data_6KMJ # _entry.id 6KMJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6KMJ pdb_00006kmj 10.2210/pdb6kmj/pdb WWPDB D_1300013279 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-11-27 2 'Structure model' 1 1 2020-01-22 3 'Structure model' 1 2 2023-11-22 4 'Structure model' 1 3 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.year' 4 3 'Structure model' '_database_2.pdbx_DOI' 5 3 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6KMJ _pdbx_database_status.recvd_initial_deposition_date 2019-07-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'apo protein structure' _pdbx_database_related.db_id 6KMB _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chen, G.' 1 ? 'Li, W.' 2 ? 'Yan, F.' 3 ? 'Wang, D.' 4 ? 'Chen, Y.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 28 _citation.language ? _citation.page_first 111 _citation.page_last ? _citation.title 'The Structural Basis for Specific Recognition of H3K14 Acetylation by Sth1 in the RSC Chromatin Remodeling Complex.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2019.10.015 _citation.pdbx_database_id_PubMed 31711754 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, G.' 1 ? primary 'Li, W.' 2 ? primary 'Yan, F.' 3 ? primary 'Wang, D.' 4 ? primary 'Chen, Y.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nuclear protein STH1/NPS1' 13334.953 1 3.6.4.12 ? ? ? 2 polymer syn 'Histone H3' 1879.169 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 129 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ATP-dependent helicase STH1,Chromatin structure-remodeling complex protein STH1,SNF2 homolog' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;SLGIFPTVEKLVEEMREQLDEVDSHPRTSIFEKLPSKRDYPDYFKVIEKPMAIDIILKNCKNGTYKTLEEVRQALQTMFE NARFYNEEGSWVYVDADKLNEFTDEWFKEHSS ; ;SLGIFPTVEKLVEEMREQLDEVDSHPRTSIFEKLPSKRDYPDYFKVIEKPMAIDIILKNCKNGTYKTLEEVRQALQTMFE NARFYNEEGSWVYVDADKLNEFTDEWFKEHSS ; A ? 2 'polypeptide(L)' no yes 'TARKSTGG(ALY)APRKQLAY' TARKSTGGKAPRKQLAY C ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCEROL GOL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LEU n 1 3 GLY n 1 4 ILE n 1 5 PHE n 1 6 PRO n 1 7 THR n 1 8 VAL n 1 9 GLU n 1 10 LYS n 1 11 LEU n 1 12 VAL n 1 13 GLU n 1 14 GLU n 1 15 MET n 1 16 ARG n 1 17 GLU n 1 18 GLN n 1 19 LEU n 1 20 ASP n 1 21 GLU n 1 22 VAL n 1 23 ASP n 1 24 SER n 1 25 HIS n 1 26 PRO n 1 27 ARG n 1 28 THR n 1 29 SER n 1 30 ILE n 1 31 PHE n 1 32 GLU n 1 33 LYS n 1 34 LEU n 1 35 PRO n 1 36 SER n 1 37 LYS n 1 38 ARG n 1 39 ASP n 1 40 TYR n 1 41 PRO n 1 42 ASP n 1 43 TYR n 1 44 PHE n 1 45 LYS n 1 46 VAL n 1 47 ILE n 1 48 GLU n 1 49 LYS n 1 50 PRO n 1 51 MET n 1 52 ALA n 1 53 ILE n 1 54 ASP n 1 55 ILE n 1 56 ILE n 1 57 LEU n 1 58 LYS n 1 59 ASN n 1 60 CYS n 1 61 LYS n 1 62 ASN n 1 63 GLY n 1 64 THR n 1 65 TYR n 1 66 LYS n 1 67 THR n 1 68 LEU n 1 69 GLU n 1 70 GLU n 1 71 VAL n 1 72 ARG n 1 73 GLN n 1 74 ALA n 1 75 LEU n 1 76 GLN n 1 77 THR n 1 78 MET n 1 79 PHE n 1 80 GLU n 1 81 ASN n 1 82 ALA n 1 83 ARG n 1 84 PHE n 1 85 TYR n 1 86 ASN n 1 87 GLU n 1 88 GLU n 1 89 GLY n 1 90 SER n 1 91 TRP n 1 92 VAL n 1 93 TYR n 1 94 VAL n 1 95 ASP n 1 96 ALA n 1 97 ASP n 1 98 LYS n 1 99 LEU n 1 100 ASN n 1 101 GLU n 1 102 PHE n 1 103 THR n 1 104 ASP n 1 105 GLU n 1 106 TRP n 1 107 PHE n 1 108 LYS n 1 109 GLU n 1 110 HIS n 1 111 SER n 1 112 SER n 2 1 THR n 2 2 ALA n 2 3 ARG n 2 4 LYS n 2 5 SER n 2 6 THR n 2 7 GLY n 2 8 GLY n 2 9 ALY n 2 10 ALA n 2 11 PRO n 2 12 ARG n 2 13 LYS n 2 14 GLN n 2 15 LEU n 2 16 ALA n 2 17 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 112 _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'STH1, NPS1, YIL126W' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant Rosetta _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 17 _pdbx_entity_src_syn.organism_scientific 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' _pdbx_entity_src_syn.organism_common_name ;Baker's yeast ; _pdbx_entity_src_syn.ncbi_taxonomy_id 559292 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE' ? 'C8 H16 N2 O3' 188.224 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1248 1248 SER SER A . n A 1 2 LEU 2 1249 1249 LEU LEU A . n A 1 3 GLY 3 1250 1250 GLY GLY A . n A 1 4 ILE 4 1251 1251 ILE ILE A . n A 1 5 PHE 5 1252 1252 PHE PHE A . n A 1 6 PRO 6 1253 1253 PRO PRO A . n A 1 7 THR 7 1254 1254 THR THR A . n A 1 8 VAL 8 1255 1255 VAL VAL A . n A 1 9 GLU 9 1256 1256 GLU GLU A . n A 1 10 LYS 10 1257 1257 LYS LYS A . n A 1 11 LEU 11 1258 1258 LEU LEU A . n A 1 12 VAL 12 1259 1259 VAL VAL A . n A 1 13 GLU 13 1260 1260 GLU GLU A . n A 1 14 GLU 14 1261 1261 GLU GLU A . n A 1 15 MET 15 1262 1262 MET MET A . n A 1 16 ARG 16 1263 1263 ARG ARG A . n A 1 17 GLU 17 1264 1264 GLU GLU A . n A 1 18 GLN 18 1265 1265 GLN GLN A . n A 1 19 LEU 19 1266 1266 LEU LEU A . n A 1 20 ASP 20 1267 1267 ASP ASP A . n A 1 21 GLU 21 1268 1268 GLU GLU A . n A 1 22 VAL 22 1269 1269 VAL VAL A . n A 1 23 ASP 23 1270 1270 ASP ASP A . n A 1 24 SER 24 1271 1271 SER SER A . n A 1 25 HIS 25 1272 1272 HIS HIS A . n A 1 26 PRO 26 1273 1273 PRO PRO A . n A 1 27 ARG 27 1274 1274 ARG ARG A . n A 1 28 THR 28 1275 1275 THR THR A . n A 1 29 SER 29 1276 1276 SER SER A . n A 1 30 ILE 30 1277 1277 ILE ILE A . n A 1 31 PHE 31 1278 1278 PHE PHE A . n A 1 32 GLU 32 1279 1279 GLU GLU A . n A 1 33 LYS 33 1280 1280 LYS LYS A . n A 1 34 LEU 34 1281 1281 LEU LEU A . n A 1 35 PRO 35 1282 1282 PRO PRO A . n A 1 36 SER 36 1283 1283 SER SER A . n A 1 37 LYS 37 1284 1284 LYS LYS A . n A 1 38 ARG 38 1285 1285 ARG ARG A . n A 1 39 ASP 39 1286 1286 ASP ASP A . n A 1 40 TYR 40 1287 1287 TYR TYR A . n A 1 41 PRO 41 1288 1288 PRO PRO A . n A 1 42 ASP 42 1289 1289 ASP ASP A . n A 1 43 TYR 43 1290 1290 TYR TYR A . n A 1 44 PHE 44 1291 1291 PHE PHE A . n A 1 45 LYS 45 1292 1292 LYS LYS A . n A 1 46 VAL 46 1293 1293 VAL VAL A . n A 1 47 ILE 47 1294 1294 ILE ILE A . n A 1 48 GLU 48 1295 1295 GLU GLU A . n A 1 49 LYS 49 1296 1296 LYS LYS A . n A 1 50 PRO 50 1297 1297 PRO PRO A . n A 1 51 MET 51 1298 1298 MET MET A . n A 1 52 ALA 52 1299 1299 ALA ALA A . n A 1 53 ILE 53 1300 1300 ILE ILE A . n A 1 54 ASP 54 1301 1301 ASP ASP A . n A 1 55 ILE 55 1302 1302 ILE ILE A . n A 1 56 ILE 56 1303 1303 ILE ILE A . n A 1 57 LEU 57 1304 1304 LEU LEU A . n A 1 58 LYS 58 1305 1305 LYS LYS A . n A 1 59 ASN 59 1306 1306 ASN ASN A . n A 1 60 CYS 60 1307 1307 CYS CYS A . n A 1 61 LYS 61 1308 1308 LYS LYS A . n A 1 62 ASN 62 1309 1309 ASN ASN A . n A 1 63 GLY 63 1310 1310 GLY GLY A . n A 1 64 THR 64 1311 1311 THR THR A . n A 1 65 TYR 65 1312 1312 TYR TYR A . n A 1 66 LYS 66 1313 1313 LYS LYS A . n A 1 67 THR 67 1314 1314 THR THR A . n A 1 68 LEU 68 1315 1315 LEU LEU A . n A 1 69 GLU 69 1316 1316 GLU GLU A . n A 1 70 GLU 70 1317 1317 GLU GLU A . n A 1 71 VAL 71 1318 1318 VAL VAL A . n A 1 72 ARG 72 1319 1319 ARG ARG A . n A 1 73 GLN 73 1320 1320 GLN GLN A . n A 1 74 ALA 74 1321 1321 ALA ALA A . n A 1 75 LEU 75 1322 1322 LEU LEU A . n A 1 76 GLN 76 1323 1323 GLN GLN A . n A 1 77 THR 77 1324 1324 THR THR A . n A 1 78 MET 78 1325 1325 MET MET A . n A 1 79 PHE 79 1326 1326 PHE PHE A . n A 1 80 GLU 80 1327 1327 GLU GLU A . n A 1 81 ASN 81 1328 1328 ASN ASN A . n A 1 82 ALA 82 1329 1329 ALA ALA A . n A 1 83 ARG 83 1330 1330 ARG ARG A . n A 1 84 PHE 84 1331 1331 PHE PHE A . n A 1 85 TYR 85 1332 1332 TYR TYR A . n A 1 86 ASN 86 1333 1333 ASN ASN A . n A 1 87 GLU 87 1334 1334 GLU GLU A . n A 1 88 GLU 88 1335 1335 GLU GLU A . n A 1 89 GLY 89 1336 1336 GLY GLY A . n A 1 90 SER 90 1337 1337 SER SER A . n A 1 91 TRP 91 1338 1338 TRP TRP A . n A 1 92 VAL 92 1339 1339 VAL VAL A . n A 1 93 TYR 93 1340 1340 TYR TYR A . n A 1 94 VAL 94 1341 1341 VAL VAL A . n A 1 95 ASP 95 1342 1342 ASP ASP A . n A 1 96 ALA 96 1343 1343 ALA ALA A . n A 1 97 ASP 97 1344 1344 ASP ASP A . n A 1 98 LYS 98 1345 1345 LYS LYS A . n A 1 99 LEU 99 1346 1346 LEU LEU A . n A 1 100 ASN 100 1347 1347 ASN ASN A . n A 1 101 GLU 101 1348 1348 GLU GLU A . n A 1 102 PHE 102 1349 1349 PHE PHE A . n A 1 103 THR 103 1350 1350 THR THR A . n A 1 104 ASP 104 1351 1351 ASP ASP A . n A 1 105 GLU 105 1352 1352 GLU GLU A . n A 1 106 TRP 106 1353 1353 TRP TRP A . n A 1 107 PHE 107 1354 1354 PHE PHE A . n A 1 108 LYS 108 1355 1355 LYS LYS A . n A 1 109 GLU 109 1356 1356 GLU GLU A . n A 1 110 HIS 110 1357 1357 HIS HIS A . n A 1 111 SER 111 1358 1358 SER SER A . n A 1 112 SER 112 1359 1359 SER SER A . n B 2 1 THR 1 6 6 THR THR C . n B 2 2 ALA 2 7 7 ALA ALA C . n B 2 3 ARG 3 8 8 ARG ARG C . n B 2 4 LYS 4 9 9 LYS LYS C . n B 2 5 SER 5 10 10 SER SER C . n B 2 6 THR 6 11 11 THR THR C . n B 2 7 GLY 7 12 12 GLY GLY C . n B 2 8 GLY 8 13 13 GLY GLY C . n B 2 9 ALY 9 14 14 ALY ALY C . n B 2 10 ALA 10 15 15 ALA ALA C . n B 2 11 PRO 11 16 16 PRO PRO C . n B 2 12 ARG 12 17 17 ARG ARG C . n B 2 13 LYS 13 18 18 LYS LYS C . n B 2 14 GLN 14 19 19 GLN GLN C . n B 2 15 LEU 15 20 20 LEU LEU C . n B 2 16 ALA 16 21 21 ALA ALA C . n B 2 17 TYR 17 22 22 TYR TYR C . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ALY _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ALY _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GOL 1 1401 1 GOL GOL A . D 4 HOH 1 1501 65 HOH HOH A . D 4 HOH 2 1502 38 HOH HOH A . D 4 HOH 3 1503 61 HOH HOH A . D 4 HOH 4 1504 98 HOH HOH A . D 4 HOH 5 1505 10 HOH HOH A . D 4 HOH 6 1506 37 HOH HOH A . D 4 HOH 7 1507 1 HOH HOH A . D 4 HOH 8 1508 28 HOH HOH A . D 4 HOH 9 1509 44 HOH HOH A . D 4 HOH 10 1510 82 HOH HOH A . D 4 HOH 11 1511 48 HOH HOH A . D 4 HOH 12 1512 2 HOH HOH A . D 4 HOH 13 1513 9 HOH HOH A . D 4 HOH 14 1514 43 HOH HOH A . D 4 HOH 15 1515 129 HOH HOH A . D 4 HOH 16 1516 7 HOH HOH A . D 4 HOH 17 1517 11 HOH HOH A . D 4 HOH 18 1518 8 HOH HOH A . D 4 HOH 19 1519 59 HOH HOH A . D 4 HOH 20 1520 40 HOH HOH A . D 4 HOH 21 1521 75 HOH HOH A . D 4 HOH 22 1522 24 HOH HOH A . D 4 HOH 23 1523 131 HOH HOH A . D 4 HOH 24 1524 96 HOH HOH A . D 4 HOH 25 1525 60 HOH HOH A . D 4 HOH 26 1526 91 HOH HOH A . D 4 HOH 27 1527 130 HOH HOH A . D 4 HOH 28 1528 53 HOH HOH A . D 4 HOH 29 1529 33 HOH HOH A . D 4 HOH 30 1530 27 HOH HOH A . D 4 HOH 31 1531 94 HOH HOH A . D 4 HOH 32 1532 4 HOH HOH A . D 4 HOH 33 1533 35 HOH HOH A . D 4 HOH 34 1534 17 HOH HOH A . D 4 HOH 35 1535 39 HOH HOH A . D 4 HOH 36 1536 127 HOH HOH A . D 4 HOH 37 1537 69 HOH HOH A . D 4 HOH 38 1538 67 HOH HOH A . D 4 HOH 39 1539 12 HOH HOH A . D 4 HOH 40 1540 41 HOH HOH A . D 4 HOH 41 1541 73 HOH HOH A . D 4 HOH 42 1542 31 HOH HOH A . D 4 HOH 43 1543 3 HOH HOH A . D 4 HOH 44 1544 104 HOH HOH A . D 4 HOH 45 1545 110 HOH HOH A . D 4 HOH 46 1546 108 HOH HOH A . D 4 HOH 47 1547 97 HOH HOH A . D 4 HOH 48 1548 64 HOH HOH A . D 4 HOH 49 1549 105 HOH HOH A . D 4 HOH 50 1550 20 HOH HOH A . D 4 HOH 51 1551 19 HOH HOH A . D 4 HOH 52 1552 72 HOH HOH A . D 4 HOH 53 1553 118 HOH HOH A . D 4 HOH 54 1554 22 HOH HOH A . D 4 HOH 55 1555 125 HOH HOH A . D 4 HOH 56 1556 116 HOH HOH A . D 4 HOH 57 1557 42 HOH HOH A . D 4 HOH 58 1558 115 HOH HOH A . D 4 HOH 59 1559 45 HOH HOH A . D 4 HOH 60 1560 23 HOH HOH A . D 4 HOH 61 1561 21 HOH HOH A . D 4 HOH 62 1562 85 HOH HOH A . D 4 HOH 63 1563 86 HOH HOH A . D 4 HOH 64 1564 122 HOH HOH A . D 4 HOH 65 1565 62 HOH HOH A . D 4 HOH 66 1566 66 HOH HOH A . D 4 HOH 67 1567 133 HOH HOH A . D 4 HOH 68 1568 55 HOH HOH A . D 4 HOH 69 1569 103 HOH HOH A . D 4 HOH 70 1570 34 HOH HOH A . D 4 HOH 71 1571 112 HOH HOH A . D 4 HOH 72 1572 49 HOH HOH A . D 4 HOH 73 1573 78 HOH HOH A . D 4 HOH 74 1574 70 HOH HOH A . D 4 HOH 75 1575 36 HOH HOH A . D 4 HOH 76 1576 46 HOH HOH A . D 4 HOH 77 1577 5 HOH HOH A . D 4 HOH 78 1578 138 HOH HOH A . D 4 HOH 79 1579 18 HOH HOH A . D 4 HOH 80 1580 100 HOH HOH A . D 4 HOH 81 1581 111 HOH HOH A . D 4 HOH 82 1582 6 HOH HOH A . D 4 HOH 83 1583 87 HOH HOH A . D 4 HOH 84 1584 120 HOH HOH A . D 4 HOH 85 1585 26 HOH HOH A . D 4 HOH 86 1586 81 HOH HOH A . D 4 HOH 87 1587 124 HOH HOH A . D 4 HOH 88 1588 139 HOH HOH A . D 4 HOH 89 1589 101 HOH HOH A . D 4 HOH 90 1590 126 HOH HOH A . D 4 HOH 91 1591 102 HOH HOH A . D 4 HOH 92 1592 114 HOH HOH A . D 4 HOH 93 1593 93 HOH HOH A . D 4 HOH 94 1594 137 HOH HOH A . D 4 HOH 95 1595 95 HOH HOH A . D 4 HOH 96 1596 140 HOH HOH A . D 4 HOH 97 1597 57 HOH HOH A . D 4 HOH 98 1598 68 HOH HOH A . D 4 HOH 99 1599 89 HOH HOH A . D 4 HOH 100 1600 134 HOH HOH A . D 4 HOH 101 1601 107 HOH HOH A . D 4 HOH 102 1602 71 HOH HOH A . D 4 HOH 103 1603 121 HOH HOH A . D 4 HOH 104 1604 51 HOH HOH A . D 4 HOH 105 1605 88 HOH HOH A . D 4 HOH 106 1606 54 HOH HOH A . E 4 HOH 1 101 47 HOH HOH C . E 4 HOH 2 102 74 HOH HOH C . E 4 HOH 3 103 135 HOH HOH C . E 4 HOH 4 104 58 HOH HOH C . E 4 HOH 5 105 15 HOH HOH C . E 4 HOH 6 106 119 HOH HOH C . E 4 HOH 7 107 14 HOH HOH C . E 4 HOH 8 108 52 HOH HOH C . E 4 HOH 9 109 63 HOH HOH C . E 4 HOH 10 110 32 HOH HOH C . E 4 HOH 11 111 80 HOH HOH C . E 4 HOH 12 112 56 HOH HOH C . E 4 HOH 13 113 92 HOH HOH C . E 4 HOH 14 114 84 HOH HOH C . E 4 HOH 15 115 30 HOH HOH C . E 4 HOH 16 116 25 HOH HOH C . E 4 HOH 17 117 29 HOH HOH C . E 4 HOH 18 118 13 HOH HOH C . E 4 HOH 19 119 109 HOH HOH C . E 4 HOH 20 120 113 HOH HOH C . E 4 HOH 21 121 83 HOH HOH C . E 4 HOH 22 122 90 HOH HOH C . E 4 HOH 23 123 99 HOH HOH C . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 1249 ? CG ? A LEU 2 CG 2 1 Y 1 A LEU 1249 ? CD1 ? A LEU 2 CD1 3 1 Y 1 A LEU 1249 ? CD2 ? A LEU 2 CD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6KMJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 23.943 _cell.length_a_esd ? _cell.length_b 61.933 _cell.length_b_esd ? _cell.length_c 153.151 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6KMJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6KMJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.87 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 34.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1% w/v tryptone, 1 mM sodium azide, 50 mM HEPES sodium pH 7.0, 20% w/v PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-11-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9779 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9779 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6KMJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.400 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21820 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.300 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.200 _reflns.pdbx_Rmerge_I_obs 0.136 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 2.080 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.146 _reflns.pdbx_Rpim_I_all 0.052 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 179344 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.400 1.420 ? ? ? ? ? ? 1021 92.400 ? ? ? ? 0.663 ? ? ? ? ? ? ? ? 9.100 ? 0.673 ? ? 0.701 0.221 ? 1 1 0.861 ? 1.420 1.450 ? ? ? ? ? ? 1085 95.000 ? ? ? ? 0.598 ? ? ? ? ? ? ? ? 8.900 ? 0.758 ? ? 0.632 0.202 ? 2 1 0.888 ? 1.450 1.480 ? ? ? ? ? ? 1049 92.500 ? ? ? ? 0.520 ? ? ? ? ? ? ? ? 9.100 ? 0.840 ? ? 0.550 0.175 ? 3 1 0.888 ? 1.480 1.510 ? ? ? ? ? ? 1056 90.600 ? ? ? ? 0.441 ? ? ? ? ? ? ? ? 8.900 ? 0.968 ? ? 0.467 0.149 ? 4 1 0.918 ? 1.510 1.540 ? ? ? ? ? ? 1029 94.000 ? ? ? ? 0.412 ? ? ? ? ? ? ? ? 9.100 ? 1.038 ? ? 0.437 0.141 ? 5 1 0.910 ? 1.540 1.580 ? ? ? ? ? ? 1067 91.600 ? ? ? ? 0.383 ? ? ? ? ? ? ? ? 8.000 ? 1.139 ? ? 0.409 0.139 ? 6 1 0.912 ? 1.580 1.620 ? ? ? ? ? ? 1022 92.500 ? ? ? ? 0.341 ? ? ? ? ? ? ? ? 9.100 ? 1.285 ? ? 0.361 0.116 ? 7 1 0.946 ? 1.620 1.660 ? ? ? ? ? ? 1074 92.700 ? ? ? ? 0.332 ? ? ? ? ? ? ? ? 8.900 ? 1.327 ? ? 0.352 0.114 ? 8 1 0.942 ? 1.660 1.710 ? ? ? ? ? ? 1040 90.300 ? ? ? ? 0.294 ? ? ? ? ? ? ? ? 9.000 ? 1.563 ? ? 0.311 0.099 ? 9 1 0.955 ? 1.710 1.760 ? ? ? ? ? ? 1056 92.600 ? ? ? ? 0.270 ? ? ? ? ? ? ? ? 8.700 ? 1.724 ? ? 0.287 0.094 ? 10 1 0.958 ? 1.760 1.830 ? ? ? ? ? ? 1049 90.300 ? ? ? ? 0.240 ? ? ? ? ? ? ? ? 8.200 ? 2.046 ? ? 0.255 0.085 ? 11 1 0.969 ? 1.830 1.900 ? ? ? ? ? ? 1038 92.900 ? ? ? ? 0.221 ? ? ? ? ? ? ? ? 7.800 ? 2.256 ? ? 0.237 0.082 ? 12 1 0.967 ? 1.900 1.990 ? ? ? ? ? ? 1095 92.900 ? ? ? ? 0.195 ? ? ? ? ? ? ? ? 8.200 ? 2.508 ? ? 0.208 0.069 ? 13 1 0.978 ? 1.990 2.090 ? ? ? ? ? ? 1092 95.600 ? ? ? ? 0.178 ? ? ? ? ? ? ? ? 8.000 ? 2.896 ? ? 0.190 0.065 ? 14 1 0.981 ? 2.090 2.220 ? ? ? ? ? ? 1127 96.000 ? ? ? ? 0.153 ? ? ? ? ? ? ? ? 7.500 ? 3.242 ? ? 0.164 0.057 ? 15 1 0.981 ? 2.220 2.390 ? ? ? ? ? ? 1133 96.300 ? ? ? ? 0.137 ? ? ? ? ? ? ? ? 6.800 ? 3.494 ? ? 0.149 0.056 ? 16 1 0.977 ? 2.390 2.630 ? ? ? ? ? ? 1135 99.000 ? ? ? ? 0.132 ? ? ? ? ? ? ? ? 7.600 ? 3.548 ? ? 0.142 0.051 ? 17 1 0.988 ? 2.630 3.020 ? ? ? ? ? ? 1195 99.600 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 7.400 ? 3.556 ? ? 0.126 0.046 ? 18 1 0.988 ? 3.020 3.800 ? ? ? ? ? ? 1167 99.200 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? 7.100 ? 3.818 ? ? 0.110 0.042 ? 19 1 0.990 ? 3.800 50.000 ? ? ? ? ? ? 1290 99.200 ? ? ? ? 0.093 ? ? ? ? ? ? ? ? 7.600 ? 3.896 ? ? 0.100 0.036 ? 20 1 0.994 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 72.480 _refine.B_iso_mean 19.7242 _refine.B_iso_min 8.120 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6KMJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.4000 _refine.ls_d_res_low 28.7080 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21764 _refine.ls_number_reflns_R_free 1110 _refine.ls_number_reflns_R_work 20654 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.2600 _refine.ls_percent_reflns_R_free 5.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1660 _refine.ls_R_factor_R_free 0.1884 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1647 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2GRC _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.3500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.4000 _refine_hist.d_res_low 28.7080 _refine_hist.number_atoms_solvent 129 _refine_hist.number_atoms_total 1202 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 129 _refine_hist.pdbx_B_iso_mean_ligand 28.13 _refine_hist.pdbx_B_iso_mean_solvent 34.28 _refine_hist.pdbx_number_atoms_protein 1067 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.4001 1.4638 . . 119 2485 93.0000 . . . 0.2341 0.0000 0.1951 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4638 1.5409 . . 133 2494 92.0000 . . . 0.2167 0.0000 0.1738 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5409 1.6375 . . 140 2499 93.0000 . . . 0.2085 0.0000 0.1644 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6375 1.7639 . . 139 2475 91.0000 . . . 0.2058 0.0000 0.1632 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7639 1.9414 . . 111 2521 92.0000 . . . 0.2069 0.0000 0.1649 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9414 2.2222 . . 162 2594 95.0000 . . . 0.1790 0.0000 0.1598 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2222 2.7993 . . 146 2709 98.0000 . . . 0.1843 0.0000 0.1649 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7993 28.7 . . 160 2877 99.0000 . . . 0.1774 0.0000 0.1627 . . . . . . . . . . # _struct.entry_id 6KMJ _struct.title 'Crystal structure of Sth1 bromodomain in complex with H3K14Ac' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6KMJ _struct_keywords.text 'Chromatin remodeling, histone acetylation, RSC complex, Sth1, bromodomain, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP STH1_YEAST P32597 ? 1 ;SLGIFPTVEKLVEEMREQLDEVDSHPRTSIFEKLPSKRDYPDYFKVIEKPMAIDIILKNCKNGTYKTLEEVRQALQTMFE NARFYNEEGSWVYVDADKLNEFTDEWFKEHSS ; 1248 2 UNP H3_YEAST P61830 ? 2 TARKSTGGKAPRKQLA 7 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6KMJ A 1 ? 112 ? P32597 1248 ? 1359 ? 1248 1359 2 2 6KMJ C 1 ? 16 ? P61830 7 ? 22 ? 6 21 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 6KMJ _struct_ref_seq_dif.mon_id TYR _struct_ref_seq_dif.pdbx_pdb_strand_id C _struct_ref_seq_dif.seq_num 17 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P61830 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 22 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1810 ? 1 MORE -9 ? 1 'SSA (A^2)' 7640 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details 'Sth1 (chain A) and H3 (chain B) form 1:1 complex.' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 4 ? GLU A 17 ? ILE A 1251 GLU A 1264 1 ? 14 HELX_P HELX_P2 AA2 THR A 28 ? GLU A 32 ? THR A 1275 GLU A 1279 5 ? 5 HELX_P HELX_P3 AA3 ASP A 42 ? ILE A 47 ? ASP A 1289 ILE A 1294 1 ? 6 HELX_P HELX_P4 AA4 ALA A 52 ? ASN A 62 ? ALA A 1299 ASN A 1309 1 ? 11 HELX_P HELX_P5 AA5 THR A 67 ? ASN A 86 ? THR A 1314 ASN A 1333 1 ? 20 HELX_P HELX_P6 AA6 SER A 90 ? HIS A 110 ? SER A 1337 HIS A 1357 1 ? 21 HELX_P HELX_P7 AA7 ARG B 12 ? TYR B 17 ? ARG C 17 TYR C 22 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B GLY 8 C ? ? ? 1_555 B ALY 9 N ? ? C GLY 13 C ALY 14 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? B ALY 9 C ? ? ? 1_555 B ALA 10 N ? ? C ALY 14 C ALA 15 1_555 ? ? ? ? ? ? ? 1.317 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id ALY _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 9 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id ALY _pdbx_modification_feature.auth_asym_id C _pdbx_modification_feature.auth_seq_id 14 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id LYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id ALY _pdbx_modification_feature.type Acetylation _pdbx_modification_feature.category 'Named protein modification' # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id GOL _struct_site.pdbx_auth_seq_id 1401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'binding site for residue GOL A 1401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 ARG A 38 ? ARG A 1285 . ? 1_455 ? 2 AC1 11 ASP A 39 ? ASP A 1286 . ? 1_455 ? 3 AC1 11 VAL A 46 ? VAL A 1293 . ? 1_555 ? 4 AC1 11 ILE A 47 ? ILE A 1294 . ? 1_555 ? 5 AC1 11 GLU A 48 ? GLU A 1295 . ? 1_555 ? 6 AC1 11 GLU A 80 ? GLU A 1327 . ? 1_555 ? 7 AC1 11 ASN A 81 ? ASN A 1328 . ? 1_555 ? 8 AC1 11 HOH D . ? HOH A 1509 . ? 1_555 ? 9 AC1 11 HOH D . ? HOH A 1521 . ? 1_555 ? 10 AC1 11 LYS B 13 ? LYS C 18 . ? 8_445 ? 11 AC1 11 TYR B 17 ? TYR C 22 . ? 8_445 ? # _pdbx_entry_details.entry_id 6KMJ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id ALY _pdbx_struct_mod_residue.label_seq_id 9 _pdbx_struct_mod_residue.auth_asym_id C _pdbx_struct_mod_residue.auth_comp_id ALY _pdbx_struct_mod_residue.auth_seq_id 14 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details 'modified residue' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -1.7313 -17.9150 -32.8253 0.1332 ? -0.0238 ? 0.0116 ? 0.1959 ? -0.0439 ? 0.1204 ? 2.8094 ? 0.7147 ? 1.1934 ? 1.9599 ? 0.9373 ? 4.0156 ? -0.1767 ? 0.5929 ? -0.2427 ? -0.2024 ? 0.1608 ? -0.0059 ? 0.1222 ? 0.1560 ? -0.0323 ? 2 'X-RAY DIFFRACTION' ? refined 3.5679 -12.3594 -17.2217 0.1062 ? -0.0128 ? -0.0101 ? 0.1139 ? -0.0033 ? 0.1151 ? 1.3226 ? 0.3735 ? -0.4906 ? 1.5368 ? -0.5315 ? 1.8122 ? -0.0390 ? -0.0451 ? 0.0277 ? -0.0195 ? -0.0278 ? -0.1601 ? -0.0237 ? 0.1279 ? 0.0753 ? 3 'X-RAY DIFFRACTION' ? refined -5.9703 -23.2032 -9.6493 0.1646 ? -0.0177 ? 0.0343 ? 0.1842 ? 0.0415 ? 0.1675 ? 2.0121 ? -0.0965 ? -0.6337 ? 2.0483 ? -0.2449 ? 0.9175 ? -0.1715 ? -0.3390 ? -0.3019 ? 0.1391 ? 0.0383 ? 0.2054 ? 0.3989 ? -0.1092 ? 0.1602 ? 4 'X-RAY DIFFRACTION' ? refined -7.7767 -19.2048 -21.0519 0.0979 ? -0.0137 ? -0.0040 ? 0.0931 ? 0.0100 ? 0.1012 ? 1.2331 ? 0.0160 ? -0.1614 ? 1.4409 ? 1.1278 ? 3.2376 ? -0.0203 ? 0.0873 ? -0.0496 ? -0.0110 ? -0.0556 ? 0.0625 ? 0.1508 ? -0.2562 ? 0.0538 ? 5 'X-RAY DIFFRACTION' ? refined -8.3400 -8.5754 -25.0451 0.1375 ? 0.0143 ? -0.0094 ? 0.1402 ? 0.0224 ? 0.1322 ? 1.2826 ? 0.4761 ? 1.2980 ? 0.5958 ? 0.5802 ? 3.7135 ? -0.0254 ? 0.1285 ? 0.1362 ? -0.1253 ? -0.0157 ? 0.0589 ? -0.2068 ? -0.1806 ? 0.1062 ? 6 'X-RAY DIFFRACTION' ? refined 3.2754 -9.2337 -8.9567 0.1383 ? 0.0034 ? -0.0118 ? 0.1411 ? 0.0042 ? 0.1592 ? 1.4216 ? 0.4084 ? -0.0524 ? 0.6053 ? -0.2315 ? 0.0956 ? 0.0166 ? -0.0309 ? 0.1763 ? -0.0557 ? -0.0780 ? 0.0163 ? -0.0559 ? 0.0656 ? 0.0522 ? 7 'X-RAY DIFFRACTION' ? refined -4.6399 -14.6270 2.2865 0.1566 ? 0.0148 ? 0.0088 ? 0.1623 ? 0.0124 ? 0.1442 ? 3.2271 ? -0.4460 ? 2.1341 ? 1.9723 ? -0.8627 ? 4.8322 ? 0.2148 ? -0.3567 ? 0.1174 ? -0.0434 ? 0.0069 ? -0.0552 ? 0.2664 ? -0.0646 ? -0.1095 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 1248 through 1263 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 1264 through 1287 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 1288 through 1299 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 1300 through 1337 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 1338 through 1359 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? C 6 ? ? C 17 ? ;chain 'C' and (resid 6 through 17 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? C 18 ? ? C 22 ? ;chain 'C' and (resid 18 through 22 ) ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ALY OH O N N 14 ALY CH C N N 15 ALY CH3 C N N 16 ALY NZ N N N 17 ALY CE C N N 18 ALY CD C N N 19 ALY CG C N N 20 ALY CB C N N 21 ALY CA C N S 22 ALY N N N N 23 ALY C C N N 24 ALY O O N N 25 ALY OXT O N N 26 ALY HH31 H N N 27 ALY HH32 H N N 28 ALY HH33 H N N 29 ALY HZ H N N 30 ALY HE3 H N N 31 ALY HE2 H N N 32 ALY HD3 H N N 33 ALY HD2 H N N 34 ALY HG3 H N N 35 ALY HG2 H N N 36 ALY HB3 H N N 37 ALY HB2 H N N 38 ALY HA H N N 39 ALY H H N N 40 ALY H2 H N N 41 ALY HXT H N N 42 ARG N N N N 43 ARG CA C N S 44 ARG C C N N 45 ARG O O N N 46 ARG CB C N N 47 ARG CG C N N 48 ARG CD C N N 49 ARG NE N N N 50 ARG CZ C N N 51 ARG NH1 N N N 52 ARG NH2 N N N 53 ARG OXT O N N 54 ARG H H N N 55 ARG H2 H N N 56 ARG HA H N N 57 ARG HB2 H N N 58 ARG HB3 H N N 59 ARG HG2 H N N 60 ARG HG3 H N N 61 ARG HD2 H N N 62 ARG HD3 H N N 63 ARG HE H N N 64 ARG HH11 H N N 65 ARG HH12 H N N 66 ARG HH21 H N N 67 ARG HH22 H N N 68 ARG HXT H N N 69 ASN N N N N 70 ASN CA C N S 71 ASN C C N N 72 ASN O O N N 73 ASN CB C N N 74 ASN CG C N N 75 ASN OD1 O N N 76 ASN ND2 N N N 77 ASN OXT O N N 78 ASN H H N N 79 ASN H2 H N N 80 ASN HA H N N 81 ASN HB2 H N N 82 ASN HB3 H N N 83 ASN HD21 H N N 84 ASN HD22 H N N 85 ASN HXT H N N 86 ASP N N N N 87 ASP CA C N S 88 ASP C C N N 89 ASP O O N N 90 ASP CB C N N 91 ASP CG C N N 92 ASP OD1 O N N 93 ASP OD2 O N N 94 ASP OXT O N N 95 ASP H H N N 96 ASP H2 H N N 97 ASP HA H N N 98 ASP HB2 H N N 99 ASP HB3 H N N 100 ASP HD2 H N N 101 ASP HXT H N N 102 CYS N N N N 103 CYS CA C N R 104 CYS C C N N 105 CYS O O N N 106 CYS CB C N N 107 CYS SG S N N 108 CYS OXT O N N 109 CYS H H N N 110 CYS H2 H N N 111 CYS HA H N N 112 CYS HB2 H N N 113 CYS HB3 H N N 114 CYS HG H N N 115 CYS HXT H N N 116 GLN N N N N 117 GLN CA C N S 118 GLN C C N N 119 GLN O O N N 120 GLN CB C N N 121 GLN CG C N N 122 GLN CD C N N 123 GLN OE1 O N N 124 GLN NE2 N N N 125 GLN OXT O N N 126 GLN H H N N 127 GLN H2 H N N 128 GLN HA H N N 129 GLN HB2 H N N 130 GLN HB3 H N N 131 GLN HG2 H N N 132 GLN HG3 H N N 133 GLN HE21 H N N 134 GLN HE22 H N N 135 GLN HXT H N N 136 GLU N N N N 137 GLU CA C N S 138 GLU C C N N 139 GLU O O N N 140 GLU CB C N N 141 GLU CG C N N 142 GLU CD C N N 143 GLU OE1 O N N 144 GLU OE2 O N N 145 GLU OXT O N N 146 GLU H H N N 147 GLU H2 H N N 148 GLU HA H N N 149 GLU HB2 H N N 150 GLU HB3 H N N 151 GLU HG2 H N N 152 GLU HG3 H N N 153 GLU HE2 H N N 154 GLU HXT H N N 155 GLY N N N N 156 GLY CA C N N 157 GLY C C N N 158 GLY O O N N 159 GLY OXT O N N 160 GLY H H N N 161 GLY H2 H N N 162 GLY HA2 H N N 163 GLY HA3 H N N 164 GLY HXT H N N 165 GOL C1 C N N 166 GOL O1 O N N 167 GOL C2 C N N 168 GOL O2 O N N 169 GOL C3 C N N 170 GOL O3 O N N 171 GOL H11 H N N 172 GOL H12 H N N 173 GOL HO1 H N N 174 GOL H2 H N N 175 GOL HO2 H N N 176 GOL H31 H N N 177 GOL H32 H N N 178 GOL HO3 H N N 179 HIS N N N N 180 HIS CA C N S 181 HIS C C N N 182 HIS O O N N 183 HIS CB C N N 184 HIS CG C Y N 185 HIS ND1 N Y N 186 HIS CD2 C Y N 187 HIS CE1 C Y N 188 HIS NE2 N Y N 189 HIS OXT O N N 190 HIS H H N N 191 HIS H2 H N N 192 HIS HA H N N 193 HIS HB2 H N N 194 HIS HB3 H N N 195 HIS HD1 H N N 196 HIS HD2 H N N 197 HIS HE1 H N N 198 HIS HE2 H N N 199 HIS HXT H N N 200 HOH O O N N 201 HOH H1 H N N 202 HOH H2 H N N 203 ILE N N N N 204 ILE CA C N S 205 ILE C C N N 206 ILE O O N N 207 ILE CB C N S 208 ILE CG1 C N N 209 ILE CG2 C N N 210 ILE CD1 C N N 211 ILE OXT O N N 212 ILE H H N N 213 ILE H2 H N N 214 ILE HA H N N 215 ILE HB H N N 216 ILE HG12 H N N 217 ILE HG13 H N N 218 ILE HG21 H N N 219 ILE HG22 H N N 220 ILE HG23 H N N 221 ILE HD11 H N N 222 ILE HD12 H N N 223 ILE HD13 H N N 224 ILE HXT H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 MET N N N N 273 MET CA C N S 274 MET C C N N 275 MET O O N N 276 MET CB C N N 277 MET CG C N N 278 MET SD S N N 279 MET CE C N N 280 MET OXT O N N 281 MET H H N N 282 MET H2 H N N 283 MET HA H N N 284 MET HB2 H N N 285 MET HB3 H N N 286 MET HG2 H N N 287 MET HG3 H N N 288 MET HE1 H N N 289 MET HE2 H N N 290 MET HE3 H N N 291 MET HXT H N N 292 PHE N N N N 293 PHE CA C N S 294 PHE C C N N 295 PHE O O N N 296 PHE CB C N N 297 PHE CG C Y N 298 PHE CD1 C Y N 299 PHE CD2 C Y N 300 PHE CE1 C Y N 301 PHE CE2 C Y N 302 PHE CZ C Y N 303 PHE OXT O N N 304 PHE H H N N 305 PHE H2 H N N 306 PHE HA H N N 307 PHE HB2 H N N 308 PHE HB3 H N N 309 PHE HD1 H N N 310 PHE HD2 H N N 311 PHE HE1 H N N 312 PHE HE2 H N N 313 PHE HZ H N N 314 PHE HXT H N N 315 PRO N N N N 316 PRO CA C N S 317 PRO C C N N 318 PRO O O N N 319 PRO CB C N N 320 PRO CG C N N 321 PRO CD C N N 322 PRO OXT O N N 323 PRO H H N N 324 PRO HA H N N 325 PRO HB2 H N N 326 PRO HB3 H N N 327 PRO HG2 H N N 328 PRO HG3 H N N 329 PRO HD2 H N N 330 PRO HD3 H N N 331 PRO HXT H N N 332 SER N N N N 333 SER CA C N S 334 SER C C N N 335 SER O O N N 336 SER CB C N N 337 SER OG O N N 338 SER OXT O N N 339 SER H H N N 340 SER H2 H N N 341 SER HA H N N 342 SER HB2 H N N 343 SER HB3 H N N 344 SER HG H N N 345 SER HXT H N N 346 THR N N N N 347 THR CA C N S 348 THR C C N N 349 THR O O N N 350 THR CB C N R 351 THR OG1 O N N 352 THR CG2 C N N 353 THR OXT O N N 354 THR H H N N 355 THR H2 H N N 356 THR HA H N N 357 THR HB H N N 358 THR HG1 H N N 359 THR HG21 H N N 360 THR HG22 H N N 361 THR HG23 H N N 362 THR HXT H N N 363 TRP N N N N 364 TRP CA C N S 365 TRP C C N N 366 TRP O O N N 367 TRP CB C N N 368 TRP CG C Y N 369 TRP CD1 C Y N 370 TRP CD2 C Y N 371 TRP NE1 N Y N 372 TRP CE2 C Y N 373 TRP CE3 C Y N 374 TRP CZ2 C Y N 375 TRP CZ3 C Y N 376 TRP CH2 C Y N 377 TRP OXT O N N 378 TRP H H N N 379 TRP H2 H N N 380 TRP HA H N N 381 TRP HB2 H N N 382 TRP HB3 H N N 383 TRP HD1 H N N 384 TRP HE1 H N N 385 TRP HE3 H N N 386 TRP HZ2 H N N 387 TRP HZ3 H N N 388 TRP HH2 H N N 389 TRP HXT H N N 390 TYR N N N N 391 TYR CA C N S 392 TYR C C N N 393 TYR O O N N 394 TYR CB C N N 395 TYR CG C Y N 396 TYR CD1 C Y N 397 TYR CD2 C Y N 398 TYR CE1 C Y N 399 TYR CE2 C Y N 400 TYR CZ C Y N 401 TYR OH O N N 402 TYR OXT O N N 403 TYR H H N N 404 TYR H2 H N N 405 TYR HA H N N 406 TYR HB2 H N N 407 TYR HB3 H N N 408 TYR HD1 H N N 409 TYR HD2 H N N 410 TYR HE1 H N N 411 TYR HE2 H N N 412 TYR HH H N N 413 TYR HXT H N N 414 VAL N N N N 415 VAL CA C N S 416 VAL C C N N 417 VAL O O N N 418 VAL CB C N N 419 VAL CG1 C N N 420 VAL CG2 C N N 421 VAL OXT O N N 422 VAL H H N N 423 VAL H2 H N N 424 VAL HA H N N 425 VAL HB H N N 426 VAL HG11 H N N 427 VAL HG12 H N N 428 VAL HG13 H N N 429 VAL HG21 H N N 430 VAL HG22 H N N 431 VAL HG23 H N N 432 VAL HXT H N N 433 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ALY OH CH doub N N 13 ALY CH CH3 sing N N 14 ALY CH NZ sing N N 15 ALY CH3 HH31 sing N N 16 ALY CH3 HH32 sing N N 17 ALY CH3 HH33 sing N N 18 ALY NZ CE sing N N 19 ALY NZ HZ sing N N 20 ALY CE CD sing N N 21 ALY CE HE3 sing N N 22 ALY CE HE2 sing N N 23 ALY CD CG sing N N 24 ALY CD HD3 sing N N 25 ALY CD HD2 sing N N 26 ALY CG CB sing N N 27 ALY CG HG3 sing N N 28 ALY CG HG2 sing N N 29 ALY CB CA sing N N 30 ALY CB HB3 sing N N 31 ALY CB HB2 sing N N 32 ALY CA N sing N N 33 ALY CA C sing N N 34 ALY CA HA sing N N 35 ALY N H sing N N 36 ALY N H2 sing N N 37 ALY C O doub N N 38 ALY C OXT sing N N 39 ALY OXT HXT sing N N 40 ARG N CA sing N N 41 ARG N H sing N N 42 ARG N H2 sing N N 43 ARG CA C sing N N 44 ARG CA CB sing N N 45 ARG CA HA sing N N 46 ARG C O doub N N 47 ARG C OXT sing N N 48 ARG CB CG sing N N 49 ARG CB HB2 sing N N 50 ARG CB HB3 sing N N 51 ARG CG CD sing N N 52 ARG CG HG2 sing N N 53 ARG CG HG3 sing N N 54 ARG CD NE sing N N 55 ARG CD HD2 sing N N 56 ARG CD HD3 sing N N 57 ARG NE CZ sing N N 58 ARG NE HE sing N N 59 ARG CZ NH1 sing N N 60 ARG CZ NH2 doub N N 61 ARG NH1 HH11 sing N N 62 ARG NH1 HH12 sing N N 63 ARG NH2 HH21 sing N N 64 ARG NH2 HH22 sing N N 65 ARG OXT HXT sing N N 66 ASN N CA sing N N 67 ASN N H sing N N 68 ASN N H2 sing N N 69 ASN CA C sing N N 70 ASN CA CB sing N N 71 ASN CA HA sing N N 72 ASN C O doub N N 73 ASN C OXT sing N N 74 ASN CB CG sing N N 75 ASN CB HB2 sing N N 76 ASN CB HB3 sing N N 77 ASN CG OD1 doub N N 78 ASN CG ND2 sing N N 79 ASN ND2 HD21 sing N N 80 ASN ND2 HD22 sing N N 81 ASN OXT HXT sing N N 82 ASP N CA sing N N 83 ASP N H sing N N 84 ASP N H2 sing N N 85 ASP CA C sing N N 86 ASP CA CB sing N N 87 ASP CA HA sing N N 88 ASP C O doub N N 89 ASP C OXT sing N N 90 ASP CB CG sing N N 91 ASP CB HB2 sing N N 92 ASP CB HB3 sing N N 93 ASP CG OD1 doub N N 94 ASP CG OD2 sing N N 95 ASP OD2 HD2 sing N N 96 ASP OXT HXT sing N N 97 CYS N CA sing N N 98 CYS N H sing N N 99 CYS N H2 sing N N 100 CYS CA C sing N N 101 CYS CA CB sing N N 102 CYS CA HA sing N N 103 CYS C O doub N N 104 CYS C OXT sing N N 105 CYS CB SG sing N N 106 CYS CB HB2 sing N N 107 CYS CB HB3 sing N N 108 CYS SG HG sing N N 109 CYS OXT HXT sing N N 110 GLN N CA sing N N 111 GLN N H sing N N 112 GLN N H2 sing N N 113 GLN CA C sing N N 114 GLN CA CB sing N N 115 GLN CA HA sing N N 116 GLN C O doub N N 117 GLN C OXT sing N N 118 GLN CB CG sing N N 119 GLN CB HB2 sing N N 120 GLN CB HB3 sing N N 121 GLN CG CD sing N N 122 GLN CG HG2 sing N N 123 GLN CG HG3 sing N N 124 GLN CD OE1 doub N N 125 GLN CD NE2 sing N N 126 GLN NE2 HE21 sing N N 127 GLN NE2 HE22 sing N N 128 GLN OXT HXT sing N N 129 GLU N CA sing N N 130 GLU N H sing N N 131 GLU N H2 sing N N 132 GLU CA C sing N N 133 GLU CA CB sing N N 134 GLU CA HA sing N N 135 GLU C O doub N N 136 GLU C OXT sing N N 137 GLU CB CG sing N N 138 GLU CB HB2 sing N N 139 GLU CB HB3 sing N N 140 GLU CG CD sing N N 141 GLU CG HG2 sing N N 142 GLU CG HG3 sing N N 143 GLU CD OE1 doub N N 144 GLU CD OE2 sing N N 145 GLU OE2 HE2 sing N N 146 GLU OXT HXT sing N N 147 GLY N CA sing N N 148 GLY N H sing N N 149 GLY N H2 sing N N 150 GLY CA C sing N N 151 GLY CA HA2 sing N N 152 GLY CA HA3 sing N N 153 GLY C O doub N N 154 GLY C OXT sing N N 155 GLY OXT HXT sing N N 156 GOL C1 O1 sing N N 157 GOL C1 C2 sing N N 158 GOL C1 H11 sing N N 159 GOL C1 H12 sing N N 160 GOL O1 HO1 sing N N 161 GOL C2 O2 sing N N 162 GOL C2 C3 sing N N 163 GOL C2 H2 sing N N 164 GOL O2 HO2 sing N N 165 GOL C3 O3 sing N N 166 GOL C3 H31 sing N N 167 GOL C3 H32 sing N N 168 GOL O3 HO3 sing N N 169 HIS N CA sing N N 170 HIS N H sing N N 171 HIS N H2 sing N N 172 HIS CA C sing N N 173 HIS CA CB sing N N 174 HIS CA HA sing N N 175 HIS C O doub N N 176 HIS C OXT sing N N 177 HIS CB CG sing N N 178 HIS CB HB2 sing N N 179 HIS CB HB3 sing N N 180 HIS CG ND1 sing Y N 181 HIS CG CD2 doub Y N 182 HIS ND1 CE1 doub Y N 183 HIS ND1 HD1 sing N N 184 HIS CD2 NE2 sing Y N 185 HIS CD2 HD2 sing N N 186 HIS CE1 NE2 sing Y N 187 HIS CE1 HE1 sing N N 188 HIS NE2 HE2 sing N N 189 HIS OXT HXT sing N N 190 HOH O H1 sing N N 191 HOH O H2 sing N N 192 ILE N CA sing N N 193 ILE N H sing N N 194 ILE N H2 sing N N 195 ILE CA C sing N N 196 ILE CA CB sing N N 197 ILE CA HA sing N N 198 ILE C O doub N N 199 ILE C OXT sing N N 200 ILE CB CG1 sing N N 201 ILE CB CG2 sing N N 202 ILE CB HB sing N N 203 ILE CG1 CD1 sing N N 204 ILE CG1 HG12 sing N N 205 ILE CG1 HG13 sing N N 206 ILE CG2 HG21 sing N N 207 ILE CG2 HG22 sing N N 208 ILE CG2 HG23 sing N N 209 ILE CD1 HD11 sing N N 210 ILE CD1 HD12 sing N N 211 ILE CD1 HD13 sing N N 212 ILE OXT HXT sing N N 213 LEU N CA sing N N 214 LEU N H sing N N 215 LEU N H2 sing N N 216 LEU CA C sing N N 217 LEU CA CB sing N N 218 LEU CA HA sing N N 219 LEU C O doub N N 220 LEU C OXT sing N N 221 LEU CB CG sing N N 222 LEU CB HB2 sing N N 223 LEU CB HB3 sing N N 224 LEU CG CD1 sing N N 225 LEU CG CD2 sing N N 226 LEU CG HG sing N N 227 LEU CD1 HD11 sing N N 228 LEU CD1 HD12 sing N N 229 LEU CD1 HD13 sing N N 230 LEU CD2 HD21 sing N N 231 LEU CD2 HD22 sing N N 232 LEU CD2 HD23 sing N N 233 LEU OXT HXT sing N N 234 LYS N CA sing N N 235 LYS N H sing N N 236 LYS N H2 sing N N 237 LYS CA C sing N N 238 LYS CA CB sing N N 239 LYS CA HA sing N N 240 LYS C O doub N N 241 LYS C OXT sing N N 242 LYS CB CG sing N N 243 LYS CB HB2 sing N N 244 LYS CB HB3 sing N N 245 LYS CG CD sing N N 246 LYS CG HG2 sing N N 247 LYS CG HG3 sing N N 248 LYS CD CE sing N N 249 LYS CD HD2 sing N N 250 LYS CD HD3 sing N N 251 LYS CE NZ sing N N 252 LYS CE HE2 sing N N 253 LYS CE HE3 sing N N 254 LYS NZ HZ1 sing N N 255 LYS NZ HZ2 sing N N 256 LYS NZ HZ3 sing N N 257 LYS OXT HXT sing N N 258 MET N CA sing N N 259 MET N H sing N N 260 MET N H2 sing N N 261 MET CA C sing N N 262 MET CA CB sing N N 263 MET CA HA sing N N 264 MET C O doub N N 265 MET C OXT sing N N 266 MET CB CG sing N N 267 MET CB HB2 sing N N 268 MET CB HB3 sing N N 269 MET CG SD sing N N 270 MET CG HG2 sing N N 271 MET CG HG3 sing N N 272 MET SD CE sing N N 273 MET CE HE1 sing N N 274 MET CE HE2 sing N N 275 MET CE HE3 sing N N 276 MET OXT HXT sing N N 277 PHE N CA sing N N 278 PHE N H sing N N 279 PHE N H2 sing N N 280 PHE CA C sing N N 281 PHE CA CB sing N N 282 PHE CA HA sing N N 283 PHE C O doub N N 284 PHE C OXT sing N N 285 PHE CB CG sing N N 286 PHE CB HB2 sing N N 287 PHE CB HB3 sing N N 288 PHE CG CD1 doub Y N 289 PHE CG CD2 sing Y N 290 PHE CD1 CE1 sing Y N 291 PHE CD1 HD1 sing N N 292 PHE CD2 CE2 doub Y N 293 PHE CD2 HD2 sing N N 294 PHE CE1 CZ doub Y N 295 PHE CE1 HE1 sing N N 296 PHE CE2 CZ sing Y N 297 PHE CE2 HE2 sing N N 298 PHE CZ HZ sing N N 299 PHE OXT HXT sing N N 300 PRO N CA sing N N 301 PRO N CD sing N N 302 PRO N H sing N N 303 PRO CA C sing N N 304 PRO CA CB sing N N 305 PRO CA HA sing N N 306 PRO C O doub N N 307 PRO C OXT sing N N 308 PRO CB CG sing N N 309 PRO CB HB2 sing N N 310 PRO CB HB3 sing N N 311 PRO CG CD sing N N 312 PRO CG HG2 sing N N 313 PRO CG HG3 sing N N 314 PRO CD HD2 sing N N 315 PRO CD HD3 sing N N 316 PRO OXT HXT sing N N 317 SER N CA sing N N 318 SER N H sing N N 319 SER N H2 sing N N 320 SER CA C sing N N 321 SER CA CB sing N N 322 SER CA HA sing N N 323 SER C O doub N N 324 SER C OXT sing N N 325 SER CB OG sing N N 326 SER CB HB2 sing N N 327 SER CB HB3 sing N N 328 SER OG HG sing N N 329 SER OXT HXT sing N N 330 THR N CA sing N N 331 THR N H sing N N 332 THR N H2 sing N N 333 THR CA C sing N N 334 THR CA CB sing N N 335 THR CA HA sing N N 336 THR C O doub N N 337 THR C OXT sing N N 338 THR CB OG1 sing N N 339 THR CB CG2 sing N N 340 THR CB HB sing N N 341 THR OG1 HG1 sing N N 342 THR CG2 HG21 sing N N 343 THR CG2 HG22 sing N N 344 THR CG2 HG23 sing N N 345 THR OXT HXT sing N N 346 TRP N CA sing N N 347 TRP N H sing N N 348 TRP N H2 sing N N 349 TRP CA C sing N N 350 TRP CA CB sing N N 351 TRP CA HA sing N N 352 TRP C O doub N N 353 TRP C OXT sing N N 354 TRP CB CG sing N N 355 TRP CB HB2 sing N N 356 TRP CB HB3 sing N N 357 TRP CG CD1 doub Y N 358 TRP CG CD2 sing Y N 359 TRP CD1 NE1 sing Y N 360 TRP CD1 HD1 sing N N 361 TRP CD2 CE2 doub Y N 362 TRP CD2 CE3 sing Y N 363 TRP NE1 CE2 sing Y N 364 TRP NE1 HE1 sing N N 365 TRP CE2 CZ2 sing Y N 366 TRP CE3 CZ3 doub Y N 367 TRP CE3 HE3 sing N N 368 TRP CZ2 CH2 doub Y N 369 TRP CZ2 HZ2 sing N N 370 TRP CZ3 CH2 sing Y N 371 TRP CZ3 HZ3 sing N N 372 TRP CH2 HH2 sing N N 373 TRP OXT HXT sing N N 374 TYR N CA sing N N 375 TYR N H sing N N 376 TYR N H2 sing N N 377 TYR CA C sing N N 378 TYR CA CB sing N N 379 TYR CA HA sing N N 380 TYR C O doub N N 381 TYR C OXT sing N N 382 TYR CB CG sing N N 383 TYR CB HB2 sing N N 384 TYR CB HB3 sing N N 385 TYR CG CD1 doub Y N 386 TYR CG CD2 sing Y N 387 TYR CD1 CE1 sing Y N 388 TYR CD1 HD1 sing N N 389 TYR CD2 CE2 doub Y N 390 TYR CD2 HD2 sing N N 391 TYR CE1 CZ doub Y N 392 TYR CE1 HE1 sing N N 393 TYR CE2 CZ sing Y N 394 TYR CE2 HE2 sing N N 395 TYR CZ OH sing N N 396 TYR OH HH sing N N 397 TYR OXT HXT sing N N 398 VAL N CA sing N N 399 VAL N H sing N N 400 VAL N H2 sing N N 401 VAL CA C sing N N 402 VAL CA CB sing N N 403 VAL CA HA sing N N 404 VAL C O doub N N 405 VAL C OXT sing N N 406 VAL CB CG1 sing N N 407 VAL CB CG2 sing N N 408 VAL CB HB sing N N 409 VAL CG1 HG11 sing N N 410 VAL CG1 HG12 sing N N 411 VAL CG1 HG13 sing N N 412 VAL CG2 HG21 sing N N 413 VAL CG2 HG22 sing N N 414 VAL CG2 HG23 sing N N 415 VAL OXT HXT sing N N 416 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31670748 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2GRC _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6KMJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.041766 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016146 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006530 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ # loop_ #