 . ? 1_555 ? 5 AC1 23 GLY A 41 ? GLY A 177 . ? 1_555 ? 6 AC1 23 THR A 42 ? THR A 178 . ? 1_555 ? 7 AC1 23 GLY A 43 ? GLY A 179 . ? 1_555 ? 8 AC1 23 LYS A 44 ? LYS A 180 . ? 1_555 ? 9 AC1 23 GLU A 45 ? GLU A 181 . ? 1_555 ? 10 AC1 23 VAL A 46 ? VAL A 182 . ? 1_555 ? 11 AC1 23 ASP A 109 ? ASP A 245 . ? 1_555 ? 12 AC1 23 ARG A 198 ? ARG A 334 . ? 1_555 ? 13 AC1 23 VAL A 226 ? VAL A 362 . ? 1_555 ? 14 AC1 23 ARG A 227 ? ARG A 363 . ? 1_555 ? 15 AC1 23 MG C . ? MG A 402 . ? 1_555 ? 16 AC1 23 HOH D . ? HOH A 504 . ? 1_555 ? 17 AC1 23 HOH D . ? HOH A 505 . ? 1_555 ? 18 AC1 23 HOH D . ? HOH A 506 . ? 1_555 ? 19 AC1 23 HOH D . ? HOH A 509 . ? 1_555 ? 20 AC1 23 HOH D . ? HOH A 516 . ? 1_555 ? 21 AC1 23 HOH D . ? HOH A 534 . ? 6_554 ? 22 AC1 23 HOH D . ? HOH A 541 . ? 1_555 ? 23 AC1 23 HOH D . ? HOH A 555 . ? 6_554 ? 24 AC2 4 GLU A 45 ? GLU A 181 . ? 1_555 ? 25 AC2 4 AGS B . ? AGS A 401 . ? 1_555 ? 26 AC2 4 HOH D . ? HOH A 516 . ? 1_555 ? 27 AC2 4 HOH D . ? HOH A 534 . ? 6_554 ? # _atom_sites.entry_id 6JDL _atom_sites.fract_transf_matrix[1][1] 0.009523 _atom_sites.fract_transf_matrix[1][2] 0.005498 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010996 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023153 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 137 ? ? ? A . n A 1 2 PRO 2 138 ? ? ? A . n A 1 3 LEU 3 139 ? ? ? A . n A 1 4 GLY 4 140 ? ? ? A . n A 1 5 SER 5 141 ? ? ? A . n A 1 6 LEU 6 142 142 LEU LEU A . n A 1 7 PHE 7 143 143 PHE PHE A . n A 1 8 ARG 8 144 144 ARG ARG A . n A 1 9 SER 9 145 145 SER SER A . n A 1 10 LEU 10 146 146 LEU LEU A . n A 1 11 VAL 11 147 147 VAL VAL A . n A 1 12 GLY 12 148 148 GLY GLY A . n A 1 13 THR 13 149 149 THR THR A . n A 1 14 SER 14 150 150 SER SER A . n A 1 15 ARG 15 151 151 ARG ARG A . n A 1 16 ALA 16 152 152 ALA ALA A . n A 1 17 ILE 17 153 153 ILE ILE A . n A 1 18 GLN 18 154 154 GLN GLN A . n A 1 19 GLN 19 155 155 GLN GLN A . n A 1 20 VAL 20 156 156 VAL VAL A . n A 1 21 ARG 21 157 157 ARG ARG A . n A 1 22 GLN 22 158 158 GLN GLN A . n A 1 23 MET 23 159 159 MET MET A . n A 1 24 MET 24 160 160 MET MET A . n A 1 25 GLN 25 161 161 GLN GLN A . n A 1 26 GLN 26 162 162 GLN GLN A . n A 1 27 VAL 27 163 163 VAL VAL A . n A 1 28 ALA 28 164 164 ALA ALA A . n A 1 29 ASP 29 165 165 ASP ASP A . n A 1 30 THR 30 166 166 THR THR A . n A 1 31 ASP 31 167 167 ASP ASP A . n A 1 32 ALA 32 168 168 ALA ALA A . n A 1 33 SER 33 169 169 SER SER A . n A 1 34 VAL 34 170 170 VAL VAL A . n A 1 35 LEU 35 171 171 LEU LEU A . n A 1 36 ILE 36 172 172 ILE ILE A . n A 1 37 LEU 37 173 173 LEU LEU A . n A 1 38 GLY 38 174 174 GLY GLY A . n A 1 39 GLU 39 175 175 GLU GLU A . n A 1 40 SER 40 176 176 SER SER A . n A 1 41 GLY 41 177 177 GLY GLY A . n A 1 42 THR 42 178 178 THR THR A . n A 1 43 GLY 43 179 179 GLY GLY A . n A 1 44 LYS 44 180 180 LYS LYS A . n A 1 45 GLU 45 181 181 GLU GLU A . n A 1 46 VAL 46 182 182 VAL VAL A . n A 1 47 VAL 47 183 183 VAL VAL A . n A 1 48 ALA 48 184 184 ALA ALA A . n A 1 49 ARG 49 185 185 ARG ARG A . n A 1 50 ASN 50 186 186 ASN ASN A . n A 1 51 LEU 51 187 187 LEU LEU A . n A 1 52 HIS 52 188 188 HIS HIS A . n A 1 53 TYR 53 189 189 TYR TYR A . n A 1 54 HIS 54 190 190 HIS HIS A . n A 1 55 SER 55 191 191 SER SER A . n A 1 56 LYS 56 192 192 LYS LYS A . n A 1 57 ARG 57 193 193 ARG ARG A . n A 1 58 ARG 58 194 194 ARG ARG A . n A 1 59 GLU 59 195 195 GLU GLU A . n A 1 60 GLY 60 196 196 GLY GLY A . n A 1 61 PRO 61 197 197 PRO PRO A . n A 1 62 PHE 62 198 198 PHE PHE A . n A 1 63 VAL 63 199 199 VAL VAL A . n A 1 64 PRO 64 200 200 PRO PRO A . n A 1 65 VAL 65 201 201 VAL VAL A . n A 1 66 ASN 66 202 202 ASN ASN A . n A 1 67 CYS 67 203 203 CYS CYS A . n A 1 68 GLY 68 204 204 GLY GLY A . n A 1 69 ALA 69 205 205 ALA ALA A . n A 1 70 ILE 70 206 206 ILE ILE A . n A 1 71 PRO 71 207 207 PRO PRO A . n A 1 72 ALA 72 208 208 ALA ALA A . n A 1 73 GLU 73 209 209 GLU GLU A . n A 1 74 LEU 74 210 210 LEU LEU A . n A 1 75 LEU 75 211 211 LEU LEU A . n A 1 76 GLU 76 212 212 GLU GLU A . n A 1 77 SER 77 213 213 SER SER A . n A 1 78 GLU 78 214 214 GLU GLU A . n A 1 79 LEU 79 215 215 LEU LEU A . n A 1 80 PHE 80 216 216 PHE PHE A . n A 1 81 GLY 81 217 217 GLY GLY A . n A 1 82 HIS 82 218 218 HIS HIS A . n A 1 83 GLU 83 219 219 GLU GLU A . n A 1 84 LYS 84 220 220 LYS LYS A . n A 1 85 GLY 85 221 221 GLY GLY A . n A 1 86 ALA 86 222 222 ALA ALA A . n A 1 87 PHE 87 223 223 PHE PHE A . n A 1 88 THR 88 224 224 THR THR A . n A 1 89 GLY 89 225 225 GLY GLY A . n A 1 90 ALA 90 226 226 ALA ALA A . n A 1 91 ILE 91 227 227 ILE ILE A . n A 1 92 THR 92 228 228 THR THR A . n A 1 93 SER 93 229 229 SER SER A . n A 1 94 ARG 94 230 230 ARG ARG A . n A 1 95 ALA 95 231 231 ALA ALA A . n A 1 96 GLY 96 232 232 GLY GLY A . n A 1 97 ARG 97 233 233 ARG ARG A . n A 1 98 PHE 98 234 234 PHE PHE A . n A 1 99 GLU 99 235 235 GLU GLU A . n A 1 100 LEU 100 236 236 LEU LEU A . n A 1 101 ALA 101 237 237 ALA ALA A . n A 1 102 ASN 102 238 238 ASN ASN A . n A 1 103 GLY 103 239 239 GLY GLY A . n A 1 104 GLY 104 240 240 GLY GLY A . n A 1 105 THR 105 241 241 THR THR A . n A 1 106 LEU 106 242 242 LEU LEU A . n A 1 107 PHE 107 243 243 PHE PHE A . n A 1 108 LEU 108 244 244 LEU LEU A . n A 1 109 ASP 109 245 245 ASP ASP A . n A 1 110 GLU 110 246 246 GLU GLU A . n A 1 111 ILE 111 247 247 ILE ILE A . n A 1 112 GLY 112 248 248 GLY GLY A . n A 1 113 ASP 113 249 249 ASP ASP A . n A 1 114 MET 114 250 250 MET MET A . n A 1 115 PRO 115 251 251 PRO PRO A . n A 1 116 LEU 116 252 252 LEU LEU A . n A 1 117 PRO 117 253 253 PRO PRO A . n A 1 118 MET 118 254 254 MET MET A . n A 1 119 GLN 119 255 255 GLN GLN A . n A 1 120 VAL 120 256 256 VAL VAL A . n A 1 121 LYS 121 257 257 LYS LYS A . n A 1 122 LEU 122 258 258 LEU LEU A . n A 1 123 LEU 123 259 259 LEU LEU A . n A 1 124 ARG 124 260 260 ARG ARG A . n A 1 125 VAL 125 261 261 VAL VAL A . n A 1 126 LEU 126 262 262 LEU LEU A . n A 1 127 GLN 127 263 263 GLN GLN A . n A 1 128 GLU 128 264 264 GLU GLU A . n A 1 129 ARG 129 265 265 ARG ARG A . n A 1 130 THR 130 266 266 THR THR A . n A 1 131 PHE 131 267 267 PHE PHE A . n A 1 132 GLU 132 268 268 GLU GLU A . n A 1 133 ARG 133 269 269 ARG ARG A . n A 1 134 VAL 134 270 270 VAL VAL A . n A 1 135 GLY 135 271 271 GLY GLY A . n A 1 136 SER 136 272 272 SER SER A . n A 1 137 ASN 137 273 273 ASN ASN A . n A 1 138 LYS 138 274 274 LYS LYS A . n A 1 139 THR 139 275 275 THR THR A . n A 1 140 GLN 140 276 276 GLN GLN A . n A 1 141 ASN 141 277 277 ASN ASN A . n A 1 142 VAL 142 278 278 VAL VAL A . n A 1 143 ASP 143 279 279 ASP ASP A . n A 1 144 VAL 144 280 280 VAL VAL A . n A 1 145 ARG 145 281 281 ARG ARG A . n A 1 146 ILE 146 282 282 ILE ILE A . n A 1 147 ILE 147 283 283 ILE ILE A . n A 1 148 ALA 148 284 284 ALA ALA A . n A 1 149 ALA 149 285 285 ALA ALA A . n A 1 150 THR 150 286 286 THR THR A . n A 1 151 ALA 151 287 287 ALA ALA A . n A 1 152 LYS 152 288 288 LYS LYS A . n A 1 153 ASN 153 289 289 ASN ASN A . n A 1 154 LEU 154 290 290 LEU LEU A . n A 1 155 GLU 155 291 291 GLU GLU A . n A 1 156 LYS 156 292 292 LYS LYS A . n A 1 157 MET 157 293 293 MET MET A . n A 1 158 ILE 158 294 294 ILE ILE A . n A 1 159 GLU 159 295 295 GLU GLU A . n A 1 160 ASP 160 296 296 ASP ASP A . n A 1 161 GLY 161 297 297 GLY GLY A . n A 1 162 THR 162 298 298 THR THR A . n A 1 163 PHE 163 299 299 PHE PHE A . n A 1 164 ARG 164 300 300 ARG ARG A . n A 1 165 GLU 165 301 301 GLU GLU A . n A 1 166 ASP 166 302 302 ASP ASP A . n A 1 167 LEU 167 303 303 LEU LEU A . n A 1 168 TYR 168 304 304 TYR TYR A . n A 1 169 TYR 169 305 305 TYR TYR A . n A 1 170 ARG 170 306 306 ARG ARG A . n A 1 171 LEU 171 307 307 LEU LEU A . n A 1 172 ASN 172 308 308 ASN ASN A . n A 1 173 VAL 173 309 309 VAL VAL A . n A 1 174 PHE 174 310 310 PHE PHE A . n A 1 175 PRO 175 311 311 PRO PRO A . n A 1 176 ILE 176 312 312 ILE ILE A . n A 1 177 GLU 177 313 313 GLU GLU A . n A 1 178 MET 178 314 314 MET MET A . n A 1 179 ALA 179 315 315 ALA ALA A . n A 1 180 PRO 180 316 316 PRO PRO A . n A 1 181 LEU 181 317 317 LEU LEU A . n A 1 182 ARG 182 318 318 ARG ARG A . n A 1 183 GLU 183 319 319 GLU GLU A . n A 1 184 ARG 184 320 320 ARG ARG A . n A 1 185 VAL 185 321 321 VAL VAL A . n A 1 186 GLU 186 322 322 GLU GLU A . n A 1 187 ASP 187 323 323 ASP ASP A . n A 1 188 ILE 188 324 324 ILE ILE A . n A 1 189 ALA 189 325 325 ALA ALA A . n A 1 190 LEU 190 326 326 LEU LEU A . n A 1 191 LEU 191 327 327 LEU LEU A . n A 1 192 LEU 192 328 328 LEU LEU A . n A 1 193 ASN 193 329 329 ASN ASN A . n A 1 194 GLU 194 330 330 GLU GLU A . n A 1 195 LEU 195 331 331 LEU LEU A . n A 1 196 ILE 196 332 332 ILE ILE A . n A 1 197 SER 197 333 333 SER SER A . n A 1 198 ARG 198 334 334 ARG ARG A . n A 1 199 MET 199 335 335 MET MET A . n A 1 200 GLU 200 336 336 GLU GLU A . n A 1 201 HIS 201 337 337 HIS HIS A . n A 1 202 GLU 202 338 338 GLU GLU A . n A 1 203 LYS 203 339 339 LYS LYS A . n A 1 204 ARG 204 340 340 ARG ARG A . n A 1 205 GLY 205 341 341 GLY GLY A . n A 1 206 SER 206 342 342 SER SER A . n A 1 207 ILE 207 343 343 ILE ILE A . n A 1 208 ARG 208 344 344 ARG ARG A . n A 1 209 PHE 209 345 345 PHE PHE A . n A 1 210 ASN 210 346 346 ASN ASN A . n A 1 211 SER 211 347 347 SER SER A . n A 1 212 ALA 212 348 348 ALA ALA A . n A 1 213 ALA 213 349 349 ALA ALA A . n A 1 214 ILE 214 350 350 ILE ILE A . n A 1 215 MET 215 351 351 MET MET A . n A 1 216 SER 216 352 352 SER SER A . n A 1 217 LEU 217 353 353 LEU LEU A . n A 1 218 CYS 218 354 354 CYS CYS A . n A 1 219 ARG 219 355 355 ARG ARG A . n A 1 220 HIS 220 356 356 HIS HIS A . n A 1 221 ASP 221 357 357 ASP ASP A . n A 1 222 TRP 222 358 358 TRP TRP A . n A 1 223 PRO 223 359 359 PRO PRO A . n A 1 224 GLY 224 360 360 GLY GLY A . n A 1 225 ASN 225 361 361 ASN ASN A . n A 1 226 VAL 226 362 362 VAL VAL A . n A 1 227 ARG 227 363 363 ARG ARG A . n A 1 228 GLU 228 364 364 GLU GLU A . n A 1 229 LEU 229 365 365 LEU LEU A . n A 1 230 ALA 230 366 366 ALA ALA A . n A 1 231 ASN 231 367 367 ASN ASN A . n A 1 232 LEU 232 368 368 LEU LEU A . n A 1 233 VAL 233 369 369 VAL VAL A . n A 1 234 GLU 234 370 370 GLU GLU A . n A 1 235 ARG 235 371 371 ARG ARG A . n A 1 236 LEU 236 372 372 LEU LEU A . n A 1 237 ALA 237 373 373 ALA ALA A . n A 1 238 ILE 238 374 374 ILE ILE A . n A 1 239 MET 239 375 375 MET MET A . n A 1 240 HIS 240 376 376 HIS HIS A . n A 1 241 PRO 241 377 377 PRO PRO A . n A 1 242 TYR 242 378 378 TYR TYR A . n A 1 243 GLY 243 379 379 GLY GLY A . n A 1 244 VAL 244 380 380 VAL VAL A . n A 1 245 ILE 245 381 381 ILE ILE A . n A 1 246 GLY 246 382 382 GLY GLY A . n A 1 247 VAL 247 383 383 VAL VAL A . n A 1 248 GLY 248 384 384 GLY GLY A . n A 1 249 GLU 249 385 385 GLU GLU A . n A 1 250 LEU 250 386 386 LEU LEU A . n A 1 251 PRO 251 387 387 PRO PRO A . n A 1 252 LYS 252 388 388 LYS LYS A . n A 1 253 LYS 253 389 389 LYS LYS A . n A 1 254 PHE 254 390 390 PHE PHE A . n A 1 255 ARG 255 391 391 ARG ARG A . n A 1 256 HIS 256 392 392 HIS HIS A . n A 1 257 VAL 257 393 393 VAL VAL A . n A 1 258 ASP 258 394 ? ? ? A . n A 1 259 ASP 259 395 ? ? ? A . n A 1 260 GLU 260 396 ? ? ? A . n A 1 261 ASP 261 397 ? ? ? A . n A 1 262 GLU 262 398 ? ? ? A . n A 1 263 GLN 263 399 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 AGS 1 401 401 AGS AGS A . C 3 MG 1 402 1 MG MG A . D 4 HOH 1 501 52 HOH HOH A . D 4 HOH 2 502 9 HOH HOH A . D 4 HOH 3 503 60 HOH HOH A . D 4 HOH 4 504 44 HOH HOH A . D 4 HOH 5 505 16 HOH HOH A . D 4 HOH 6 506 45 HOH HOH A . D 4 HOH 7 507 35 HOH HOH A . D 4 HOH 8 508 51 HOH HOH A . D 4 HOH 9 509 23 HOH HOH A . D 4 HOH 10 510 12 HOH HOH A . D 4 HOH 11 511 41 HOH HOH A . D 4 HOH 12 512 13 HOH HOH A . D 4 HOH 13 513 71 HOH HOH A . D 4 HOH 14 514 14 HOH HOH A . D 4 HOH 15 515 7 HOH HOH A . D 4 HOH 16 516 56 HOH HOH A . D 4 HOH 17 517 57 HOH HOH A . D 4 HOH 18 518 1 HOH HOH A . D 4 HOH 19 519 28 HOH HOH A . D 4 HOH 20 520 5 HOH HOH A . D 4 HOH 21 521 58 HOH HOH A . D 4 HOH 22 522 8 HOH HOH A . D 4 HOH 23 523 46 HOH HOH A . D 4 HOH 24 524 3 HOH HOH A . D 4 HOH 25 525 21 HOH HOH A . D 4 HOH 26 526 48 HOH HOH A . D 4 HOH 27 527 19 HOH HOH A . D 4 HOH 28 528 26 HOH HOH A . D 4 HOH 29 529 34 HOH HOH A . D 4 HOH 30 530 2 HOH HOH A . D 4 HOH 31 531 6 HOH HOH A . D 4 HOH 32 532 49 HOH HOH A . D 4 HOH 33 533 73 HOH HOH A . D 4 HOH 34 534 11 HOH HOH A . D 4 HOH 35 535 15 HOH HOH A . D 4 HOH 36 536 32 HOH HOH A . D 4 HOH 37 537 25 HOH HOH A . D 4 HOH 38 538 20 HOH HOH A . D 4 HOH 39 539 47 HOH HOH A . D 4 HOH 40 540 65 HOH HOH A . D 4 HOH 41 541 72 HOH HOH A . D 4 HOH 42 542 17 HOH HOH A . D 4 HOH 43 543 59 HOH HOH A . D 4 HOH 44 544 42 HOH HOH A . D 4 HOH 45 545 30 HOH HOH A . D 4 HOH 46 546 50 HOH HOH A . D 4 HOH 47 547 10 HOH HOH A . D 4 HOH 48 548 37 HOH HOH A . D 4 HOH 49 549 22 HOH HOH A . D 4 HOH 50 550 31 HOH HOH A . D 4 HOH 51 551 74 HOH HOH A . D 4 HOH 52 552 70 HOH HOH A . D 4 HOH 53 553 40 HOH HOH A . D 4 HOH 54 554 18 HOH HOH A . D 4 HOH 55 555 33 HOH HOH A . D 4 HOH 56 556 27 HOH HOH A . D 4 HOH 57 557 4 HOH HOH A . D 4 HOH 58 558 54 HOH HOH A . D 4 HOH 59 559 24 HOH HOH A . D 4 HOH 60 560 61 HOH HOH A . D 4 HOH 61 561 53 HOH HOH A . D 4 HOH 62 562 64 HOH HOH A . D 4 HOH 63 563 29 HOH HOH A . D 4 HOH 64 564 68 HOH HOH A . D 4 HOH 65 565 43 HOH HOH A . D 4 HOH 66 566 36 HOH HOH A . D 4 HOH 67 567 66 HOH HOH A . D 4 HOH 68 568 62 HOH HOH A . D 4 HOH 69 569 55 HOH HOH A . D 4 HOH 70 570 39 HOH HOH A . D 4 HOH 71 571 38 HOH HOH A . D 4 HOH 72 572 69 HOH HOH A . D 4 HOH 73 573 63 HOH HOH A . D 4 HOH 74 574 75 HOH HOH A . D 4 HOH 75 575 67 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1040 ? 1 MORE -10 ? 1 'SSA (A^2)' 12790 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 45 ? A GLU 181 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O2G ? B AGS . ? A AGS 401 ? 1_555 152.3 ? 2 OE1 ? A GLU 45 ? A GLU 181 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 516 ? 1_555 125.0 ? 3 O2G ? B AGS . ? A AGS 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 516 ? 1_555 67.8 ? 4 OE1 ? A GLU 45 ? A GLU 181 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 534 ? 6_554 86.7 ? 5 O2G ? B AGS . ? A AGS 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 534 ? 6_554 77.8 ? 6 O ? D HOH . ? A HOH 516 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 534 ? 6_554 63.8 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2019-11-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 32.1239 -26.1769 0.5518 0.4482 0.3550 0.4693 0.0918 0.0623 0.0657 7.1120 7.0227 1.8385 0.6348 0.7362 1.4262 -0.1359 0.0671 -0.7328 -0.4620 0.0940 -0.8715 0.4889 0.5944 0.0277 'X-RAY DIFFRACTION' 2 ? refined 14.1315 -21.1033 -9.8870 0.4566 0.2686 0.2717 -0.0011 0.0042 0.0285 3.6376 3.2024 2.8153 -0.7655 1.3525 -0.6932 0.2110 0.3515 -0.0492 -0.6429 -0.1547 0.2227 0.3067 -0.0584 -0.0169 'X-RAY DIFFRACTION' 3 ? refined 37.9725 -11.2896 3.2718 0.2348 0.3831 0.2998 0.0519 -0.0401 0.0229 4.6772 2.6499 0.8607 2.8830 -0.3454 -0.2481 0.0933 -0.2643 -0.2924 0.0776 -0.1229 -0.3770 0.0900 0.3371 0.0259 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 142 through 179 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 180 through 295 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 296 through 393 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 143 ? ? -20.14 124.93 2 1 ILE A 206 ? ? -27.91 121.84 3 1 ILE A 227 ? ? 60.18 -58.91 4 1 THR A 228 ? ? -93.42 -123.29 5 1 SER A 229 ? ? -171.84 129.47 6 1 ASN A 308 ? ? -84.31 47.19 7 1 ASN A 361 ? ? 46.89 -132.05 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 137 ? A GLY 1 2 1 Y 1 A PRO 138 ? A PRO 2 3 1 Y 1 A LEU 139 ? A LEU 3 4 1 Y 1 A GLY 140 ? A GLY 4 5 1 Y 1 A SER 141 ? A SER 5 6 1 Y 1 A ASP 394 ? A ASP 258 7 1 Y 1 A ASP 395 ? A ASP 259 8 1 Y 1 A GLU 396 ? A GLU 260 9 1 Y 1 A ASP 397 ? A ASP 261 10 1 Y 1 A GLU 398 ? A GLU 262 11 1 Y 1 A GLN 399 ? A GLN 263 # _pdbx_audit_support.funding_organization 'Department of Biotechnology (India)' _pdbx_audit_support.country India _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 AGS ? ? AGS ? ? 'SUBJECT OF INVESTIGATION' ? 2 MG ? ? MG ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER' AGS 3 'MAGNESIUM ION' MG 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #