data_6JFG # _entry.id 6JFG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6JFG pdb_00006jfg 10.2210/pdb6jfg/pdb WWPDB D_1300011009 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6JFG _pdbx_database_status.recvd_initial_deposition_date 2019-02-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lee, I.H.' 1 0000-0003-3529-470X 'Ho, T.H.' 2 0000-0002-3706-7917 'Kang, L.W.' 3 0000-0002-1411-3132 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'K1U bound crystal structure of class II peptide deformylase from methicillin resistant Staphylococcus aureus' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, I.H.' 1 0000-0003-3529-470X primary 'Ho, T.H.' 2 0000-0002-3706-7917 primary 'Kang, L.W.' 3 0000-0002-1411-3132 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6JFG _cell.details ? _cell.formula_units_Z ? _cell.length_a 96.908 _cell.length_a_esd ? _cell.length_b 120.320 _cell.length_b_esd ? _cell.length_c 47.571 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6JFG _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptide deformylase' 20588.576 1 3.5.1.88 ? ? ? 2 non-polymer syn 'NICKEL (II) ION' 58.693 1 ? ? ? ? 3 non-polymer syn '(3R)-3-benzyl-4-oxo-4-[(2-oxo-2-phenylethyl)sulfanyl]butanoic acid' 342.409 1 ? ? ? ? 4 water nat water 18.015 14 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PDF,Polypeptide deformylase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDD GSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLN GVMFYDHIDKNHPLQPHTDAVEV ; _entity_poly.pdbx_seq_one_letter_code_can ;MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDD GSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLN GVMFYDHIDKNHPLQPHTDAVEV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 THR n 1 4 MET n 1 5 LYS n 1 6 ASP n 1 7 ILE n 1 8 ILE n 1 9 ARG n 1 10 ASP n 1 11 GLY n 1 12 HIS n 1 13 PRO n 1 14 THR n 1 15 LEU n 1 16 ARG n 1 17 GLN n 1 18 LYS n 1 19 ALA n 1 20 ALA n 1 21 GLU n 1 22 LEU n 1 23 GLU n 1 24 LEU n 1 25 PRO n 1 26 LEU n 1 27 THR n 1 28 LYS n 1 29 GLU n 1 30 GLU n 1 31 LYS n 1 32 GLU n 1 33 THR n 1 34 LEU n 1 35 ILE n 1 36 ALA n 1 37 MET n 1 38 ARG n 1 39 GLU n 1 40 PHE n 1 41 LEU n 1 42 VAL n 1 43 ASN n 1 44 SER n 1 45 GLN n 1 46 ASP n 1 47 GLU n 1 48 GLU n 1 49 ILE n 1 50 ALA n 1 51 LYS n 1 52 ARG n 1 53 TYR n 1 54 GLY n 1 55 LEU n 1 56 ARG n 1 57 SER n 1 58 GLY n 1 59 VAL n 1 60 GLY n 1 61 LEU n 1 62 ALA n 1 63 ALA n 1 64 PRO n 1 65 GLN n 1 66 ILE n 1 67 ASN n 1 68 ILE n 1 69 SER n 1 70 LYS n 1 71 ARG n 1 72 MET n 1 73 ILE n 1 74 ALA n 1 75 VAL n 1 76 LEU n 1 77 ILE n 1 78 PRO n 1 79 ASP n 1 80 ASP n 1 81 GLY n 1 82 SER n 1 83 GLY n 1 84 LYS n 1 85 SER n 1 86 TYR n 1 87 ASP n 1 88 TYR n 1 89 MET n 1 90 LEU n 1 91 VAL n 1 92 ASN n 1 93 PRO n 1 94 LYS n 1 95 ILE n 1 96 VAL n 1 97 SER n 1 98 HIS n 1 99 SER n 1 100 VAL n 1 101 GLN n 1 102 GLU n 1 103 ALA n 1 104 TYR n 1 105 LEU n 1 106 PRO n 1 107 THR n 1 108 GLY n 1 109 GLU n 1 110 GLY n 1 111 CYS n 1 112 LEU n 1 113 SER n 1 114 VAL n 1 115 ASP n 1 116 ASP n 1 117 ASN n 1 118 VAL n 1 119 ALA n 1 120 GLY n 1 121 LEU n 1 122 VAL n 1 123 HIS n 1 124 ARG n 1 125 HIS n 1 126 ASN n 1 127 ARG n 1 128 ILE n 1 129 THR n 1 130 ILE n 1 131 LYS n 1 132 ALA n 1 133 LYS n 1 134 ASP n 1 135 ILE n 1 136 GLU n 1 137 GLY n 1 138 ASN n 1 139 ASP n 1 140 ILE n 1 141 GLN n 1 142 LEU n 1 143 ARG n 1 144 LEU n 1 145 LYS n 1 146 GLY n 1 147 TYR n 1 148 PRO n 1 149 ALA n 1 150 ILE n 1 151 VAL n 1 152 PHE n 1 153 GLN n 1 154 HIS n 1 155 GLU n 1 156 ILE n 1 157 ASP n 1 158 HIS n 1 159 LEU n 1 160 ASN n 1 161 GLY n 1 162 VAL n 1 163 MET n 1 164 PHE n 1 165 TYR n 1 166 ASP n 1 167 HIS n 1 168 ILE n 1 169 ASP n 1 170 LYS n 1 171 ASN n 1 172 HIS n 1 173 PRO n 1 174 LEU n 1 175 GLN n 1 176 PRO n 1 177 HIS n 1 178 THR n 1 179 ASP n 1 180 ALA n 1 181 VAL n 1 182 GLU n 1 183 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 183 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'def, def1, pdf1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain CCARM3089 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET29b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DEF_STAAU _struct_ref.pdbx_db_accession P68826 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDD GSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLN GVMFYDHIDKNHPLQPHTDAVEV ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6JFG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P68826 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K1U non-polymer . '(3R)-3-benzyl-4-oxo-4-[(2-oxo-2-phenylethyl)sulfanyl]butanoic acid' ? 'C19 H18 O4 S' 342.409 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6JFG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.37 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.48 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 287 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.02M CaCl2, 0.1M MgCl2, 15% (v/v) Glycerol, 25% (w/v) PEG 4K, 0.05M Tris pH 8.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-03-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97940 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97940 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6JFG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.600 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8404 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.200 _reflns.pdbx_Rmerge_I_obs 0.147 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 4.992 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.166 _reflns.pdbx_Rpim_I_all 0.076 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.600 2.640 ? ? ? ? ? ? 430 96.000 ? ? ? ? 0.486 ? ? ? ? ? ? ? ? 3.200 ? 1.190 ? ? 0.573 0.297 ? 1 1 0.584 ? 2.640 2.690 ? ? ? ? ? ? 405 95.500 ? ? ? ? 0.445 ? ? ? ? ? ? ? ? 3.300 ? 1.265 ? ? 0.522 0.266 ? 2 1 0.563 ? 2.690 2.740 ? ? ? ? ? ? 430 95.800 ? ? ? ? 0.427 ? ? ? ? ? ? ? ? 3.500 ? 1.249 ? ? 0.500 0.253 ? 3 1 0.688 ? 2.740 2.800 ? ? ? ? ? ? 390 93.100 ? ? ? ? 0.379 ? ? ? ? ? ? ? ? 3.500 ? 1.363 ? ? 0.441 0.220 ? 4 1 0.751 ? 2.800 2.860 ? ? ? ? ? ? 405 94.400 ? ? ? ? 0.357 ? ? ? ? ? ? ? ? 3.400 ? 1.361 ? ? 0.418 0.213 ? 5 1 0.811 ? 2.860 2.930 ? ? ? ? ? ? 424 96.100 ? ? ? ? 0.324 ? ? ? ? ? ? ? ? 3.600 ? 1.444 ? ? 0.377 0.189 ? 6 1 0.850 ? 2.930 3.000 ? ? ? ? ? ? 423 95.900 ? ? ? ? 0.299 ? ? ? ? ? ? ? ? 3.600 ? 1.697 ? ? 0.348 0.173 ? 7 1 0.851 ? 3.000 3.080 ? ? ? ? ? ? 416 95.400 ? ? ? ? 0.268 ? ? ? ? ? ? ? ? 3.900 ? 2.172 ? ? 0.307 0.146 ? 8 1 0.912 ? 3.080 3.170 ? ? ? ? ? ? 422 95.300 ? ? ? ? 0.249 ? ? ? ? ? ? ? ? 3.900 ? 2.098 ? ? 0.286 0.137 ? 9 1 0.926 ? 3.170 3.280 ? ? ? ? ? ? 404 95.100 ? ? ? ? 0.229 ? ? ? ? ? ? ? ? 4.100 ? 2.513 ? ? 0.261 0.123 ? 10 1 0.943 ? 3.280 3.390 ? ? ? ? ? ? 431 96.400 ? ? ? ? 0.209 ? ? ? ? ? ? ? ? 4.300 ? 3.067 ? ? 0.240 0.115 ? 11 1 0.900 ? 3.390 3.530 ? ? ? ? ? ? 405 94.600 ? ? ? ? 0.187 ? ? ? ? ? ? ? ? 4.500 ? 3.512 ? ? 0.211 0.095 ? 12 1 0.954 ? 3.530 3.690 ? ? ? ? ? ? 424 93.600 ? ? ? ? 0.165 ? ? ? ? ? ? ? ? 4.500 ? 4.745 ? ? 0.188 0.087 ? 13 1 0.952 ? 3.690 3.880 ? ? ? ? ? ? 414 93.900 ? ? ? ? 0.173 ? ? ? ? ? ? ? ? 4.700 ? 9.043 ? ? 0.195 0.088 ? 14 1 0.939 ? 3.880 4.130 ? ? ? ? ? ? 424 95.700 ? ? ? ? 0.138 ? ? ? ? ? ? ? ? 4.900 ? 7.779 ? ? 0.155 0.069 ? 15 1 0.980 ? 4.130 4.450 ? ? ? ? ? ? 421 94.800 ? ? ? ? 0.133 ? ? ? ? ? ? ? ? 5.000 ? 8.709 ? ? 0.149 0.065 ? 16 1 0.975 ? 4.450 4.890 ? ? ? ? ? ? 431 94.100 ? ? ? ? 0.124 ? ? ? ? ? ? ? ? 4.700 ? 11.979 ? ? 0.139 0.061 ? 17 1 0.979 ? 4.890 5.600 ? ? ? ? ? ? 423 94.000 ? ? ? ? 0.098 ? ? ? ? ? ? ? ? 4.900 ? 6.720 ? ? 0.109 0.047 ? 18 1 0.990 ? 5.600 7.050 ? ? ? ? ? ? 437 93.000 ? ? ? ? 0.098 ? ? ? ? ? ? ? ? 5.200 ? 6.694 ? ? 0.108 0.046 ? 19 1 0.989 ? 7.050 50.000 ? ? ? ? ? ? 445 89.400 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 5.200 ? 8.662 ? ? 0.095 0.042 ? 20 1 0.983 ? # _refine.aniso_B[1][1] 0.0600 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -0.0300 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.0300 _refine.B_iso_max 114.110 _refine.B_iso_mean 45.5120 _refine.B_iso_min 18.860 _refine.correlation_coeff_Fo_to_Fc 0.9400 _refine.correlation_coeff_Fo_to_Fc_free 0.8920 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6JFG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6000 _refine.ls_d_res_low 49.9900 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8014 _refine.ls_number_reflns_R_free 384 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.5300 _refine.ls_percent_reflns_R_free 4.6000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2016 _refine.ls_R_factor_R_free 0.2653 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1986 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1LM4 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.4390 _refine.pdbx_overall_ESU_R_Free 0.3050 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 11.4650 _refine.overall_SU_ML 0.2350 _refine.overall_SU_R_Cruickshank_DPI 0.4390 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.6000 _refine_hist.d_res_low 49.9900 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.number_atoms_solvent 14 _refine_hist.number_atoms_total 1461 _refine_hist.pdbx_number_residues_total 183 _refine_hist.pdbx_B_iso_mean_ligand 101.08 _refine_hist.pdbx_B_iso_mean_solvent 33.25 _refine_hist.pdbx_number_atoms_protein 1422 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.019 1473 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1369 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.800 1.984 1995 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.019 3.000 3174 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.022 5.000 182 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.348 24.627 67 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.317 15.000 252 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.518 15.000 9 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.116 0.200 226 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.021 1637 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 276 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.6030 _refine_ls_shell.d_res_low 2.6700 _refine_ls_shell.number_reflns_all 623 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 26 _refine_ls_shell.number_reflns_R_work 597 _refine_ls_shell.percent_reflns_obs 95.1100 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4950 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2950 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6JFG _struct.title 'K1U bound crystal structure of class II peptide deformylase from methicillin resistant Staphylococcus aureus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6JFG _struct_keywords.text 'peptide deformylase, hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 3 ? ILE A 7 ? THR A 3 ILE A 7 5 ? 5 HELX_P HELX_P2 AA2 HIS A 12 ? GLN A 17 ? HIS A 12 GLN A 17 5 ? 6 HELX_P HELX_P3 AA3 THR A 27 ? GLN A 45 ? THR A 27 GLN A 45 1 ? 19 HELX_P HELX_P4 AA4 ASP A 46 ? GLY A 54 ? ASP A 46 GLY A 54 1 ? 9 HELX_P HELX_P5 AA5 PRO A 64 ? ASN A 67 ? PRO A 64 ASN A 67 5 ? 4 HELX_P HELX_P6 AA6 GLY A 146 ? ASN A 160 ? GLY A 146 ASN A 160 1 ? 15 HELX_P HELX_P7 AA7 MET A 163 ? ILE A 168 ? MET A 163 ILE A 168 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 111 SG ? ? ? 1_555 B NI . NI ? ? A CYS 111 A NI 201 1_555 ? ? ? ? ? ? ? 2.012 ? ? metalc2 metalc ? ? A HIS 154 NE2 ? ? ? 1_555 B NI . NI ? ? A HIS 154 A NI 201 1_555 ? ? ? ? ? ? ? 2.355 ? ? metalc3 metalc ? ? A HIS 158 NE2 ? ? ? 1_555 B NI . NI ? ? A HIS 158 A NI 201 1_555 ? ? ? ? ? ? ? 2.392 ? ? metalc4 metalc ? ? B NI . NI ? ? ? 1_555 C K1U . O1 ? ? A NI 201 A K1U 202 1_555 ? ? ? ? ? ? ? 2.623 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 24 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 24 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 25 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 25 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.52 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 60 ? ALA A 62 ? GLY A 60 ALA A 62 AA1 2 MET A 72 ? ILE A 77 ? MET A 72 ILE A 77 AA1 3 TYR A 86 ? HIS A 98 ? TYR A 86 HIS A 98 AA1 4 ARG A 127 ? LYS A 133 ? ARG A 127 LYS A 133 AA1 5 ASP A 139 ? LYS A 145 ? ASP A 139 LYS A 145 AA2 1 ARG A 124 ? HIS A 125 ? ARG A 124 HIS A 125 AA2 2 GLU A 102 ? TYR A 104 ? GLU A 102 TYR A 104 AA2 3 VAL A 181 ? GLU A 182 ? VAL A 181 GLU A 182 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 61 ? N LEU A 61 O ALA A 74 ? O ALA A 74 AA1 2 3 N ILE A 77 ? N ILE A 77 O TYR A 86 ? O TYR A 86 AA1 3 4 N VAL A 91 ? N VAL A 91 O LYS A 133 ? O LYS A 133 AA1 4 5 N ILE A 128 ? N ILE A 128 O LEU A 144 ? O LEU A 144 AA2 1 2 O ARG A 124 ? O ARG A 124 N ALA A 103 ? N ALA A 103 AA2 2 3 N GLU A 102 ? N GLU A 102 O VAL A 181 ? O VAL A 181 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A NI 201 ? 5 'binding site for residue NI A 201' AC2 Software A K1U 202 ? 13 'binding site for residue K1U A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLN A 65 ? GLN A 65 . ? 1_555 ? 2 AC1 5 CYS A 111 ? CYS A 111 . ? 1_555 ? 3 AC1 5 HIS A 154 ? HIS A 154 . ? 1_555 ? 4 AC1 5 HIS A 158 ? HIS A 158 . ? 1_555 ? 5 AC1 5 K1U C . ? K1U A 202 . ? 1_555 ? 6 AC2 13 SER A 57 ? SER A 57 . ? 1_555 ? 7 AC2 13 GLY A 58 ? GLY A 58 . ? 1_555 ? 8 AC2 13 VAL A 59 ? VAL A 59 . ? 1_555 ? 9 AC2 13 GLY A 60 ? GLY A 60 . ? 1_555 ? 10 AC2 13 GLN A 65 ? GLN A 65 . ? 1_555 ? 11 AC2 13 LEU A 105 ? LEU A 105 . ? 1_555 ? 12 AC2 13 GLY A 110 ? GLY A 110 . ? 1_555 ? 13 AC2 13 CYS A 111 ? CYS A 111 . ? 1_555 ? 14 AC2 13 LEU A 112 ? LEU A 112 . ? 1_555 ? 15 AC2 13 HIS A 154 ? HIS A 154 . ? 1_555 ? 16 AC2 13 GLU A 155 ? GLU A 155 . ? 1_555 ? 17 AC2 13 HIS A 158 ? HIS A 158 . ? 1_555 ? 18 AC2 13 NI B . ? NI A 201 . ? 1_555 ? # _atom_sites.entry_id 6JFG _atom_sites.fract_transf_matrix[1][1] 0.010319 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008311 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021021 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N NI O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 CYS 111 111 111 CYS CYS A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 HIS 154 154 154 HIS HIS A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 HIS 158 158 158 HIS HIS A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 ASN 160 160 160 ASN ASN A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 MET 163 163 163 MET MET A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 HIS 167 167 167 HIS HIS A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 PRO 173 173 173 PRO PRO A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 GLN 175 175 175 GLN GLN A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 HIS 177 177 177 HIS HIS A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 VAL 183 183 183 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NI 1 201 1 NI NI A . C 3 K1U 1 202 1 K1U K1U A . D 4 HOH 1 301 12 HOH HOH A . D 4 HOH 2 302 4 HOH HOH A . D 4 HOH 3 303 9 HOH HOH A . D 4 HOH 4 304 1 HOH HOH A . D 4 HOH 5 305 5 HOH HOH A . D 4 HOH 6 306 8 HOH HOH A . D 4 HOH 7 307 2 HOH HOH A . D 4 HOH 8 308 3 HOH HOH A . D 4 HOH 9 309 10 HOH HOH A . D 4 HOH 10 310 14 HOH HOH A . D 4 HOH 11 311 6 HOH HOH A . D 4 HOH 12 312 7 HOH HOH A . D 4 HOH 13 313 13 HOH HOH A . D 4 HOH 14 314 11 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 120 ? 1 MORE -12 ? 1 'SSA (A^2)' 9500 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 111 ? A CYS 111 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 154 ? A HIS 154 ? 1_555 135.9 ? 2 SG ? A CYS 111 ? A CYS 111 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 158 ? A HIS 158 ? 1_555 109.2 ? 3 NE2 ? A HIS 154 ? A HIS 154 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 158 ? A HIS 158 ? 1_555 96.0 ? 4 SG ? A CYS 111 ? A CYS 111 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 O1 ? C K1U . ? A K1U 202 ? 1_555 132.9 ? 5 NE2 ? A HIS 154 ? A HIS 154 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 O1 ? C K1U . ? A K1U 202 ? 1_555 80.5 ? 6 NE2 ? A HIS 158 ? A HIS 158 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 O1 ? C K1U . ? A K1U 202 ? 1_555 90.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-02-12 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 2 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OXT _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 VAL _pdbx_validate_close_contact.auth_seq_id_1 183 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.95 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OD2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASP _pdbx_validate_symm_contact.auth_seq_id_1 139 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NH2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ARG _pdbx_validate_symm_contact.auth_seq_id_2 143 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_455 _pdbx_validate_symm_contact.dist 2.13 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 143 ? ? CZ A ARG 143 ? ? NH1 A ARG 143 ? ? 124.06 120.30 3.76 0.50 N 2 1 NE A ARG 143 ? ? CZ A ARG 143 ? ? NH2 A ARG 143 ? ? 117.28 120.30 -3.02 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 79 ? ? -44.33 -70.06 2 1 ASP A 80 ? ? 54.97 73.53 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 28 ? CG ? A LYS 28 CG 2 1 Y 1 A LYS 28 ? CD ? A LYS 28 CD 3 1 Y 1 A LYS 28 ? CE ? A LYS 28 CE 4 1 Y 1 A LYS 28 ? NZ ? A LYS 28 NZ 5 1 Y 1 A LYS 51 ? CG ? A LYS 51 CG 6 1 Y 1 A LYS 51 ? CD ? A LYS 51 CD 7 1 Y 1 A LYS 51 ? CE ? A LYS 51 CE 8 1 Y 1 A LYS 51 ? NZ ? A LYS 51 NZ 9 1 Y 1 A ASP 80 ? CG ? A ASP 80 CG 10 1 Y 1 A ASP 80 ? OD1 ? A ASP 80 OD1 11 1 Y 1 A ASP 80 ? OD2 ? A ASP 80 OD2 12 1 Y 1 A LYS 84 ? CG ? A LYS 84 CG 13 1 Y 1 A LYS 84 ? CD ? A LYS 84 CD 14 1 Y 1 A LYS 84 ? CE ? A LYS 84 CE 15 1 Y 1 A LYS 84 ? NZ ? A LYS 84 NZ 16 1 Y 1 A LYS 170 ? CG ? A LYS 170 CG 17 1 Y 1 A LYS 170 ? CD ? A LYS 170 CD 18 1 Y 1 A LYS 170 ? CE ? A LYS 170 CE 19 1 Y 1 A LYS 170 ? NZ ? A LYS 170 NZ 20 1 Y 1 A ASP 179 ? CG ? A ASP 179 CG 21 1 Y 1 A ASP 179 ? OD1 ? A ASP 179 OD1 22 1 Y 1 A ASP 179 ? OD2 ? A ASP 179 OD2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 K1U O1 O N N 183 K1U C8 C N N 184 K1U O2 O N N 185 K1U C24 C N N 186 K1U C9 C N R 187 K1U C1 C N N 188 K1U C2 C Y N 189 K1U C3 C Y N 190 K1U C4 C Y N 191 K1U C5 C Y N 192 K1U C6 C Y N 193 K1U C7 C Y N 194 K1U C10 C N N 195 K1U O3 O N N 196 K1U S1 S N N 197 K1U C11 C N N 198 K1U C12 C N N 199 K1U O4 O N N 200 K1U C13 C Y N 201 K1U C14 C Y N 202 K1U C15 C Y N 203 K1U C16 C Y N 204 K1U C17 C Y N 205 K1U C18 C Y N 206 K1U H1 H N N 207 K1U H2 H N N 208 K1U H3 H N N 209 K1U H4 H N N 210 K1U H5 H N N 211 K1U H6 H N N 212 K1U H7 H N N 213 K1U H8 H N N 214 K1U H9 H N N 215 K1U H10 H N N 216 K1U H11 H N N 217 K1U H12 H N N 218 K1U H13 H N N 219 K1U H14 H N N 220 K1U H15 H N N 221 K1U H16 H N N 222 K1U H17 H N N 223 K1U H18 H N N 224 LEU N N N N 225 LEU CA C N S 226 LEU C C N N 227 LEU O O N N 228 LEU CB C N N 229 LEU CG C N N 230 LEU CD1 C N N 231 LEU CD2 C N N 232 LEU OXT O N N 233 LEU H H N N 234 LEU H2 H N N 235 LEU HA H N N 236 LEU HB2 H N N 237 LEU HB3 H N N 238 LEU HG H N N 239 LEU HD11 H N N 240 LEU HD12 H N N 241 LEU HD13 H N N 242 LEU HD21 H N N 243 LEU HD22 H N N 244 LEU HD23 H N N 245 LEU HXT H N N 246 LYS N N N N 247 LYS CA C N S 248 LYS C C N N 249 LYS O O N N 250 LYS CB C N N 251 LYS CG C N N 252 LYS CD C N N 253 LYS CE C N N 254 LYS NZ N N N 255 LYS OXT O N N 256 LYS H H N N 257 LYS H2 H N N 258 LYS HA H N N 259 LYS HB2 H N N 260 LYS HB3 H N N 261 LYS HG2 H N N 262 LYS HG3 H N N 263 LYS HD2 H N N 264 LYS HD3 H N N 265 LYS HE2 H N N 266 LYS HE3 H N N 267 LYS HZ1 H N N 268 LYS HZ2 H N N 269 LYS HZ3 H N N 270 LYS HXT H N N 271 MET N N N N 272 MET CA C N S 273 MET C C N N 274 MET O O N N 275 MET CB C N N 276 MET CG C N N 277 MET SD S N N 278 MET CE C N N 279 MET OXT O N N 280 MET H H N N 281 MET H2 H N N 282 MET HA H N N 283 MET HB2 H N N 284 MET HB3 H N N 285 MET HG2 H N N 286 MET HG3 H N N 287 MET HE1 H N N 288 MET HE2 H N N 289 MET HE3 H N N 290 MET HXT H N N 291 NI NI NI N N 292 PHE N N N N 293 PHE CA C N S 294 PHE C C N N 295 PHE O O N N 296 PHE CB C N N 297 PHE CG C Y N 298 PHE CD1 C Y N 299 PHE CD2 C Y N 300 PHE CE1 C Y N 301 PHE CE2 C Y N 302 PHE CZ C Y N 303 PHE OXT O N N 304 PHE H H N N 305 PHE H2 H N N 306 PHE HA H N N 307 PHE HB2 H N N 308 PHE HB3 H N N 309 PHE HD1 H N N 310 PHE HD2 H N N 311 PHE HE1 H N N 312 PHE HE2 H N N 313 PHE HZ H N N 314 PHE HXT H N N 315 PRO N N N N 316 PRO CA C N S 317 PRO C C N N 318 PRO O O N N 319 PRO CB C N N 320 PRO CG C N N 321 PRO CD C N N 322 PRO OXT O N N 323 PRO H H N N 324 PRO HA H N N 325 PRO HB2 H N N 326 PRO HB3 H N N 327 PRO HG2 H N N 328 PRO HG3 H N N 329 PRO HD2 H N N 330 PRO HD3 H N N 331 PRO HXT H N N 332 SER N N N N 333 SER CA C N S 334 SER C C N N 335 SER O O N N 336 SER CB C N N 337 SER OG O N N 338 SER OXT O N N 339 SER H H N N 340 SER H2 H N N 341 SER HA H N N 342 SER HB2 H N N 343 SER HB3 H N N 344 SER HG H N N 345 SER HXT H N N 346 THR N N N N 347 THR CA C N S 348 THR C C N N 349 THR O O N N 350 THR CB C N R 351 THR OG1 O N N 352 THR CG2 C N N 353 THR OXT O N N 354 THR H H N N 355 THR H2 H N N 356 THR HA H N N 357 THR HB H N N 358 THR HG1 H N N 359 THR HG21 H N N 360 THR HG22 H N N 361 THR HG23 H N N 362 THR HXT H N N 363 TYR N N N N 364 TYR CA C N S 365 TYR C C N N 366 TYR O O N N 367 TYR CB C N N 368 TYR CG C Y N 369 TYR CD1 C Y N 370 TYR CD2 C Y N 371 TYR CE1 C Y N 372 TYR CE2 C Y N 373 TYR CZ C Y N 374 TYR OH O N N 375 TYR OXT O N N 376 TYR H H N N 377 TYR H2 H N N 378 TYR HA H N N 379 TYR HB2 H N N 380 TYR HB3 H N N 381 TYR HD1 H N N 382 TYR HD2 H N N 383 TYR HE1 H N N 384 TYR HE2 H N N 385 TYR HH H N N 386 TYR HXT H N N 387 VAL N N N N 388 VAL CA C N S 389 VAL C C N N 390 VAL O O N N 391 VAL CB C N N 392 VAL CG1 C N N 393 VAL CG2 C N N 394 VAL OXT O N N 395 VAL H H N N 396 VAL H2 H N N 397 VAL HA H N N 398 VAL HB H N N 399 VAL HG11 H N N 400 VAL HG12 H N N 401 VAL HG13 H N N 402 VAL HG21 H N N 403 VAL HG22 H N N 404 VAL HG23 H N N 405 VAL HXT H N N 406 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 K1U O2 C8 doub N N 173 K1U C8 O1 sing N N 174 K1U C8 C24 sing N N 175 K1U C24 C9 sing N N 176 K1U C9 C1 sing N N 177 K1U C9 C10 sing N N 178 K1U C1 C2 sing N N 179 K1U C10 O3 doub N N 180 K1U C10 S1 sing N N 181 K1U C3 C2 doub Y N 182 K1U C3 C4 sing Y N 183 K1U C2 C7 sing Y N 184 K1U S1 C11 sing N N 185 K1U C11 C12 sing N N 186 K1U C4 C5 doub Y N 187 K1U C7 C6 doub Y N 188 K1U C12 O4 doub N N 189 K1U C12 C13 sing N N 190 K1U C5 C6 sing Y N 191 K1U C13 C18 doub Y N 192 K1U C13 C14 sing Y N 193 K1U C18 C17 sing Y N 194 K1U C14 C15 doub Y N 195 K1U C17 C16 doub Y N 196 K1U C15 C16 sing Y N 197 K1U O1 H1 sing N N 198 K1U C24 H2 sing N N 199 K1U C24 H3 sing N N 200 K1U C9 H4 sing N N 201 K1U C1 H5 sing N N 202 K1U C1 H6 sing N N 203 K1U C3 H7 sing N N 204 K1U C4 H8 sing N N 205 K1U C5 H9 sing N N 206 K1U C6 H10 sing N N 207 K1U C7 H11 sing N N 208 K1U C11 H12 sing N N 209 K1U C11 H13 sing N N 210 K1U C14 H14 sing N N 211 K1U C15 H15 sing N N 212 K1U C16 H16 sing N N 213 K1U C17 H17 sing N N 214 K1U C18 H18 sing N N 215 LEU N CA sing N N 216 LEU N H sing N N 217 LEU N H2 sing N N 218 LEU CA C sing N N 219 LEU CA CB sing N N 220 LEU CA HA sing N N 221 LEU C O doub N N 222 LEU C OXT sing N N 223 LEU CB CG sing N N 224 LEU CB HB2 sing N N 225 LEU CB HB3 sing N N 226 LEU CG CD1 sing N N 227 LEU CG CD2 sing N N 228 LEU CG HG sing N N 229 LEU CD1 HD11 sing N N 230 LEU CD1 HD12 sing N N 231 LEU CD1 HD13 sing N N 232 LEU CD2 HD21 sing N N 233 LEU CD2 HD22 sing N N 234 LEU CD2 HD23 sing N N 235 LEU OXT HXT sing N N 236 LYS N CA sing N N 237 LYS N H sing N N 238 LYS N H2 sing N N 239 LYS CA C sing N N 240 LYS CA CB sing N N 241 LYS CA HA sing N N 242 LYS C O doub N N 243 LYS C OXT sing N N 244 LYS CB CG sing N N 245 LYS CB HB2 sing N N 246 LYS CB HB3 sing N N 247 LYS CG CD sing N N 248 LYS CG HG2 sing N N 249 LYS CG HG3 sing N N 250 LYS CD CE sing N N 251 LYS CD HD2 sing N N 252 LYS CD HD3 sing N N 253 LYS CE NZ sing N N 254 LYS CE HE2 sing N N 255 LYS CE HE3 sing N N 256 LYS NZ HZ1 sing N N 257 LYS NZ HZ2 sing N N 258 LYS NZ HZ3 sing N N 259 LYS OXT HXT sing N N 260 MET N CA sing N N 261 MET N H sing N N 262 MET N H2 sing N N 263 MET CA C sing N N 264 MET CA CB sing N N 265 MET CA HA sing N N 266 MET C O doub N N 267 MET C OXT sing N N 268 MET CB CG sing N N 269 MET CB HB2 sing N N 270 MET CB HB3 sing N N 271 MET CG SD sing N N 272 MET CG HG2 sing N N 273 MET CG HG3 sing N N 274 MET SD CE sing N N 275 MET CE HE1 sing N N 276 MET CE HE2 sing N N 277 MET CE HE3 sing N N 278 MET OXT HXT sing N N 279 PHE N CA sing N N 280 PHE N H sing N N 281 PHE N H2 sing N N 282 PHE CA C sing N N 283 PHE CA CB sing N N 284 PHE CA HA sing N N 285 PHE C O doub N N 286 PHE C OXT sing N N 287 PHE CB CG sing N N 288 PHE CB HB2 sing N N 289 PHE CB HB3 sing N N 290 PHE CG CD1 doub Y N 291 PHE CG CD2 sing Y N 292 PHE CD1 CE1 sing Y N 293 PHE CD1 HD1 sing N N 294 PHE CD2 CE2 doub Y N 295 PHE CD2 HD2 sing N N 296 PHE CE1 CZ doub Y N 297 PHE CE1 HE1 sing N N 298 PHE CE2 CZ sing Y N 299 PHE CE2 HE2 sing N N 300 PHE CZ HZ sing N N 301 PHE OXT HXT sing N N 302 PRO N CA sing N N 303 PRO N CD sing N N 304 PRO N H sing N N 305 PRO CA C sing N N 306 PRO CA CB sing N N 307 PRO CA HA sing N N 308 PRO C O doub N N 309 PRO C OXT sing N N 310 PRO CB CG sing N N 311 PRO CB HB2 sing N N 312 PRO CB HB3 sing N N 313 PRO CG CD sing N N 314 PRO CG HG2 sing N N 315 PRO CG HG3 sing N N 316 PRO CD HD2 sing N N 317 PRO CD HD3 sing N N 318 PRO OXT HXT sing N N 319 SER N CA sing N N 320 SER N H sing N N 321 SER N H2 sing N N 322 SER CA C sing N N 323 SER CA CB sing N N 324 SER CA HA sing N N 325 SER C O doub N N 326 SER C OXT sing N N 327 SER CB OG sing N N 328 SER CB HB2 sing N N 329 SER CB HB3 sing N N 330 SER OG HG sing N N 331 SER OXT HXT sing N N 332 THR N CA sing N N 333 THR N H sing N N 334 THR N H2 sing N N 335 THR CA C sing N N 336 THR CA CB sing N N 337 THR CA HA sing N N 338 THR C O doub N N 339 THR C OXT sing N N 340 THR CB OG1 sing N N 341 THR CB CG2 sing N N 342 THR CB HB sing N N 343 THR OG1 HG1 sing N N 344 THR CG2 HG21 sing N N 345 THR CG2 HG22 sing N N 346 THR CG2 HG23 sing N N 347 THR OXT HXT sing N N 348 TYR N CA sing N N 349 TYR N H sing N N 350 TYR N H2 sing N N 351 TYR CA C sing N N 352 TYR CA CB sing N N 353 TYR CA HA sing N N 354 TYR C O doub N N 355 TYR C OXT sing N N 356 TYR CB CG sing N N 357 TYR CB HB2 sing N N 358 TYR CB HB3 sing N N 359 TYR CG CD1 doub Y N 360 TYR CG CD2 sing Y N 361 TYR CD1 CE1 sing Y N 362 TYR CD1 HD1 sing N N 363 TYR CD2 CE2 doub Y N 364 TYR CD2 HD2 sing N N 365 TYR CE1 CZ doub Y N 366 TYR CE1 HE1 sing N N 367 TYR CE2 CZ sing Y N 368 TYR CE2 HE2 sing N N 369 TYR CZ OH sing N N 370 TYR OH HH sing N N 371 TYR OXT HXT sing N N 372 VAL N CA sing N N 373 VAL N H sing N N 374 VAL N H2 sing N N 375 VAL CA C sing N N 376 VAL CA CB sing N N 377 VAL CA HA sing N N 378 VAL C O doub N N 379 VAL C OXT sing N N 380 VAL CB CG1 sing N N 381 VAL CB CG2 sing N N 382 VAL CB HB sing N N 383 VAL CG1 HG11 sing N N 384 VAL CG1 HG12 sing N N 385 VAL CG1 HG13 sing N N 386 VAL CG2 HG21 sing N N 387 VAL CG2 HG22 sing N N 388 VAL CG2 HG23 sing N N 389 VAL OXT HXT sing N N 390 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id K1U _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id K1U _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'NICKEL (II) ION' NI 3 '(3R)-3-benzyl-4-oxo-4-[(2-oxo-2-phenylethyl)sulfanyl]butanoic acid' K1U 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1LM4 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #