data_6KG8 # _entry.id 6KG8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6KG8 pdb_00006kg8 10.2210/pdb6kg8/pdb WWPDB D_1300012940 ? ? BMRB 18188 ? 10.13018/BMR18188 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-07-08 2 'Structure model' 1 1 2020-11-04 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_database_2.pdbx_DOI' 11 3 'Structure model' '_database_2.pdbx_database_accession' 12 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 13 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6KG8 _pdbx_database_status.recvd_initial_deposition_date 2019-07-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB . 18188 unspecified PDB . 6KG9 unspecified PDB . 6KGF unspecified PDB . 6KGE unspecified PDB . 6KGD unspecified PDB . 6KGC unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Feng, Y.' 1 0000-0002-0879-1316 'Yao, X.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2375-2548 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Discovery and mechanism of a pH-dependent dual-binding-site switch in the interaction of a pair of protein modules.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/sciadv.abd7182 _citation.pdbx_database_id_PubMed 33097546 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yao, X.' 1 0000-0003-1333-9989 primary 'Chen, C.' 2 0000-0003-0789-7749 primary 'Wang, Y.' 3 0000-0002-7228-7712 primary 'Dong, S.' 4 0000-0002-0452-5221 primary 'Liu, Y.J.' 5 0000-0002-0899-5968 primary 'Li, Y.' 6 0000-0003-3703-8910 primary 'Cui, Z.' 7 0000-0002-5664-8303 primary 'Gong, W.' 8 ? primary 'Perrett, S.' 9 0000-0003-0137-0997 primary 'Yao, L.' 10 ? primary 'Lamed, R.' 11 ? primary 'Bayer, E.A.' 12 ? primary 'Cui, Q.' 13 0000-0003-4669-424X primary 'Feng, Y.' 14 0000-0002-0879-1316 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Probably cellulosomal scaffolding protein, secreted cellulose-binding and cohesin domain' _entity.formula_weight 16027.812 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSASVKNETVKLSVGTVSGNPGDTVKVPVTISQVSTPVGLICMDISYDASKFTVKDVLPNTDLVKDTDNYSFIVNTSTPG KISITFTDPTLANYPISVDGILAYLDFIINSNATAGDSALTVDPATLIVADENDKDIKDAASNGKITVTGSAPTS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSASVKNETVKLSVGTVSGNPGDTVKVPVTISQVSTPVGLICMDISYDASKFTVKDVLPNTDLVKDTDNYSFIVNTSTPG KISITFTDPTLANYPISVDGILAYLDFIINSNATAGDSALTVDPATLIVADENDKDIKDAASNGKITVTGSAPTS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 SER n 1 5 VAL n 1 6 LYS n 1 7 ASN n 1 8 GLU n 1 9 THR n 1 10 VAL n 1 11 LYS n 1 12 LEU n 1 13 SER n 1 14 VAL n 1 15 GLY n 1 16 THR n 1 17 VAL n 1 18 SER n 1 19 GLY n 1 20 ASN n 1 21 PRO n 1 22 GLY n 1 23 ASP n 1 24 THR n 1 25 VAL n 1 26 LYS n 1 27 VAL n 1 28 PRO n 1 29 VAL n 1 30 THR n 1 31 ILE n 1 32 SER n 1 33 GLN n 1 34 VAL n 1 35 SER n 1 36 THR n 1 37 PRO n 1 38 VAL n 1 39 GLY n 1 40 LEU n 1 41 ILE n 1 42 CYS n 1 43 MET n 1 44 ASP n 1 45 ILE n 1 46 SER n 1 47 TYR n 1 48 ASP n 1 49 ALA n 1 50 SER n 1 51 LYS n 1 52 PHE n 1 53 THR n 1 54 VAL n 1 55 LYS n 1 56 ASP n 1 57 VAL n 1 58 LEU n 1 59 PRO n 1 60 ASN n 1 61 THR n 1 62 ASP n 1 63 LEU n 1 64 VAL n 1 65 LYS n 1 66 ASP n 1 67 THR n 1 68 ASP n 1 69 ASN n 1 70 TYR n 1 71 SER n 1 72 PHE n 1 73 ILE n 1 74 VAL n 1 75 ASN n 1 76 THR n 1 77 SER n 1 78 THR n 1 79 PRO n 1 80 GLY n 1 81 LYS n 1 82 ILE n 1 83 SER n 1 84 ILE n 1 85 THR n 1 86 PHE n 1 87 THR n 1 88 ASP n 1 89 PRO n 1 90 THR n 1 91 LEU n 1 92 ALA n 1 93 ASN n 1 94 TYR n 1 95 PRO n 1 96 ILE n 1 97 SER n 1 98 VAL n 1 99 ASP n 1 100 GLY n 1 101 ILE n 1 102 LEU n 1 103 ALA n 1 104 TYR n 1 105 LEU n 1 106 ASP n 1 107 PHE n 1 108 ILE n 1 109 ILE n 1 110 ASN n 1 111 SER n 1 112 ASN n 1 113 ALA n 1 114 THR n 1 115 ALA n 1 116 GLY n 1 117 ASP n 1 118 SER n 1 119 ALA n 1 120 LEU n 1 121 THR n 1 122 VAL n 1 123 ASP n 1 124 PRO n 1 125 ALA n 1 126 THR n 1 127 LEU n 1 128 ILE n 1 129 VAL n 1 130 ALA n 1 131 ASP n 1 132 GLU n 1 133 ASN n 1 134 ASP n 1 135 LYS n 1 136 ASP n 1 137 ILE n 1 138 LYS n 1 139 ASP n 1 140 ALA n 1 141 ALA n 1 142 SER n 1 143 ASN n 1 144 GLY n 1 145 LYS n 1 146 ILE n 1 147 THR n 1 148 VAL n 1 149 THR n 1 150 GLY n 1 151 SER n 1 152 ALA n 1 153 PRO n 1 154 THR n 1 155 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 155 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CA_C0910 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 824' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Clostridium acetobutylicum ATCC 824' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28aNS _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 -3 GLY GLY A . n A 1 2 SER 2 -2 -2 SER SER A . n A 1 3 ALA 3 -1 -1 ALA ALA A . n A 1 4 SER 4 0 0 SER SER A . n A 1 5 VAL 5 1 1 VAL VAL A . n A 1 6 LYS 6 2 2 LYS LYS A . n A 1 7 ASN 7 3 3 ASN ASN A . n A 1 8 GLU 8 4 4 GLU GLU A . n A 1 9 THR 9 5 5 THR THR A . n A 1 10 VAL 10 6 6 VAL VAL A . n A 1 11 LYS 11 7 7 LYS LYS A . n A 1 12 LEU 12 8 8 LEU LEU A . n A 1 13 SER 13 9 9 SER SER A . n A 1 14 VAL 14 10 10 VAL VAL A . n A 1 15 GLY 15 11 11 GLY GLY A . n A 1 16 THR 16 12 12 THR THR A . n A 1 17 VAL 17 13 13 VAL VAL A . n A 1 18 SER 18 14 14 SER SER A . n A 1 19 GLY 19 15 15 GLY GLY A . n A 1 20 ASN 20 16 16 ASN ASN A . n A 1 21 PRO 21 17 17 PRO PRO A . n A 1 22 GLY 22 18 18 GLY GLY A . n A 1 23 ASP 23 19 19 ASP ASP A . n A 1 24 THR 24 20 20 THR THR A . n A 1 25 VAL 25 21 21 VAL VAL A . n A 1 26 LYS 26 22 22 LYS LYS A . n A 1 27 VAL 27 23 23 VAL VAL A . n A 1 28 PRO 28 24 24 PRO PRO A . n A 1 29 VAL 29 25 25 VAL VAL A . n A 1 30 THR 30 26 26 THR THR A . n A 1 31 ILE 31 27 27 ILE ILE A . n A 1 32 SER 32 28 28 SER SER A . n A 1 33 GLN 33 29 29 GLN GLN A . n A 1 34 VAL 34 30 30 VAL VAL A . n A 1 35 SER 35 31 31 SER SER A . n A 1 36 THR 36 32 32 THR THR A . n A 1 37 PRO 37 33 33 PRO PRO A . n A 1 38 VAL 38 34 34 VAL VAL A . n A 1 39 GLY 39 35 35 GLY GLY A . n A 1 40 LEU 40 36 36 LEU LEU A . n A 1 41 ILE 41 37 37 ILE ILE A . n A 1 42 CYS 42 38 38 CYS CYS A . n A 1 43 MET 43 39 39 MET MET A . n A 1 44 ASP 44 40 40 ASP ASP A . n A 1 45 ILE 45 41 41 ILE ILE A . n A 1 46 SER 46 42 42 SER SER A . n A 1 47 TYR 47 43 43 TYR TYR A . n A 1 48 ASP 48 44 44 ASP ASP A . n A 1 49 ALA 49 45 45 ALA ALA A . n A 1 50 SER 50 46 46 SER SER A . n A 1 51 LYS 51 47 47 LYS LYS A . n A 1 52 PHE 52 48 48 PHE PHE A . n A 1 53 THR 53 49 49 THR THR A . n A 1 54 VAL 54 50 50 VAL VAL A . n A 1 55 LYS 55 51 51 LYS LYS A . n A 1 56 ASP 56 52 52 ASP ASP A . n A 1 57 VAL 57 53 53 VAL VAL A . n A 1 58 LEU 58 54 54 LEU LEU A . n A 1 59 PRO 59 55 55 PRO PRO A . n A 1 60 ASN 60 56 56 ASN ASN A . n A 1 61 THR 61 57 57 THR THR A . n A 1 62 ASP 62 58 58 ASP ASP A . n A 1 63 LEU 63 59 59 LEU LEU A . n A 1 64 VAL 64 60 60 VAL VAL A . n A 1 65 LYS 65 61 61 LYS LYS A . n A 1 66 ASP 66 62 62 ASP ASP A . n A 1 67 THR 67 63 63 THR THR A . n A 1 68 ASP 68 64 64 ASP ASP A . n A 1 69 ASN 69 65 65 ASN ASN A . n A 1 70 TYR 70 66 66 TYR TYR A . n A 1 71 SER 71 67 67 SER SER A . n A 1 72 PHE 72 68 68 PHE PHE A . n A 1 73 ILE 73 69 69 ILE ILE A . n A 1 74 VAL 74 70 70 VAL VAL A . n A 1 75 ASN 75 71 71 ASN ASN A . n A 1 76 THR 76 72 72 THR THR A . n A 1 77 SER 77 73 73 SER SER A . n A 1 78 THR 78 74 74 THR THR A . n A 1 79 PRO 79 75 75 PRO PRO A . n A 1 80 GLY 80 76 76 GLY GLY A . n A 1 81 LYS 81 77 77 LYS LYS A . n A 1 82 ILE 82 78 78 ILE ILE A . n A 1 83 SER 83 79 79 SER SER A . n A 1 84 ILE 84 80 80 ILE ILE A . n A 1 85 THR 85 81 81 THR THR A . n A 1 86 PHE 86 82 82 PHE PHE A . n A 1 87 THR 87 83 83 THR THR A . n A 1 88 ASP 88 84 84 ASP ASP A . n A 1 89 PRO 89 85 85 PRO PRO A . n A 1 90 THR 90 86 86 THR THR A . n A 1 91 LEU 91 87 87 LEU LEU A . n A 1 92 ALA 92 88 88 ALA ALA A . n A 1 93 ASN 93 89 89 ASN ASN A . n A 1 94 TYR 94 90 90 TYR TYR A . n A 1 95 PRO 95 91 91 PRO PRO A . n A 1 96 ILE 96 92 92 ILE ILE A . n A 1 97 SER 97 93 93 SER SER A . n A 1 98 VAL 98 94 94 VAL VAL A . n A 1 99 ASP 99 95 95 ASP ASP A . n A 1 100 GLY 100 96 96 GLY GLY A . n A 1 101 ILE 101 97 97 ILE ILE A . n A 1 102 LEU 102 98 98 LEU LEU A . n A 1 103 ALA 103 99 99 ALA ALA A . n A 1 104 TYR 104 100 100 TYR TYR A . n A 1 105 LEU 105 101 101 LEU LEU A . n A 1 106 ASP 106 102 102 ASP ASP A . n A 1 107 PHE 107 103 103 PHE PHE A . n A 1 108 ILE 108 104 104 ILE ILE A . n A 1 109 ILE 109 105 105 ILE ILE A . n A 1 110 ASN 110 106 106 ASN ASN A . n A 1 111 SER 111 107 107 SER SER A . n A 1 112 ASN 112 108 108 ASN ASN A . n A 1 113 ALA 113 109 109 ALA ALA A . n A 1 114 THR 114 110 110 THR THR A . n A 1 115 ALA 115 111 111 ALA ALA A . n A 1 116 GLY 116 112 112 GLY GLY A . n A 1 117 ASP 117 113 113 ASP ASP A . n A 1 118 SER 118 114 114 SER SER A . n A 1 119 ALA 119 115 115 ALA ALA A . n A 1 120 LEU 120 116 116 LEU LEU A . n A 1 121 THR 121 117 117 THR THR A . n A 1 122 VAL 122 118 118 VAL VAL A . n A 1 123 ASP 123 119 119 ASP ASP A . n A 1 124 PRO 124 120 120 PRO PRO A . n A 1 125 ALA 125 121 121 ALA ALA A . n A 1 126 THR 126 122 122 THR THR A . n A 1 127 LEU 127 123 123 LEU LEU A . n A 1 128 ILE 128 124 124 ILE ILE A . n A 1 129 VAL 129 125 125 VAL VAL A . n A 1 130 ALA 130 126 126 ALA ALA A . n A 1 131 ASP 131 127 127 ASP ASP A . n A 1 132 GLU 132 128 128 GLU GLU A . n A 1 133 ASN 133 129 129 ASN ASN A . n A 1 134 ASP 134 130 130 ASP ASP A . n A 1 135 LYS 135 131 131 LYS LYS A . n A 1 136 ASP 136 132 132 ASP ASP A . n A 1 137 ILE 137 133 133 ILE ILE A . n A 1 138 LYS 138 134 134 LYS LYS A . n A 1 139 ASP 139 135 135 ASP ASP A . n A 1 140 ALA 140 136 136 ALA ALA A . n A 1 141 ALA 141 137 137 ALA ALA A . n A 1 142 SER 142 138 138 SER SER A . n A 1 143 ASN 143 139 139 ASN ASN A . n A 1 144 GLY 144 140 140 GLY GLY A . n A 1 145 LYS 145 141 141 LYS LYS A . n A 1 146 ILE 146 142 142 ILE ILE A . n A 1 147 THR 147 143 143 THR THR A . n A 1 148 VAL 148 144 144 VAL VAL A . n A 1 149 THR 149 145 145 THR THR A . n A 1 150 GLY 150 146 146 GLY GLY A . n A 1 151 SER 151 147 147 SER SER A . n A 1 152 ALA 152 148 148 ALA ALA A . n A 1 153 PRO 153 149 149 PRO PRO A . n A 1 154 THR 154 150 150 THR THR A . n A 1 155 SER 155 151 151 SER SER A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6KG8 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6KG8 _struct.title 'Solution structure of CaCohA2 from Clostridium acetobutylicum' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6KG8 _struct_keywords.text 'cohesin, cellulosome, scaffolding, beta sandwitch, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q977Y4_CLOAB _struct_ref.pdbx_db_accession Q977Y4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VKNETVKLSVGTVSGNPGDTVKVPVTISQVSTPVGLICMDISYDASKFTVKDVLPNTDLVKDTDNYSFIVNTSTPGKISI TFTDPTLANYPISVDGILAYLDFIINSNATAGDSALTVDPATLIVADENDKDIKDAASNGKITVTGSAP ; _struct_ref.pdbx_align_begin 611 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6KG8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 153 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q977Y4 _struct_ref_seq.db_align_beg 611 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 759 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 149 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6KG8 GLY A 1 ? UNP Q977Y4 ? ? 'expression tag' -3 1 1 6KG8 SER A 2 ? UNP Q977Y4 ? ? 'expression tag' -2 2 1 6KG8 ALA A 3 ? UNP Q977Y4 ? ? 'expression tag' -1 3 1 6KG8 SER A 4 ? UNP Q977Y4 ? ? 'expression tag' 0 4 1 6KG8 THR A 154 ? UNP Q977Y4 ? ? 'expression tag' 150 5 1 6KG8 SER A 155 ? UNP Q977Y4 ? ? 'expression tag' 151 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 66 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 70 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 62 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 66 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 52 ? PRO A 59 ? PHE A 48 PRO A 55 AA1 2 GLY A 100 ? ILE A 109 ? GLY A 96 ILE A 105 AA1 3 THR A 24 ? SER A 32 ? THR A 20 SER A 28 AA1 4 VAL A 10 ? SER A 13 ? VAL A 6 SER A 9 AA1 5 LYS A 138 ? ALA A 140 ? LYS A 134 ALA A 136 AA2 1 THR A 16 ? GLY A 19 ? THR A 12 GLY A 15 AA2 2 ASN A 143 ? VAL A 148 ? ASN A 139 VAL A 144 AA2 3 GLY A 116 ? ASP A 131 ? GLY A 112 ASP A 127 AA2 4 VAL A 38 ? SER A 46 ? VAL A 34 SER A 42 AA2 5 LYS A 81 ? THR A 87 ? LYS A 77 THR A 83 AA2 6 PHE A 72 ? THR A 76 ? PHE A 68 THR A 72 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 53 ? N THR A 49 O ILE A 108 ? O ILE A 104 AA1 2 3 O LEU A 102 ? O LEU A 98 N VAL A 29 ? N VAL A 25 AA1 3 4 O SER A 32 ? O SER A 28 N LYS A 11 ? N LYS A 7 AA1 4 5 N VAL A 10 ? N VAL A 6 O ASP A 139 ? O ASP A 135 AA2 1 2 N VAL A 17 ? N VAL A 13 O THR A 147 ? O THR A 143 AA2 2 3 O VAL A 148 ? O VAL A 144 N GLY A 116 ? N GLY A 112 AA2 3 4 O THR A 121 ? O THR A 117 N SER A 46 ? N SER A 42 AA2 4 5 N ILE A 45 ? N ILE A 41 O ILE A 82 ? O ILE A 78 AA2 5 6 O SER A 83 ? O SER A 79 N ASN A 75 ? N ASN A 71 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 0 ? ? 75.18 -59.49 2 1 PRO A 75 ? ? -34.83 120.98 3 1 THR A 150 ? ? -155.13 -66.19 4 2 LYS A 51 ? ? -92.30 -62.27 5 2 ASP A 62 ? ? 51.06 77.48 6 2 TYR A 66 ? ? 71.48 30.77 7 2 PRO A 75 ? ? -35.65 129.32 8 2 ASN A 139 ? ? -126.64 -80.07 9 2 THR A 150 ? ? 71.13 121.37 10 3 SER A 31 ? ? -130.26 -33.00 11 3 ASP A 62 ? ? 36.77 86.94 12 3 TYR A 66 ? ? 74.75 33.36 13 3 PRO A 75 ? ? -36.55 124.93 14 4 SER A 31 ? ? -143.95 -42.46 15 4 LEU A 59 ? ? -106.08 -69.17 16 4 PRO A 75 ? ? -35.87 121.47 17 4 ASN A 139 ? ? -133.08 -87.36 18 5 ALA A -1 ? ? 70.31 96.26 19 5 ASN A 3 ? ? 61.67 73.25 20 5 LEU A 59 ? ? -98.25 -66.06 21 5 PRO A 75 ? ? -34.53 118.58 22 5 ASP A 127 ? ? -77.63 -167.82 23 5 ASN A 139 ? ? -149.16 -85.10 24 5 ALA A 148 ? ? 54.39 81.90 25 5 THR A 150 ? ? 64.28 146.33 26 6 LYS A 51 ? ? -101.61 -62.21 27 6 PRO A 75 ? ? -38.11 123.54 28 6 ASP A 127 ? ? -65.09 -176.80 29 6 ASP A 130 ? ? 56.75 19.28 30 6 ASN A 139 ? ? -152.00 86.57 31 6 PRO A 149 ? ? -80.28 49.08 32 7 ALA A -1 ? ? -102.44 71.06 33 7 VAL A 1 ? ? 59.94 78.66 34 7 ASN A 3 ? ? 82.73 107.82 35 7 LYS A 51 ? ? -92.29 -62.07 36 7 LEU A 59 ? ? -102.96 -64.28 37 7 ASP A 62 ? ? 43.24 96.03 38 7 PRO A 75 ? ? -33.97 117.73 39 7 ASN A 139 ? ? -175.80 79.64 40 8 ALA A -1 ? ? 70.75 -80.96 41 8 LYS A 2 ? ? 65.44 -176.61 42 8 LEU A 59 ? ? -95.26 -67.80 43 8 ASP A 62 ? ? 46.91 80.41 44 8 PRO A 75 ? ? -34.69 130.64 45 8 SER A 93 ? ? -140.87 23.62 46 8 ASP A 130 ? ? 58.58 19.42 47 8 ASN A 139 ? ? -129.15 -76.94 48 9 LYS A 2 ? ? 54.83 114.86 49 9 GLU A 4 ? ? -105.20 -169.21 50 9 ASP A 62 ? ? 23.48 68.13 51 9 PRO A 75 ? ? -34.82 112.85 52 9 ASN A 139 ? ? -167.77 80.05 53 9 SER A 147 ? ? -130.25 -48.44 54 9 ALA A 148 ? ? 69.19 155.14 55 9 THR A 150 ? ? 61.30 72.50 56 10 ASN A 3 ? ? 73.64 80.92 57 10 SER A 31 ? ? -150.49 -41.37 58 10 LEU A 59 ? ? -101.61 -70.52 59 10 PRO A 75 ? ? -34.55 128.27 60 10 SER A 93 ? ? -157.28 16.96 61 11 ALA A -1 ? ? 71.00 -84.59 62 11 ASN A 3 ? ? 71.24 95.34 63 11 SER A 31 ? ? -138.93 -47.86 64 11 LEU A 59 ? ? -97.52 -69.44 65 11 PRO A 75 ? ? -38.86 124.94 66 11 ASP A 127 ? ? -64.55 -179.71 67 11 ASN A 139 ? ? -155.41 89.92 68 11 PRO A 149 ? ? -92.30 37.46 69 11 THR A 150 ? ? 70.69 109.94 70 12 ALA A -1 ? ? 69.52 77.55 71 12 LYS A 2 ? ? -104.92 -164.53 72 12 ASN A 3 ? ? 76.10 113.80 73 12 LYS A 51 ? ? -91.01 -61.93 74 12 LEU A 59 ? ? -97.90 -62.79 75 12 PRO A 75 ? ? -35.01 120.72 76 13 ASN A 3 ? ? 59.17 73.87 77 13 LEU A 59 ? ? -92.86 -61.19 78 13 ASP A 62 ? ? 40.29 70.58 79 13 TYR A 66 ? ? 75.52 32.45 80 13 PRO A 75 ? ? -35.20 128.88 81 13 ASN A 139 ? ? -167.46 93.45 82 13 PRO A 149 ? ? -64.21 93.37 83 14 SER A -2 ? ? 67.68 -69.68 84 14 ASN A 3 ? ? 68.70 93.51 85 14 SER A 31 ? ? -136.16 -43.32 86 14 PRO A 75 ? ? -34.16 118.09 87 14 ASP A 119 ? ? -54.79 106.78 88 14 ASP A 130 ? ? 58.67 19.23 89 14 ILE A 133 ? ? -140.20 38.57 90 14 THR A 150 ? ? -171.15 138.67 91 15 SER A 0 ? ? -90.24 -87.67 92 15 ASN A 3 ? ? 70.61 169.31 93 15 SER A 31 ? ? -141.86 -37.13 94 15 LYS A 51 ? ? -91.90 -61.96 95 15 TYR A 66 ? ? 70.23 53.55 96 15 PRO A 75 ? ? -35.10 123.24 97 15 ALA A 148 ? ? 70.30 160.31 98 15 PRO A 149 ? ? -72.80 48.16 99 15 THR A 150 ? ? 71.97 -66.16 100 16 PRO A 75 ? ? -35.16 115.39 101 16 ASN A 139 ? ? -164.49 77.96 102 17 ALA A -1 ? ? -124.63 -164.91 103 17 SER A 0 ? ? -68.05 90.27 104 17 VAL A 1 ? ? -174.49 -34.13 105 17 LYS A 2 ? ? 62.76 -165.27 106 17 ASN A 3 ? ? 71.36 -164.39 107 17 LEU A 59 ? ? -101.47 -62.59 108 17 ASP A 62 ? ? 60.15 66.19 109 17 ASN A 139 ? ? -157.86 85.37 110 17 THR A 150 ? ? 71.41 90.27 111 18 ASN A 3 ? ? 79.14 165.56 112 18 GLU A 4 ? ? -116.89 -169.11 113 18 LYS A 51 ? ? -94.98 -62.18 114 18 ASP A 62 ? ? 57.49 74.39 115 18 PRO A 75 ? ? -35.46 120.43 116 18 ASN A 139 ? ? -133.66 -77.52 117 18 ALA A 148 ? ? 39.21 85.46 118 18 PRO A 149 ? ? -77.30 39.78 119 19 LYS A 2 ? ? 56.95 97.46 120 19 ASN A 3 ? ? 73.01 89.25 121 19 GLU A 4 ? ? -115.76 -163.06 122 19 TYR A 66 ? ? 70.66 54.41 123 19 PRO A 75 ? ? -33.96 113.00 124 19 SER A 93 ? ? -151.49 14.61 125 19 ASP A 127 ? ? -79.17 -169.30 126 19 ALA A 148 ? ? 61.95 104.69 127 19 THR A 150 ? ? -129.63 -80.99 128 20 LYS A 2 ? ? 53.71 -165.45 129 20 ASN A 3 ? ? 50.40 91.29 130 20 SER A 31 ? ? -131.80 -36.49 131 20 LEU A 59 ? ? -98.97 -60.72 132 20 ASP A 62 ? ? 42.33 84.14 133 20 ASN A 65 ? ? -78.61 30.39 134 20 PRO A 75 ? ? -35.67 122.92 # _pdbx_nmr_ensemble.entry_id 6KG8 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6KG8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;0.6 mM [U-13C; U-15N] CaCohA2, 20 mM sodium acetate, 100 mM potassium chloride, 1 mM CaCl2, 0.01 % w/v sodium azide, 0.05 % w/v DSS, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label sample1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 CaCohA2 0.6 ? mM '[U-13C; U-15N]' 1 'sodium acetate' 20 ? mM 'natural abundance' 1 'potassium chloride' 100 ? mM 'natural abundance' 1 CaCl2 1 ? mM 'natural abundance' 1 'sodium azide' 0.01 ? '% w/v' 'natural abundance' 1 DSS 0.05 ? '% w/v' 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-15N NOESY' 1 isotropic 2 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 3 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic # _pdbx_nmr_refine.entry_id 6KG8 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'structure calculation' CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 3 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific' 4 'peak picking' NMRView ? 'Johnson, One Moon Scientific' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 ILE N N N N 110 ILE CA C N S 111 ILE C C N N 112 ILE O O N N 113 ILE CB C N S 114 ILE CG1 C N N 115 ILE CG2 C N N 116 ILE CD1 C N N 117 ILE OXT O N N 118 ILE H H N N 119 ILE H2 H N N 120 ILE HA H N N 121 ILE HB H N N 122 ILE HG12 H N N 123 ILE HG13 H N N 124 ILE HG21 H N N 125 ILE HG22 H N N 126 ILE HG23 H N N 127 ILE HD11 H N N 128 ILE HD12 H N N 129 ILE HD13 H N N 130 ILE HXT H N N 131 LEU N N N N 132 LEU CA C N S 133 LEU C C N N 134 LEU O O N N 135 LEU CB C N N 136 LEU CG C N N 137 LEU CD1 C N N 138 LEU CD2 C N N 139 LEU OXT O N N 140 LEU H H N N 141 LEU H2 H N N 142 LEU HA H N N 143 LEU HB2 H N N 144 LEU HB3 H N N 145 LEU HG H N N 146 LEU HD11 H N N 147 LEU HD12 H N N 148 LEU HD13 H N N 149 LEU HD21 H N N 150 LEU HD22 H N N 151 LEU HD23 H N N 152 LEU HXT H N N 153 LYS N N N N 154 LYS CA C N S 155 LYS C C N N 156 LYS O O N N 157 LYS CB C N N 158 LYS CG C N N 159 LYS CD C N N 160 LYS CE C N N 161 LYS NZ N N N 162 LYS OXT O N N 163 LYS H H N N 164 LYS H2 H N N 165 LYS HA H N N 166 LYS HB2 H N N 167 LYS HB3 H N N 168 LYS HG2 H N N 169 LYS HG3 H N N 170 LYS HD2 H N N 171 LYS HD3 H N N 172 LYS HE2 H N N 173 LYS HE3 H N N 174 LYS HZ1 H N N 175 LYS HZ2 H N N 176 LYS HZ3 H N N 177 LYS HXT H N N 178 MET N N N N 179 MET CA C N S 180 MET C C N N 181 MET O O N N 182 MET CB C N N 183 MET CG C N N 184 MET SD S N N 185 MET CE C N N 186 MET OXT O N N 187 MET H H N N 188 MET H2 H N N 189 MET HA H N N 190 MET HB2 H N N 191 MET HB3 H N N 192 MET HG2 H N N 193 MET HG3 H N N 194 MET HE1 H N N 195 MET HE2 H N N 196 MET HE3 H N N 197 MET HXT H N N 198 PHE N N N N 199 PHE CA C N S 200 PHE C C N N 201 PHE O O N N 202 PHE CB C N N 203 PHE CG C Y N 204 PHE CD1 C Y N 205 PHE CD2 C Y N 206 PHE CE1 C Y N 207 PHE CE2 C Y N 208 PHE CZ C Y N 209 PHE OXT O N N 210 PHE H H N N 211 PHE H2 H N N 212 PHE HA H N N 213 PHE HB2 H N N 214 PHE HB3 H N N 215 PHE HD1 H N N 216 PHE HD2 H N N 217 PHE HE1 H N N 218 PHE HE2 H N N 219 PHE HZ H N N 220 PHE HXT H N N 221 PRO N N N N 222 PRO CA C N S 223 PRO C C N N 224 PRO O O N N 225 PRO CB C N N 226 PRO CG C N N 227 PRO CD C N N 228 PRO OXT O N N 229 PRO H H N N 230 PRO HA H N N 231 PRO HB2 H N N 232 PRO HB3 H N N 233 PRO HG2 H N N 234 PRO HG3 H N N 235 PRO HD2 H N N 236 PRO HD3 H N N 237 PRO HXT H N N 238 SER N N N N 239 SER CA C N S 240 SER C C N N 241 SER O O N N 242 SER CB C N N 243 SER OG O N N 244 SER OXT O N N 245 SER H H N N 246 SER H2 H N N 247 SER HA H N N 248 SER HB2 H N N 249 SER HB3 H N N 250 SER HG H N N 251 SER HXT H N N 252 THR N N N N 253 THR CA C N S 254 THR C C N N 255 THR O O N N 256 THR CB C N R 257 THR OG1 O N N 258 THR CG2 C N N 259 THR OXT O N N 260 THR H H N N 261 THR H2 H N N 262 THR HA H N N 263 THR HB H N N 264 THR HG1 H N N 265 THR HG21 H N N 266 THR HG22 H N N 267 THR HG23 H N N 268 THR HXT H N N 269 TYR N N N N 270 TYR CA C N S 271 TYR C C N N 272 TYR O O N N 273 TYR CB C N N 274 TYR CG C Y N 275 TYR CD1 C Y N 276 TYR CD2 C Y N 277 TYR CE1 C Y N 278 TYR CE2 C Y N 279 TYR CZ C Y N 280 TYR OH O N N 281 TYR OXT O N N 282 TYR H H N N 283 TYR H2 H N N 284 TYR HA H N N 285 TYR HB2 H N N 286 TYR HB3 H N N 287 TYR HD1 H N N 288 TYR HD2 H N N 289 TYR HE1 H N N 290 TYR HE2 H N N 291 TYR HH H N N 292 TYR HXT H N N 293 VAL N N N N 294 VAL CA C N S 295 VAL C C N N 296 VAL O O N N 297 VAL CB C N N 298 VAL CG1 C N N 299 VAL CG2 C N N 300 VAL OXT O N N 301 VAL H H N N 302 VAL H2 H N N 303 VAL HA H N N 304 VAL HB H N N 305 VAL HG11 H N N 306 VAL HG12 H N N 307 VAL HG13 H N N 308 VAL HG21 H N N 309 VAL HG22 H N N 310 VAL HG23 H N N 311 VAL HXT H N N 312 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 ILE N CA sing N N 103 ILE N H sing N N 104 ILE N H2 sing N N 105 ILE CA C sing N N 106 ILE CA CB sing N N 107 ILE CA HA sing N N 108 ILE C O doub N N 109 ILE C OXT sing N N 110 ILE CB CG1 sing N N 111 ILE CB CG2 sing N N 112 ILE CB HB sing N N 113 ILE CG1 CD1 sing N N 114 ILE CG1 HG12 sing N N 115 ILE CG1 HG13 sing N N 116 ILE CG2 HG21 sing N N 117 ILE CG2 HG22 sing N N 118 ILE CG2 HG23 sing N N 119 ILE CD1 HD11 sing N N 120 ILE CD1 HD12 sing N N 121 ILE CD1 HD13 sing N N 122 ILE OXT HXT sing N N 123 LEU N CA sing N N 124 LEU N H sing N N 125 LEU N H2 sing N N 126 LEU CA C sing N N 127 LEU CA CB sing N N 128 LEU CA HA sing N N 129 LEU C O doub N N 130 LEU C OXT sing N N 131 LEU CB CG sing N N 132 LEU CB HB2 sing N N 133 LEU CB HB3 sing N N 134 LEU CG CD1 sing N N 135 LEU CG CD2 sing N N 136 LEU CG HG sing N N 137 LEU CD1 HD11 sing N N 138 LEU CD1 HD12 sing N N 139 LEU CD1 HD13 sing N N 140 LEU CD2 HD21 sing N N 141 LEU CD2 HD22 sing N N 142 LEU CD2 HD23 sing N N 143 LEU OXT HXT sing N N 144 LYS N CA sing N N 145 LYS N H sing N N 146 LYS N H2 sing N N 147 LYS CA C sing N N 148 LYS CA CB sing N N 149 LYS CA HA sing N N 150 LYS C O doub N N 151 LYS C OXT sing N N 152 LYS CB CG sing N N 153 LYS CB HB2 sing N N 154 LYS CB HB3 sing N N 155 LYS CG CD sing N N 156 LYS CG HG2 sing N N 157 LYS CG HG3 sing N N 158 LYS CD CE sing N N 159 LYS CD HD2 sing N N 160 LYS CD HD3 sing N N 161 LYS CE NZ sing N N 162 LYS CE HE2 sing N N 163 LYS CE HE3 sing N N 164 LYS NZ HZ1 sing N N 165 LYS NZ HZ2 sing N N 166 LYS NZ HZ3 sing N N 167 LYS OXT HXT sing N N 168 MET N CA sing N N 169 MET N H sing N N 170 MET N H2 sing N N 171 MET CA C sing N N 172 MET CA CB sing N N 173 MET CA HA sing N N 174 MET C O doub N N 175 MET C OXT sing N N 176 MET CB CG sing N N 177 MET CB HB2 sing N N 178 MET CB HB3 sing N N 179 MET CG SD sing N N 180 MET CG HG2 sing N N 181 MET CG HG3 sing N N 182 MET SD CE sing N N 183 MET CE HE1 sing N N 184 MET CE HE2 sing N N 185 MET CE HE3 sing N N 186 MET OXT HXT sing N N 187 PHE N CA sing N N 188 PHE N H sing N N 189 PHE N H2 sing N N 190 PHE CA C sing N N 191 PHE CA CB sing N N 192 PHE CA HA sing N N 193 PHE C O doub N N 194 PHE C OXT sing N N 195 PHE CB CG sing N N 196 PHE CB HB2 sing N N 197 PHE CB HB3 sing N N 198 PHE CG CD1 doub Y N 199 PHE CG CD2 sing Y N 200 PHE CD1 CE1 sing Y N 201 PHE CD1 HD1 sing N N 202 PHE CD2 CE2 doub Y N 203 PHE CD2 HD2 sing N N 204 PHE CE1 CZ doub Y N 205 PHE CE1 HE1 sing N N 206 PHE CE2 CZ sing Y N 207 PHE CE2 HE2 sing N N 208 PHE CZ HZ sing N N 209 PHE OXT HXT sing N N 210 PRO N CA sing N N 211 PRO N CD sing N N 212 PRO N H sing N N 213 PRO CA C sing N N 214 PRO CA CB sing N N 215 PRO CA HA sing N N 216 PRO C O doub N N 217 PRO C OXT sing N N 218 PRO CB CG sing N N 219 PRO CB HB2 sing N N 220 PRO CB HB3 sing N N 221 PRO CG CD sing N N 222 PRO CG HG2 sing N N 223 PRO CG HG3 sing N N 224 PRO CD HD2 sing N N 225 PRO CD HD3 sing N N 226 PRO OXT HXT sing N N 227 SER N CA sing N N 228 SER N H sing N N 229 SER N H2 sing N N 230 SER CA C sing N N 231 SER CA CB sing N N 232 SER CA HA sing N N 233 SER C O doub N N 234 SER C OXT sing N N 235 SER CB OG sing N N 236 SER CB HB2 sing N N 237 SER CB HB3 sing N N 238 SER OG HG sing N N 239 SER OXT HXT sing N N 240 THR N CA sing N N 241 THR N H sing N N 242 THR N H2 sing N N 243 THR CA C sing N N 244 THR CA CB sing N N 245 THR CA HA sing N N 246 THR C O doub N N 247 THR C OXT sing N N 248 THR CB OG1 sing N N 249 THR CB CG2 sing N N 250 THR CB HB sing N N 251 THR OG1 HG1 sing N N 252 THR CG2 HG21 sing N N 253 THR CG2 HG22 sing N N 254 THR CG2 HG23 sing N N 255 THR OXT HXT sing N N 256 TYR N CA sing N N 257 TYR N H sing N N 258 TYR N H2 sing N N 259 TYR CA C sing N N 260 TYR CA CB sing N N 261 TYR CA HA sing N N 262 TYR C O doub N N 263 TYR C OXT sing N N 264 TYR CB CG sing N N 265 TYR CB HB2 sing N N 266 TYR CB HB3 sing N N 267 TYR CG CD1 doub Y N 268 TYR CG CD2 sing Y N 269 TYR CD1 CE1 sing Y N 270 TYR CD1 HD1 sing N N 271 TYR CD2 CE2 doub Y N 272 TYR CD2 HD2 sing N N 273 TYR CE1 CZ doub Y N 274 TYR CE1 HE1 sing N N 275 TYR CE2 CZ sing Y N 276 TYR CE2 HE2 sing N N 277 TYR CZ OH sing N N 278 TYR OH HH sing N N 279 TYR OXT HXT sing N N 280 VAL N CA sing N N 281 VAL N H sing N N 282 VAL N H2 sing N N 283 VAL CA C sing N N 284 VAL CA CB sing N N 285 VAL CA HA sing N N 286 VAL C O doub N N 287 VAL C OXT sing N N 288 VAL CB CG1 sing N N 289 VAL CB CG2 sing N N 290 VAL CB HB sing N N 291 VAL CG1 HG11 sing N N 292 VAL CG1 HG12 sing N N 293 VAL CG1 HG13 sing N N 294 VAL CG2 HG21 sing N N 295 VAL CG2 HG22 sing N N 296 VAL CG2 HG23 sing N N 297 VAL OXT HXT sing N N 298 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China' China 31270784 1 'National Natural Science Foundation of China' China 31670735 2 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 6KG8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #