data_6KYF # _entry.id 6KYF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6KYF pdb_00006kyf 10.2210/pdb6kyf/pdb WWPDB D_1300013856 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-09-23 2 'Structure model' 1 1 2021-06-02 3 'Structure model' 1 2 2024-03-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6KYF _pdbx_database_status.recvd_initial_deposition_date 2019-09-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Niu, Y.' 1 ? 'Wang, H.' 2 ? 'Zhang, Y.' 3 ? 'Feng, Y.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mol.Cell _citation.journal_id_ASTM MOCEFL _citation.journal_id_CSD 2168 _citation.journal_id_ISSN 1097-2765 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 80 _citation.language ? _citation.page_first 512 _citation.page_last 524.e5 _citation.title 'A Type I-F Anti-CRISPR Protein Inhibits the CRISPR-Cas Surveillance Complex by ADP-Ribosylation.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.molcel.2020.09.015 _citation.pdbx_database_id_PubMed 33049228 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Niu, Y.' 1 ? primary 'Yang, L.' 2 ? primary 'Gao, T.' 3 ? primary 'Dong, C.' 4 ? primary 'Zhang, B.' 5 ? primary 'Yin, P.' 6 ? primary 'Hopp, A.K.' 7 ? primary 'Li, D.' 8 ? primary 'Gan, R.' 9 ? primary 'Wang, H.' 10 ? primary 'Liu, X.' 11 ? primary 'Cao, X.' 12 ? primary 'Xie, Y.' 13 ? primary 'Meng, X.' 14 ? primary 'Deng, H.' 15 ? primary 'Zhang, X.' 16 ? primary 'Ren, J.' 17 ? primary 'Hottiger, M.O.' 18 ? primary 'Chen, Z.' 19 ? primary 'Zhang, Y.' 20 ? primary 'Liu, X.' 21 ? primary 'Feng, Y.' 22 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man AcrF11 14943.606 1 ? ? ? ? 2 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE 663.425 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSMSMELFHGSYEEISEIRDSGVFGGLFGAHEKETALSHGETLHRIISPLPLTDYALNYEIESAWEVALDVAGGDEN VAEAIMAKACESDSNDGWELQRLRGVLAVRLGYTSVEMEDEHGTTWLCLPGCTVEKI ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSMSMELFHGSYEEISEIRDSGVFGGLFGAHEKETALSHGETLHRIISPLPLTDYALNYEIESAWEVALDVAGGDEN VAEAIMAKACESDSNDGWELQRLRGVLAVRLGYTSVEMEDEHGTTWLCLPGCTVEKI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name NICOTINAMIDE-ADENINE-DINUCLEOTIDE _pdbx_entity_nonpoly.comp_id NAD # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 SER n 1 8 MET n 1 9 GLU n 1 10 LEU n 1 11 PHE n 1 12 HIS n 1 13 GLY n 1 14 SER n 1 15 TYR n 1 16 GLU n 1 17 GLU n 1 18 ILE n 1 19 SER n 1 20 GLU n 1 21 ILE n 1 22 ARG n 1 23 ASP n 1 24 SER n 1 25 GLY n 1 26 VAL n 1 27 PHE n 1 28 GLY n 1 29 GLY n 1 30 LEU n 1 31 PHE n 1 32 GLY n 1 33 ALA n 1 34 HIS n 1 35 GLU n 1 36 LYS n 1 37 GLU n 1 38 THR n 1 39 ALA n 1 40 LEU n 1 41 SER n 1 42 HIS n 1 43 GLY n 1 44 GLU n 1 45 THR n 1 46 LEU n 1 47 HIS n 1 48 ARG n 1 49 ILE n 1 50 ILE n 1 51 SER n 1 52 PRO n 1 53 LEU n 1 54 PRO n 1 55 LEU n 1 56 THR n 1 57 ASP n 1 58 TYR n 1 59 ALA n 1 60 LEU n 1 61 ASN n 1 62 TYR n 1 63 GLU n 1 64 ILE n 1 65 GLU n 1 66 SER n 1 67 ALA n 1 68 TRP n 1 69 GLU n 1 70 VAL n 1 71 ALA n 1 72 LEU n 1 73 ASP n 1 74 VAL n 1 75 ALA n 1 76 GLY n 1 77 GLY n 1 78 ASP n 1 79 GLU n 1 80 ASN n 1 81 VAL n 1 82 ALA n 1 83 GLU n 1 84 ALA n 1 85 ILE n 1 86 MET n 1 87 ALA n 1 88 LYS n 1 89 ALA n 1 90 CYS n 1 91 GLU n 1 92 SER n 1 93 ASP n 1 94 SER n 1 95 ASN n 1 96 ASP n 1 97 GLY n 1 98 TRP n 1 99 GLU n 1 100 LEU n 1 101 GLN n 1 102 ARG n 1 103 LEU n 1 104 ARG n 1 105 GLY n 1 106 VAL n 1 107 LEU n 1 108 ALA n 1 109 VAL n 1 110 ARG n 1 111 LEU n 1 112 GLY n 1 113 TYR n 1 114 THR n 1 115 SER n 1 116 VAL n 1 117 GLU n 1 118 MET n 1 119 GLU n 1 120 ASP n 1 121 GLU n 1 122 HIS n 1 123 GLY n 1 124 THR n 1 125 THR n 1 126 TRP n 1 127 LEU n 1 128 CYS n 1 129 LEU n 1 130 PRO n 1 131 GLY n 1 132 CYS n 1 133 THR n 1 134 VAL n 1 135 GLU n 1 136 LYS n 1 137 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 137 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene NCTC11440_04410 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAD non-polymer . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 -4 GLY GLY A . n A 1 2 PRO 2 -3 -3 PRO PRO A . n A 1 3 LEU 3 -2 -2 LEU LEU A . n A 1 4 GLY 4 -1 -1 GLY GLY A . n A 1 5 SER 5 0 0 SER SER A . n A 1 6 MET 6 1 1 MET MET A . n A 1 7 SER 7 2 2 SER SER A . n A 1 8 MET 8 3 3 MET MET A . n A 1 9 GLU 9 4 4 GLU GLU A . n A 1 10 LEU 10 5 5 LEU LEU A . n A 1 11 PHE 11 6 6 PHE PHE A . n A 1 12 HIS 12 7 7 HIS HIS A . n A 1 13 GLY 13 8 8 GLY GLY A . n A 1 14 SER 14 9 9 SER SER A . n A 1 15 TYR 15 10 10 TYR TYR A . n A 1 16 GLU 16 11 11 GLU GLU A . n A 1 17 GLU 17 12 12 GLU GLU A . n A 1 18 ILE 18 13 13 ILE ILE A . n A 1 19 SER 19 14 14 SER SER A . n A 1 20 GLU 20 15 15 GLU GLU A . n A 1 21 ILE 21 16 16 ILE ILE A . n A 1 22 ARG 22 17 17 ARG ARG A . n A 1 23 ASP 23 18 18 ASP ASP A . n A 1 24 SER 24 19 19 SER SER A . n A 1 25 GLY 25 20 20 GLY GLY A . n A 1 26 VAL 26 21 21 VAL VAL A . n A 1 27 PHE 27 22 22 PHE PHE A . n A 1 28 GLY 28 23 23 GLY GLY A . n A 1 29 GLY 29 24 24 GLY GLY A . n A 1 30 LEU 30 25 25 LEU LEU A . n A 1 31 PHE 31 26 26 PHE PHE A . n A 1 32 GLY 32 27 27 GLY GLY A . n A 1 33 ALA 33 28 28 ALA ALA A . n A 1 34 HIS 34 29 29 HIS HIS A . n A 1 35 GLU 35 30 30 GLU GLU A . n A 1 36 LYS 36 31 31 LYS LYS A . n A 1 37 GLU 37 32 32 GLU GLU A . n A 1 38 THR 38 33 33 THR THR A . n A 1 39 ALA 39 34 34 ALA ALA A . n A 1 40 LEU 40 35 35 LEU LEU A . n A 1 41 SER 41 36 36 SER SER A . n A 1 42 HIS 42 37 37 HIS HIS A . n A 1 43 GLY 43 38 38 GLY GLY A . n A 1 44 GLU 44 39 39 GLU GLU A . n A 1 45 THR 45 40 40 THR THR A . n A 1 46 LEU 46 41 41 LEU LEU A . n A 1 47 HIS 47 42 42 HIS HIS A . n A 1 48 ARG 48 43 43 ARG ARG A . n A 1 49 ILE 49 44 44 ILE ILE A . n A 1 50 ILE 50 45 45 ILE ILE A . n A 1 51 SER 51 46 46 SER SER A . n A 1 52 PRO 52 47 47 PRO PRO A . n A 1 53 LEU 53 48 48 LEU LEU A . n A 1 54 PRO 54 49 49 PRO PRO A . n A 1 55 LEU 55 50 50 LEU LEU A . n A 1 56 THR 56 51 51 THR THR A . n A 1 57 ASP 57 52 52 ASP ASP A . n A 1 58 TYR 58 53 53 TYR TYR A . n A 1 59 ALA 59 54 54 ALA ALA A . n A 1 60 LEU 60 55 55 LEU LEU A . n A 1 61 ASN 61 56 56 ASN ASN A . n A 1 62 TYR 62 57 57 TYR TYR A . n A 1 63 GLU 63 58 58 GLU GLU A . n A 1 64 ILE 64 59 59 ILE ILE A . n A 1 65 GLU 65 60 60 GLU GLU A . n A 1 66 SER 66 61 61 SER SER A . n A 1 67 ALA 67 62 62 ALA ALA A . n A 1 68 TRP 68 63 63 TRP TRP A . n A 1 69 GLU 69 64 64 GLU GLU A . n A 1 70 VAL 70 65 65 VAL VAL A . n A 1 71 ALA 71 66 66 ALA ALA A . n A 1 72 LEU 72 67 67 LEU LEU A . n A 1 73 ASP 73 68 68 ASP ASP A . n A 1 74 VAL 74 69 69 VAL VAL A . n A 1 75 ALA 75 70 70 ALA ALA A . n A 1 76 GLY 76 71 71 GLY GLY A . n A 1 77 GLY 77 72 72 GLY GLY A . n A 1 78 ASP 78 73 73 ASP ASP A . n A 1 79 GLU 79 74 74 GLU GLU A . n A 1 80 ASN 80 75 75 ASN ASN A . n A 1 81 VAL 81 76 76 VAL VAL A . n A 1 82 ALA 82 77 77 ALA ALA A . n A 1 83 GLU 83 78 78 GLU GLU A . n A 1 84 ALA 84 79 79 ALA ALA A . n A 1 85 ILE 85 80 80 ILE ILE A . n A 1 86 MET 86 81 81 MET MET A . n A 1 87 ALA 87 82 82 ALA ALA A . n A 1 88 LYS 88 83 83 LYS LYS A . n A 1 89 ALA 89 84 84 ALA ALA A . n A 1 90 CYS 90 85 85 CYS CYS A . n A 1 91 GLU 91 86 86 GLU GLU A . n A 1 92 SER 92 87 87 SER SER A . n A 1 93 ASP 93 88 88 ASP ASP A . n A 1 94 SER 94 89 89 SER SER A . n A 1 95 ASN 95 90 90 ASN ASN A . n A 1 96 ASP 96 91 91 ASP ASP A . n A 1 97 GLY 97 92 92 GLY GLY A . n A 1 98 TRP 98 93 93 TRP TRP A . n A 1 99 GLU 99 94 94 GLU GLU A . n A 1 100 LEU 100 95 95 LEU LEU A . n A 1 101 GLN 101 96 96 GLN GLN A . n A 1 102 ARG 102 97 97 ARG ARG A . n A 1 103 LEU 103 98 98 LEU LEU A . n A 1 104 ARG 104 99 99 ARG ARG A . n A 1 105 GLY 105 100 100 GLY GLY A . n A 1 106 VAL 106 101 101 VAL VAL A . n A 1 107 LEU 107 102 102 LEU LEU A . n A 1 108 ALA 108 103 103 ALA ALA A . n A 1 109 VAL 109 104 104 VAL VAL A . n A 1 110 ARG 110 105 105 ARG ARG A . n A 1 111 LEU 111 106 106 LEU LEU A . n A 1 112 GLY 112 107 107 GLY GLY A . n A 1 113 TYR 113 108 108 TYR TYR A . n A 1 114 THR 114 109 109 THR THR A . n A 1 115 SER 115 110 110 SER SER A . n A 1 116 VAL 116 111 111 VAL VAL A . n A 1 117 GLU 117 112 112 GLU GLU A . n A 1 118 MET 118 113 113 MET MET A . n A 1 119 GLU 119 114 114 GLU GLU A . n A 1 120 ASP 120 115 115 ASP ASP A . n A 1 121 GLU 121 116 116 GLU GLU A . n A 1 122 HIS 122 117 117 HIS HIS A . n A 1 123 GLY 123 118 118 GLY GLY A . n A 1 124 THR 124 119 119 THR THR A . n A 1 125 THR 125 120 120 THR THR A . n A 1 126 TRP 126 121 121 TRP TRP A . n A 1 127 LEU 127 122 122 LEU LEU A . n A 1 128 CYS 128 123 123 CYS CYS A . n A 1 129 LEU 129 124 124 LEU LEU A . n A 1 130 PRO 130 125 125 PRO PRO A . n A 1 131 GLY 131 126 126 GLY GLY A . n A 1 132 CYS 132 127 127 CYS CYS A . n A 1 133 THR 133 128 128 THR THR A . n A 1 134 VAL 134 129 129 VAL VAL A . n A 1 135 GLU 135 130 130 GLU GLU A . n A 1 136 LYS 136 131 131 LYS LYS A . n A 1 137 ILE 137 132 132 ILE ILE A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id NAD _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id NAD _pdbx_nonpoly_scheme.auth_mon_id NAD _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15_3459 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6KYF _cell.details ? _cell.formula_units_Z ? _cell.length_a 104.677 _cell.length_a_esd ? _cell.length_b 104.677 _cell.length_b_esd ? _cell.length_c 119.673 _cell.length_c_esd ? _cell.volume 1135610.357 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6KYF _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall 'P 62 2 (x,y,z+1/3)' _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6KYF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 6.33 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 80.58 _exptl_crystal.description 'The entry contains friedel pairs in F_plus/minus columns and I_plus/minus columns' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'HEPES, sodium citrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-03-21 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6KYF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.07 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7640 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.54 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 29.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.976 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.07 _reflns_shell.d_res_low 3.21 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 716 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.89 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 79.43 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details 'The entry contains friedel pairs in F_plus/minus columns and I_plus/minus columns' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6KYF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.07 _refine.ls_d_res_low 47.95 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7639 _refine.ls_number_reflns_R_free 619 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.52 _refine.ls_percent_reflns_R_free 4.54 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2056 _refine.ls_R_factor_R_free 0.2238 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2047 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.98 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.0745 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2103 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.07 _refine_hist.d_res_low 47.95 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1090 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1046 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 44 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0035 ? 1115 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7163 ? 1519 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0451 ? 167 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0034 ? 192 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 6.4905 ? 643 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.07 3.38 . . 146 3222 98.19 . . . 0.2744 . 0.2740 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.38 3.87 . . 146 3277 100.00 . . . 0.2256 . 0.2150 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.87 4.87 . . 164 3245 100.00 . . . 0.2073 . 0.1877 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.87 47.95 . . 163 3272 99.88 . . . 0.2242 . 0.1955 . . . . . . . . . . # _struct.entry_id 6KYF _struct.title 'Crystal structure of an anti-CRISPR protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6KYF _struct_keywords.text 'enzyme, NAD, viral protein' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6KYF _struct_ref.pdbx_db_accession 6KYF _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6KYF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 137 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6KYF _struct_ref_seq.db_align_beg -4 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 132 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -4 _struct_ref_seq.pdbx_auth_seq_align_end 132 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1020 ? 1 MORE -6 ? 1 'SSA (A^2)' 7460 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 35 ? SER A 41 ? GLU A 30 SER A 36 1 ? 7 HELX_P HELX_P2 AA2 THR A 56 ? GLU A 63 ? THR A 51 GLU A 58 1 ? 8 HELX_P HELX_P3 AA3 SER A 66 ? ALA A 75 ? SER A 61 ALA A 70 1 ? 10 HELX_P HELX_P4 AA4 ASP A 78 ? MET A 86 ? ASP A 73 MET A 81 1 ? 9 HELX_P HELX_P5 AA5 ASP A 96 ? GLY A 112 ? ASP A 91 GLY A 107 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 8 ? SER A 14 ? MET A 3 SER A 9 AA1 2 THR A 45 ? SER A 51 ? THR A 40 SER A 46 AA1 3 THR A 133 ? LYS A 136 ? THR A 128 LYS A 131 AA2 1 LEU A 30 ? GLY A 32 ? LEU A 25 GLY A 27 AA2 2 GLY A 123 ? CYS A 128 ? GLY A 118 CYS A 123 AA2 3 SER A 115 ? ASP A 120 ? SER A 110 ASP A 115 AA2 4 PRO A 54 ? LEU A 55 ? PRO A 49 LEU A 50 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 14 ? N SER A 9 O THR A 45 ? O THR A 40 AA1 2 3 N ARG A 48 ? N ARG A 43 O GLU A 135 ? O GLU A 130 AA2 1 2 N LEU A 30 ? N LEU A 25 O CYS A 128 ? O CYS A 123 AA2 2 3 O THR A 125 ? O THR A 120 N MET A 118 ? N MET A 113 AA2 3 4 O SER A 115 ? O SER A 110 N LEU A 55 ? N LEU A 50 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NAD _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 15 _struct_site.details 'binding site for residue NAD A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 HIS A 12 ? HIS A 7 . ? 1_555 ? 2 AC1 15 GLY A 13 ? GLY A 8 . ? 1_555 ? 3 AC1 15 SER A 14 ? SER A 9 . ? 1_555 ? 4 AC1 15 GLU A 16 ? GLU A 11 . ? 1_555 ? 5 AC1 15 ILE A 18 ? ILE A 13 . ? 1_555 ? 6 AC1 15 ILE A 21 ? ILE A 16 . ? 1_555 ? 7 AC1 15 ARG A 22 ? ARG A 17 . ? 1_555 ? 8 AC1 15 SER A 24 ? SER A 19 . ? 1_555 ? 9 AC1 15 GLY A 29 ? GLY A 24 . ? 1_555 ? 10 AC1 15 LEU A 30 ? LEU A 25 . ? 1_555 ? 11 AC1 15 PHE A 31 ? PHE A 26 . ? 1_555 ? 12 AC1 15 HIS A 42 ? HIS A 37 . ? 1_555 ? 13 AC1 15 GLN A 101 ? GLN A 96 . ? 1_555 ? 14 AC1 15 ASP A 120 ? ASP A 115 . ? 1_555 ? 15 AC1 15 THR A 125 ? THR A 120 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 99 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 112 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/3 3 y,-x+y,z+2/3 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 x-y,-y,-z 7 -x,-x+y,-z+1/3 8 -x,-y,z 9 y,x,-z+2/3 10 -y,-x,-z+2/3 11 -x+y,y,-z 12 x,x-y,-z+1/3 # _pdbx_entry_details.entry_id 6KYF _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 NAD PA P N S 247 NAD O1A O N N 248 NAD O2A O N N 249 NAD O5B O N N 250 NAD C5B C N N 251 NAD C4B C N R 252 NAD O4B O N N 253 NAD C3B C N S 254 NAD O3B O N N 255 NAD C2B C N R 256 NAD O2B O N N 257 NAD C1B C N R 258 NAD N9A N Y N 259 NAD C8A C Y N 260 NAD N7A N Y N 261 NAD C5A C Y N 262 NAD C6A C Y N 263 NAD N6A N N N 264 NAD N1A N Y N 265 NAD C2A C Y N 266 NAD N3A N Y N 267 NAD C4A C Y N 268 NAD O3 O N N 269 NAD PN P N N 270 NAD O1N O N N 271 NAD O2N O N N 272 NAD O5D O N N 273 NAD C5D C N N 274 NAD C4D C N R 275 NAD O4D O N N 276 NAD C3D C N S 277 NAD O3D O N N 278 NAD C2D C N R 279 NAD O2D O N N 280 NAD C1D C N R 281 NAD N1N N Y N 282 NAD C2N C Y N 283 NAD C3N C Y N 284 NAD C7N C N N 285 NAD O7N O N N 286 NAD N7N N N N 287 NAD C4N C Y N 288 NAD C5N C Y N 289 NAD C6N C Y N 290 NAD HOA2 H N N 291 NAD H51A H N N 292 NAD H52A H N N 293 NAD H4B H N N 294 NAD H3B H N N 295 NAD HO3A H N N 296 NAD H2B H N N 297 NAD HO2A H N N 298 NAD H1B H N N 299 NAD H8A H N N 300 NAD H61A H N N 301 NAD H62A H N N 302 NAD H2A H N N 303 NAD H51N H N N 304 NAD H52N H N N 305 NAD H4D H N N 306 NAD H3D H N N 307 NAD HO3N H N N 308 NAD H2D H N N 309 NAD HO2N H N N 310 NAD H1D H N N 311 NAD H2N H N N 312 NAD H71N H N N 313 NAD H72N H N N 314 NAD H4N H N N 315 NAD H5N H N N 316 NAD H6N H N N 317 PHE N N N N 318 PHE CA C N S 319 PHE C C N N 320 PHE O O N N 321 PHE CB C N N 322 PHE CG C Y N 323 PHE CD1 C Y N 324 PHE CD2 C Y N 325 PHE CE1 C Y N 326 PHE CE2 C Y N 327 PHE CZ C Y N 328 PHE OXT O N N 329 PHE H H N N 330 PHE H2 H N N 331 PHE HA H N N 332 PHE HB2 H N N 333 PHE HB3 H N N 334 PHE HD1 H N N 335 PHE HD2 H N N 336 PHE HE1 H N N 337 PHE HE2 H N N 338 PHE HZ H N N 339 PHE HXT H N N 340 PRO N N N N 341 PRO CA C N S 342 PRO C C N N 343 PRO O O N N 344 PRO CB C N N 345 PRO CG C N N 346 PRO CD C N N 347 PRO OXT O N N 348 PRO H H N N 349 PRO HA H N N 350 PRO HB2 H N N 351 PRO HB3 H N N 352 PRO HG2 H N N 353 PRO HG3 H N N 354 PRO HD2 H N N 355 PRO HD3 H N N 356 PRO HXT H N N 357 SER N N N N 358 SER CA C N S 359 SER C C N N 360 SER O O N N 361 SER CB C N N 362 SER OG O N N 363 SER OXT O N N 364 SER H H N N 365 SER H2 H N N 366 SER HA H N N 367 SER HB2 H N N 368 SER HB3 H N N 369 SER HG H N N 370 SER HXT H N N 371 THR N N N N 372 THR CA C N S 373 THR C C N N 374 THR O O N N 375 THR CB C N R 376 THR OG1 O N N 377 THR CG2 C N N 378 THR OXT O N N 379 THR H H N N 380 THR H2 H N N 381 THR HA H N N 382 THR HB H N N 383 THR HG1 H N N 384 THR HG21 H N N 385 THR HG22 H N N 386 THR HG23 H N N 387 THR HXT H N N 388 TRP N N N N 389 TRP CA C N S 390 TRP C C N N 391 TRP O O N N 392 TRP CB C N N 393 TRP CG C Y N 394 TRP CD1 C Y N 395 TRP CD2 C Y N 396 TRP NE1 N Y N 397 TRP CE2 C Y N 398 TRP CE3 C Y N 399 TRP CZ2 C Y N 400 TRP CZ3 C Y N 401 TRP CH2 C Y N 402 TRP OXT O N N 403 TRP H H N N 404 TRP H2 H N N 405 TRP HA H N N 406 TRP HB2 H N N 407 TRP HB3 H N N 408 TRP HD1 H N N 409 TRP HE1 H N N 410 TRP HE3 H N N 411 TRP HZ2 H N N 412 TRP HZ3 H N N 413 TRP HH2 H N N 414 TRP HXT H N N 415 TYR N N N N 416 TYR CA C N S 417 TYR C C N N 418 TYR O O N N 419 TYR CB C N N 420 TYR CG C Y N 421 TYR CD1 C Y N 422 TYR CD2 C Y N 423 TYR CE1 C Y N 424 TYR CE2 C Y N 425 TYR CZ C Y N 426 TYR OH O N N 427 TYR OXT O N N 428 TYR H H N N 429 TYR H2 H N N 430 TYR HA H N N 431 TYR HB2 H N N 432 TYR HB3 H N N 433 TYR HD1 H N N 434 TYR HD2 H N N 435 TYR HE1 H N N 436 TYR HE2 H N N 437 TYR HH H N N 438 TYR HXT H N N 439 VAL N N N N 440 VAL CA C N S 441 VAL C C N N 442 VAL O O N N 443 VAL CB C N N 444 VAL CG1 C N N 445 VAL CG2 C N N 446 VAL OXT O N N 447 VAL H H N N 448 VAL H2 H N N 449 VAL HA H N N 450 VAL HB H N N 451 VAL HG11 H N N 452 VAL HG12 H N N 453 VAL HG13 H N N 454 VAL HG21 H N N 455 VAL HG22 H N N 456 VAL HG23 H N N 457 VAL HXT H N N 458 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 NAD PA O1A doub N N 235 NAD PA O2A sing N N 236 NAD PA O5B sing N N 237 NAD PA O3 sing N N 238 NAD O2A HOA2 sing N N 239 NAD O5B C5B sing N N 240 NAD C5B C4B sing N N 241 NAD C5B H51A sing N N 242 NAD C5B H52A sing N N 243 NAD C4B O4B sing N N 244 NAD C4B C3B sing N N 245 NAD C4B H4B sing N N 246 NAD O4B C1B sing N N 247 NAD C3B O3B sing N N 248 NAD C3B C2B sing N N 249 NAD C3B H3B sing N N 250 NAD O3B HO3A sing N N 251 NAD C2B O2B sing N N 252 NAD C2B C1B sing N N 253 NAD C2B H2B sing N N 254 NAD O2B HO2A sing N N 255 NAD C1B N9A sing N N 256 NAD C1B H1B sing N N 257 NAD N9A C8A sing Y N 258 NAD N9A C4A sing Y N 259 NAD C8A N7A doub Y N 260 NAD C8A H8A sing N N 261 NAD N7A C5A sing Y N 262 NAD C5A C6A sing Y N 263 NAD C5A C4A doub Y N 264 NAD C6A N6A sing N N 265 NAD C6A N1A doub Y N 266 NAD N6A H61A sing N N 267 NAD N6A H62A sing N N 268 NAD N1A C2A sing Y N 269 NAD C2A N3A doub Y N 270 NAD C2A H2A sing N N 271 NAD N3A C4A sing Y N 272 NAD O3 PN sing N N 273 NAD PN O1N doub N N 274 NAD PN O2N sing N N 275 NAD PN O5D sing N N 276 NAD O5D C5D sing N N 277 NAD C5D C4D sing N N 278 NAD C5D H51N sing N N 279 NAD C5D H52N sing N N 280 NAD C4D O4D sing N N 281 NAD C4D C3D sing N N 282 NAD C4D H4D sing N N 283 NAD O4D C1D sing N N 284 NAD C3D O3D sing N N 285 NAD C3D C2D sing N N 286 NAD C3D H3D sing N N 287 NAD O3D HO3N sing N N 288 NAD C2D O2D sing N N 289 NAD C2D C1D sing N N 290 NAD C2D H2D sing N N 291 NAD O2D HO2N sing N N 292 NAD C1D N1N sing N N 293 NAD C1D H1D sing N N 294 NAD N1N C2N sing Y N 295 NAD N1N C6N doub Y N 296 NAD C2N C3N doub Y N 297 NAD C2N H2N sing N N 298 NAD C3N C7N sing N N 299 NAD C3N C4N sing Y N 300 NAD C7N O7N doub N N 301 NAD C7N N7N sing N N 302 NAD N7N H71N sing N N 303 NAD N7N H72N sing N N 304 NAD C4N C5N doub Y N 305 NAD C4N H4N sing N N 306 NAD C5N C6N sing Y N 307 NAD C5N H5N sing N N 308 NAD C6N H6N sing N N 309 PHE N CA sing N N 310 PHE N H sing N N 311 PHE N H2 sing N N 312 PHE CA C sing N N 313 PHE CA CB sing N N 314 PHE CA HA sing N N 315 PHE C O doub N N 316 PHE C OXT sing N N 317 PHE CB CG sing N N 318 PHE CB HB2 sing N N 319 PHE CB HB3 sing N N 320 PHE CG CD1 doub Y N 321 PHE CG CD2 sing Y N 322 PHE CD1 CE1 sing Y N 323 PHE CD1 HD1 sing N N 324 PHE CD2 CE2 doub Y N 325 PHE CD2 HD2 sing N N 326 PHE CE1 CZ doub Y N 327 PHE CE1 HE1 sing N N 328 PHE CE2 CZ sing Y N 329 PHE CE2 HE2 sing N N 330 PHE CZ HZ sing N N 331 PHE OXT HXT sing N N 332 PRO N CA sing N N 333 PRO N CD sing N N 334 PRO N H sing N N 335 PRO CA C sing N N 336 PRO CA CB sing N N 337 PRO CA HA sing N N 338 PRO C O doub N N 339 PRO C OXT sing N N 340 PRO CB CG sing N N 341 PRO CB HB2 sing N N 342 PRO CB HB3 sing N N 343 PRO CG CD sing N N 344 PRO CG HG2 sing N N 345 PRO CG HG3 sing N N 346 PRO CD HD2 sing N N 347 PRO CD HD3 sing N N 348 PRO OXT HXT sing N N 349 SER N CA sing N N 350 SER N H sing N N 351 SER N H2 sing N N 352 SER CA C sing N N 353 SER CA CB sing N N 354 SER CA HA sing N N 355 SER C O doub N N 356 SER C OXT sing N N 357 SER CB OG sing N N 358 SER CB HB2 sing N N 359 SER CB HB3 sing N N 360 SER OG HG sing N N 361 SER OXT HXT sing N N 362 THR N CA sing N N 363 THR N H sing N N 364 THR N H2 sing N N 365 THR CA C sing N N 366 THR CA CB sing N N 367 THR CA HA sing N N 368 THR C O doub N N 369 THR C OXT sing N N 370 THR CB OG1 sing N N 371 THR CB CG2 sing N N 372 THR CB HB sing N N 373 THR OG1 HG1 sing N N 374 THR CG2 HG21 sing N N 375 THR CG2 HG22 sing N N 376 THR CG2 HG23 sing N N 377 THR OXT HXT sing N N 378 TRP N CA sing N N 379 TRP N H sing N N 380 TRP N H2 sing N N 381 TRP CA C sing N N 382 TRP CA CB sing N N 383 TRP CA HA sing N N 384 TRP C O doub N N 385 TRP C OXT sing N N 386 TRP CB CG sing N N 387 TRP CB HB2 sing N N 388 TRP CB HB3 sing N N 389 TRP CG CD1 doub Y N 390 TRP CG CD2 sing Y N 391 TRP CD1 NE1 sing Y N 392 TRP CD1 HD1 sing N N 393 TRP CD2 CE2 doub Y N 394 TRP CD2 CE3 sing Y N 395 TRP NE1 CE2 sing Y N 396 TRP NE1 HE1 sing N N 397 TRP CE2 CZ2 sing Y N 398 TRP CE3 CZ3 doub Y N 399 TRP CE3 HE3 sing N N 400 TRP CZ2 CH2 doub Y N 401 TRP CZ2 HZ2 sing N N 402 TRP CZ3 CH2 sing Y N 403 TRP CZ3 HZ3 sing N N 404 TRP CH2 HH2 sing N N 405 TRP OXT HXT sing N N 406 TYR N CA sing N N 407 TYR N H sing N N 408 TYR N H2 sing N N 409 TYR CA C sing N N 410 TYR CA CB sing N N 411 TYR CA HA sing N N 412 TYR C O doub N N 413 TYR C OXT sing N N 414 TYR CB CG sing N N 415 TYR CB HB2 sing N N 416 TYR CB HB3 sing N N 417 TYR CG CD1 doub Y N 418 TYR CG CD2 sing Y N 419 TYR CD1 CE1 sing Y N 420 TYR CD1 HD1 sing N N 421 TYR CD2 CE2 doub Y N 422 TYR CD2 HD2 sing N N 423 TYR CE1 CZ doub Y N 424 TYR CE1 HE1 sing N N 425 TYR CE2 CZ sing Y N 426 TYR CE2 HE2 sing N N 427 TYR CZ OH sing N N 428 TYR OH HH sing N N 429 TYR OXT HXT sing N N 430 VAL N CA sing N N 431 VAL N H sing N N 432 VAL N H2 sing N N 433 VAL CA C sing N N 434 VAL CA CB sing N N 435 VAL CA HA sing N N 436 VAL C O doub N N 437 VAL C OXT sing N N 438 VAL CB CG1 sing N N 439 VAL CB CG2 sing N N 440 VAL CB HB sing N N 441 VAL CG1 HG11 sing N N 442 VAL CG1 HG12 sing N N 443 VAL CG1 HG13 sing N N 444 VAL CG2 HG21 sing N N 445 VAL CG2 HG22 sing N N 446 VAL CG2 HG23 sing N N 447 VAL OXT HXT sing N N 448 # _pdbx_audit_support.funding_organization 'National Science Foundation (China)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31822012 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NAD _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NAD _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _space_group.name_H-M_alt 'P 62 2 2' _space_group.name_Hall 'P 62 2 (x,y,z+1/3)' _space_group.IT_number 180 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 6KYF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009553 _atom_sites.fract_transf_matrix[1][2] 0.005516 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011031 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008356 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_