data_6KYG # _entry.id 6KYG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.368 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6KYG pdb_00006kyg 10.2210/pdb6kyg/pdb WWPDB D_1300013825 ? ? # loop_ _pdbx_database_PDB_obs_spr.id _pdbx_database_PDB_obs_spr.date _pdbx_database_PDB_obs_spr.pdb_id _pdbx_database_PDB_obs_spr.replace_pdb_id _pdbx_database_PDB_obs_spr.details SPRSDE 2019-10-09 6KYG 6JMJ ? OBSLTE 2023-04-12 8I8P 6KYG ? # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6KYG _pdbx_database_status.recvd_initial_deposition_date 2019-09-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gupta, A.' 1 ? 'Viswanathan, V.' 2 ? 'Sharma, S.' 3 ? 'Singh, T.P.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Crystal structure of the complex of phospho pantetheine adenylyl transferase from Acinetobacter baumannii with ascorbic acid (Vitamin-C) at 2.19 A resolution. ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Viswanathan, V.' 1 ? primary 'Gupta, A.' 2 ? primary 'Sharma, S.' 3 ? primary 'Singh, T.P.' 4 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6KYG _cell.details ? _cell.formula_units_Z ? _cell.length_a 217.038 _cell.length_a_esd ? _cell.length_b 217.038 _cell.length_b_esd ? _cell.length_c 217.038 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6KYG _symmetry.cell_setting ? _symmetry.Int_Tables_number 210 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Phosphopantetheine adenylyltransferase' 18479.033 1 2.7.7.3 ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 non-polymer syn 'PHOSPHONOACETIC ACID' 140.032 1 ? ? ? ? 4 non-polymer nat 'MAGNESIUM ION' 24.305 1 ? ? ? ? 5 water nat water 18.015 69 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Dephospho-CoA pyrophosphorylase,Pantetheine-phosphate adenylyltransferase,PPAT' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSKTRVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKNPLFSLEERVALAQSSLGHLSNVEFVGFDGLLVNFFK EQKATAVLRGLRAVSDFEYEFQLANMNRQLDPHFEAVFLTPSEQYSFISSTLIREIARLKGDVTKFVPQAVVEAFERKHQ QGW ; _entity_poly.pdbx_seq_one_letter_code_can ;MSKTRVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKNPLFSLEERVALAQSSLGHLSNVEFVGFDGLLVNFFK EQKATAVLRGLRAVSDFEYEFQLANMNRQLDPHFEAVFLTPSEQYSFISSTLIREIARLKGDVTKFVPQAVVEAFERKHQ QGW ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LYS n 1 4 THR n 1 5 ARG n 1 6 VAL n 1 7 ILE n 1 8 TYR n 1 9 PRO n 1 10 GLY n 1 11 THR n 1 12 PHE n 1 13 ASP n 1 14 PRO n 1 15 ILE n 1 16 THR n 1 17 ASN n 1 18 GLY n 1 19 HIS n 1 20 VAL n 1 21 ASP n 1 22 LEU n 1 23 VAL n 1 24 THR n 1 25 ARG n 1 26 ALA n 1 27 SER n 1 28 ARG n 1 29 MET n 1 30 PHE n 1 31 ASP n 1 32 GLU n 1 33 VAL n 1 34 VAL n 1 35 VAL n 1 36 ALA n 1 37 ILE n 1 38 ALA n 1 39 ILE n 1 40 GLY n 1 41 HIS n 1 42 HIS n 1 43 LYS n 1 44 ASN n 1 45 PRO n 1 46 LEU n 1 47 PHE n 1 48 SER n 1 49 LEU n 1 50 GLU n 1 51 GLU n 1 52 ARG n 1 53 VAL n 1 54 ALA n 1 55 LEU n 1 56 ALA n 1 57 GLN n 1 58 SER n 1 59 SER n 1 60 LEU n 1 61 GLY n 1 62 HIS n 1 63 LEU n 1 64 SER n 1 65 ASN n 1 66 VAL n 1 67 GLU n 1 68 PHE n 1 69 VAL n 1 70 GLY n 1 71 PHE n 1 72 ASP n 1 73 GLY n 1 74 LEU n 1 75 LEU n 1 76 VAL n 1 77 ASN n 1 78 PHE n 1 79 PHE n 1 80 LYS n 1 81 GLU n 1 82 GLN n 1 83 LYS n 1 84 ALA n 1 85 THR n 1 86 ALA n 1 87 VAL n 1 88 LEU n 1 89 ARG n 1 90 GLY n 1 91 LEU n 1 92 ARG n 1 93 ALA n 1 94 VAL n 1 95 SER n 1 96 ASP n 1 97 PHE n 1 98 GLU n 1 99 TYR n 1 100 GLU n 1 101 PHE n 1 102 GLN n 1 103 LEU n 1 104 ALA n 1 105 ASN n 1 106 MET n 1 107 ASN n 1 108 ARG n 1 109 GLN n 1 110 LEU n 1 111 ASP n 1 112 PRO n 1 113 HIS n 1 114 PHE n 1 115 GLU n 1 116 ALA n 1 117 VAL n 1 118 PHE n 1 119 LEU n 1 120 THR n 1 121 PRO n 1 122 SER n 1 123 GLU n 1 124 GLN n 1 125 TYR n 1 126 SER n 1 127 PHE n 1 128 ILE n 1 129 SER n 1 130 SER n 1 131 THR n 1 132 LEU n 1 133 ILE n 1 134 ARG n 1 135 GLU n 1 136 ILE n 1 137 ALA n 1 138 ARG n 1 139 LEU n 1 140 LYS n 1 141 GLY n 1 142 ASP n 1 143 VAL n 1 144 THR n 1 145 LYS n 1 146 PHE n 1 147 VAL n 1 148 PRO n 1 149 GLN n 1 150 ALA n 1 151 VAL n 1 152 VAL n 1 153 GLU n 1 154 ALA n 1 155 PHE n 1 156 GLU n 1 157 ARG n 1 158 LYS n 1 159 HIS n 1 160 GLN n 1 161 GLN n 1 162 GLY n 1 163 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 163 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'coaD, HMPREF0010_01342' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 575584 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D0C9M9_ACIB2 _struct_ref.pdbx_db_accession D0C9M9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSKTRVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKNPLFSLEERVALAQSSLGHLSNVEFVGFDGLLVNFFK EQKATAVLRGLRAVSDFEYEFQLANMNRQLDPHFEAVFLTPSEQYSFISSTLIREIARLKGDVTKFVPQAVVEAFERKHQ QGW ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6KYG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 163 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession D0C9M9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 163 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 163 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PAE non-polymer . 'PHOSPHONOACETIC ACID' ? 'C2 H5 O5 P' 140.032 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6KYG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 78.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1M LITHIUM SULPHATE, 2M AMMONIUM SULPHATE, 0.1M SODIUM CITRATE, PH 5.6' _exptl_crystal_grow.pdbx_pH_range 5.6-6.4 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'PSI PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-12-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97199 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97199 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6KYG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.19 _reflns.d_resolution_low 125.3 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22090 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.48 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20 _reflns.pdbx_Rmerge_I_obs 0.109 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.19 _reflns_shell.d_res_low 2.25 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1672 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.168 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.631 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.000 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 0.000 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 0.000 _refine.B_iso_max ? _refine.B_iso_mean 62.928 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.967 _refine.correlation_coeff_Fo_to_Fc_free 0.953 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6KYG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.19 _refine.ls_d_res_low 125.3 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22090 _refine.ls_number_reflns_R_free 1044 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.582 _refine.ls_percent_reflns_R_free 4.726 _refine.ls_R_factor_all 0.197 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2307 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1949 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5ZZC _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.132 _refine.pdbx_overall_ESU_R_Free 0.134 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.677 _refine.overall_SU_ML 0.109 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.19 _refine_hist.d_res_low 125.3 _refine_hist.number_atoms_solvent 69 _refine_hist.number_atoms_total 1393 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1305 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 19 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.013 1350 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1241 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.047 1.638 1828 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.419 1.570 2865 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.105 5.000 162 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.357 21.688 77 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.429 15.000 224 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 22.089 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.085 0.200 169 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 1504 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 306 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.203 0.200 292 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.196 0.200 1122 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.177 0.200 667 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.090 0.200 635 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.194 0.200 45 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.210 0.200 11 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.199 0.200 67 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.206 0.200 4 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 6.330 6.168 651 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 6.223 6.168 650 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 8.406 9.251 812 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 8.444 9.255 813 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 8.521 7.213 699 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 8.507 7.213 698 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 11.842 10.436 1016 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 11.836 10.437 1017 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 13.256 74.255 1498 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 13.252 74.284 1499 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.190 2.247 1672 . 64 1006 63.9952 . 0.341 . 0.360 . 0.340 . . . . . 0.330 20 . 0.713 0.756 'X-RAY DIFFRACTION' 2.247 2.309 1639 . 57 1210 77.3032 . 0.331 . 0.459 . 0.325 . . . . . 0.302 20 . 0.762 0.747 'X-RAY DIFFRACTION' 2.309 2.376 1579 . 74 1460 97.1501 . 0.318 . 0.415 . 0.314 . . . . . 0.281 20 . 0.838 0.804 'X-RAY DIFFRACTION' 2.376 2.449 1540 . 66 1474 100.0000 . 0.302 . 0.337 . 0.301 . . . . . 0.265 20 . 0.872 0.870 'X-RAY DIFFRACTION' 2.449 2.529 1490 . 72 1418 100.0000 . 0.287 . 0.375 . 0.283 . . . . . 0.237 20 . 0.897 0.858 'X-RAY DIFFRACTION' 2.529 2.618 1446 . 51 1395 100.0000 . 0.262 . 0.286 . 0.261 . . . . . 0.213 20 . 0.913 0.917 'X-RAY DIFFRACTION' 2.618 2.717 1396 . 61 1335 100.0000 . 0.243 . 0.283 . 0.241 . . . . . 0.201 20 . 0.932 0.907 'X-RAY DIFFRACTION' 2.717 2.827 1353 . 80 1273 100.0000 . 0.216 . 0.207 . 0.217 . . . . . 0.183 20 . 0.940 0.941 'X-RAY DIFFRACTION' 2.827 2.953 1306 . 53 1253 100.0000 . 0.228 . 0.284 . 0.225 . . . . . 0.201 20 . 0.916 0.889 'X-RAY DIFFRACTION' 2.953 3.097 1245 . 52 1193 100.0000 . 0.249 . 0.351 . 0.245 . . . . . 0.221 20 . 0.900 0.835 'X-RAY DIFFRACTION' 3.097 3.264 1188 . 56 1132 100.0000 . 0.241 . 0.269 . 0.240 . . . . . 0.225 20 . 0.914 0.903 'X-RAY DIFFRACTION' 3.264 3.462 1128 . 48 1080 100.0000 . 0.223 . 0.292 . 0.220 . . . . . 0.215 20 . 0.944 0.908 'X-RAY DIFFRACTION' 3.462 3.701 1068 . 55 1013 100.0000 . 0.206 . 0.250 . 0.203 . . . . . 0.207 20 . 0.958 0.944 'X-RAY DIFFRACTION' 3.701 3.997 1002 . 58 944 100.0000 . 0.193 . 0.218 . 0.191 . . . . . 0.206 20 . 0.960 0.946 'X-RAY DIFFRACTION' 3.997 4.379 928 . 45 883 100.0000 . 0.157 . 0.178 . 0.156 . . . . . 0.180 20 . 0.973 0.971 'X-RAY DIFFRACTION' 4.379 4.895 850 . 43 807 100.0000 . 0.124 . 0.168 . 0.122 . . . . . 0.148 20 . 0.981 0.977 'X-RAY DIFFRACTION' 4.895 5.650 762 . 33 729 100.0000 . 0.154 . 0.148 . 0.154 . . . . . 0.188 20 . 0.977 0.980 'X-RAY DIFFRACTION' 5.650 6.917 650 . 32 618 100.0000 . 0.180 . 0.212 . 0.178 . . . . . 0.216 20 . 0.971 0.955 'X-RAY DIFFRACTION' 6.917 9.767 531 . 34 496 99.8117 . 0.145 . 0.182 . 0.143 . . . . . 0.197 20 . 0.982 0.974 'X-RAY DIFFRACTION' 9.767 125.307 338 . 10 327 99.7041 . 0.222 . 0.312 . 0.219 . . . . . 0.386 20 . 0.946 0.905 # _struct.entry_id 6KYG _struct.title ;Crystal structure of the complex of phosphopantetheine adenylyltransferase from Acinetobacter baumannii with Phosphonoacetate at 2.19 A resolution. ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6KYG _struct_keywords.text 'CoA biosynthesis, Ligand, inhibitor, Coenzyme A, BIOSYNTHETIC PROTEIN, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 16 ? ARG A 28 ? THR A 16 ARG A 28 1 ? 13 HELX_P HELX_P2 AA2 SER A 48 ? GLY A 61 ? SER A 48 GLY A 61 1 ? 14 HELX_P HELX_P3 AA3 LEU A 74 ? GLN A 82 ? LEU A 74 GLN A 82 1 ? 9 HELX_P HELX_P4 AA4 ALA A 93 ? ASP A 111 ? ALA A 93 ASP A 111 1 ? 19 HELX_P HELX_P5 AA5 SER A 129 ? LEU A 139 ? SER A 129 LEU A 139 1 ? 11 HELX_P HELX_P6 AA6 PRO A 148 ? GLY A 162 ? PRO A 148 GLY A 162 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id C _struct_conn.ptnr1_label_comp_id SO4 _struct_conn.ptnr1_label_seq_id . _struct_conn.ptnr1_label_atom_id O2 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id E _struct_conn.ptnr2_label_comp_id MG _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id MG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SO4 _struct_conn.ptnr1_auth_seq_id 202 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id MG _struct_conn.ptnr2_auth_seq_id 204 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.740 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 13 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 13 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 14 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 14 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.59 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 66 ? PHE A 71 ? VAL A 66 PHE A 71 AA1 2 GLU A 32 ? ALA A 38 ? GLU A 32 ALA A 38 AA1 3 ARG A 5 ? GLY A 10 ? ARG A 5 GLY A 10 AA1 4 ALA A 86 ? GLY A 90 ? ALA A 86 GLY A 90 AA1 5 ALA A 116 ? LEU A 119 ? ALA A 116 LEU A 119 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 67 ? O GLU A 67 N VAL A 35 ? N VAL A 35 AA1 2 3 O VAL A 34 ? O VAL A 34 N TYR A 8 ? N TYR A 8 AA1 3 4 N ILE A 7 ? N ILE A 7 O LEU A 88 ? O LEU A 88 AA1 4 5 N VAL A 87 ? N VAL A 87 O VAL A 117 ? O VAL A 117 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 201 ? 3 'binding site for residue SO4 A 201' AC2 Software A SO4 202 ? 8 'binding site for residue SO4 A 202' AC3 Software A PAE 203 ? 10 'binding site for residue PAE A 203' AC4 Software A MG 204 ? 5 'binding site for residue MG A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ARG A 134 ? ARG A 134 . ? 1_555 ? 2 AC1 3 HOH F . ? HOH A 301 . ? 1_555 ? 3 AC1 3 HOH F . ? HOH A 334 . ? 1_555 ? 4 AC2 8 THR A 11 ? THR A 11 . ? 1_555 ? 5 AC2 8 SER A 130 ? SER A 130 . ? 1_555 ? 6 AC2 8 THR A 131 ? THR A 131 . ? 1_555 ? 7 AC2 8 ARG A 134 ? ARG A 134 . ? 1_555 ? 8 AC2 8 PAE D . ? PAE A 203 . ? 1_555 ? 9 AC2 8 MG E . ? MG A 204 . ? 1_555 ? 10 AC2 8 HOH F . ? HOH A 303 . ? 1_555 ? 11 AC2 8 HOH F . ? HOH A 320 . ? 1_555 ? 12 AC3 10 GLY A 10 ? GLY A 10 . ? 1_555 ? 13 AC3 10 THR A 11 ? THR A 11 . ? 1_555 ? 14 AC3 10 PHE A 12 ? PHE A 12 . ? 1_555 ? 15 AC3 10 HIS A 19 ? HIS A 19 . ? 1_555 ? 16 AC3 10 SER A 129 ? SER A 129 . ? 1_555 ? 17 AC3 10 SER A 130 ? SER A 130 . ? 1_555 ? 18 AC3 10 SO4 C . ? SO4 A 202 . ? 1_555 ? 19 AC3 10 MG E . ? MG A 204 . ? 1_555 ? 20 AC3 10 HOH F . ? HOH A 302 . ? 1_555 ? 21 AC3 10 HOH F . ? HOH A 321 . ? 1_555 ? 22 AC4 5 SER A 130 ? SER A 130 . ? 1_555 ? 23 AC4 5 THR A 131 ? THR A 131 . ? 1_555 ? 24 AC4 5 SO4 C . ? SO4 A 202 . ? 1_555 ? 25 AC4 5 PAE D . ? PAE A 203 . ? 1_555 ? 26 AC4 5 HOH F . ? HOH A 356 . ? 1_555 ? # _atom_sites.entry_id 6KYG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.004607 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.004607 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004607 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 MG 12 12 5.427 2.828 2.176 79.261 1.228 0.381 2.310 7.194 0.859 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 P 15 15 6.435 1.907 4.179 27.157 1.780 0.526 1.491 68.164 1.115 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 0.867 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 GLN 124 124 124 GLN GLN A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 GLN 161 161 161 GLN GLN A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 TRP 163 163 163 TRP TRP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 202 SO4 SO4 A . C 2 SO4 1 202 203 SO4 SO4 A . D 3 PAE 1 203 401 PAE PAE A . E 4 MG 1 204 1 MG MG A . F 5 HOH 1 301 301 HOH HOH A . F 5 HOH 2 302 501 HOH HOH A . F 5 HOH 3 303 303 HOH HOH A . F 5 HOH 4 304 328 HOH HOH A . F 5 HOH 5 305 315 HOH HOH A . F 5 HOH 6 306 304 HOH HOH A . F 5 HOH 7 307 311 HOH HOH A . F 5 HOH 8 308 306 HOH HOH A . F 5 HOH 9 309 317 HOH HOH A . F 5 HOH 10 310 307 HOH HOH A . F 5 HOH 11 311 309 HOH HOH A . F 5 HOH 12 312 308 HOH HOH A . F 5 HOH 13 313 312 HOH HOH A . F 5 HOH 14 314 310 HOH HOH A . F 5 HOH 15 315 329 HOH HOH A . F 5 HOH 16 316 314 HOH HOH A . F 5 HOH 17 317 316 HOH HOH A . F 5 HOH 18 318 313 HOH HOH A . F 5 HOH 19 319 320 HOH HOH A . F 5 HOH 20 320 324 HOH HOH A . F 5 HOH 21 321 305 HOH HOH A . F 5 HOH 22 322 326 HOH HOH A . F 5 HOH 23 323 323 HOH HOH A . F 5 HOH 24 324 341 HOH HOH A . F 5 HOH 25 325 318 HOH HOH A . F 5 HOH 26 326 322 HOH HOH A . F 5 HOH 27 327 339 HOH HOH A . F 5 HOH 28 328 330 HOH HOH A . F 5 HOH 29 329 331 HOH HOH A . F 5 HOH 30 330 356 HOH HOH A . F 5 HOH 31 331 321 HOH HOH A . F 5 HOH 32 332 332 HOH HOH A . F 5 HOH 33 333 327 HOH HOH A . F 5 HOH 34 334 319 HOH HOH A . F 5 HOH 35 335 344 HOH HOH A . F 5 HOH 36 336 342 HOH HOH A . F 5 HOH 37 337 333 HOH HOH A . F 5 HOH 38 338 338 HOH HOH A . F 5 HOH 39 339 346 HOH HOH A . F 5 HOH 40 340 336 HOH HOH A . F 5 HOH 41 341 325 HOH HOH A . F 5 HOH 42 342 340 HOH HOH A . F 5 HOH 43 343 350 HOH HOH A . F 5 HOH 44 344 334 HOH HOH A . F 5 HOH 45 345 343 HOH HOH A . F 5 HOH 46 346 347 HOH HOH A . F 5 HOH 47 347 337 HOH HOH A . F 5 HOH 48 348 345 HOH HOH A . F 5 HOH 49 349 355 HOH HOH A . F 5 HOH 50 350 335 HOH HOH A . F 5 HOH 51 351 353 HOH HOH A . F 5 HOH 52 352 349 HOH HOH A . F 5 HOH 53 353 354 HOH HOH A . F 5 HOH 54 354 348 HOH HOH A . F 5 HOH 55 355 351 HOH HOH A . F 5 HOH 56 356 359 HOH HOH A . F 5 HOH 57 357 352 HOH HOH A . F 5 HOH 58 358 357 HOH HOH A . F 5 HOH 59 359 361 HOH HOH A . F 5 HOH 60 360 358 HOH HOH A . F 5 HOH 61 361 360 HOH HOH A . F 5 HOH 62 362 364 HOH HOH A . F 5 HOH 63 363 366 HOH HOH A . F 5 HOH 64 364 365 HOH HOH A . F 5 HOH 65 365 362 HOH HOH A . F 5 HOH 66 366 363 HOH HOH A . F 5 HOH 67 367 368 HOH HOH A . F 5 HOH 68 368 367 HOH HOH A . F 5 HOH 69 369 369 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 830 ? 1 MORE -42 ? 1 'SSA (A^2)' 9290 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 323 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-10-09 2 'Structure model' 1 1 2023-04-12 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Obsolete ? ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_type 2 2 'Structure model' database_2 3 2 'Structure model' pdbx_database_PDB_obs_spr 4 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_type.pdbx_N_electrons' 2 2 'Structure model' '_atom_type.pdbx_scat_Z' 3 2 'Structure model' '_database_2.pdbx_DOI' 4 2 'Structure model' '_database_2.pdbx_database_accession' 5 2 'Structure model' '_pdbx_database_status.status_code' 6 2 'Structure model' '_pdbx_database_status.status_code_sf' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0253 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_entry_details.entry_id 6KYG _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 361 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 368 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 41 ? ? -84.48 -73.69 2 1 HIS A 42 ? ? -84.62 45.63 3 1 LYS A 43 ? ? -147.14 -47.39 4 1 ASN A 44 ? ? 88.90 51.51 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 MG ? ? MG ? ? 'SUBJECT OF INVESTIGATION' ? 2 PAE ? ? PAE ? ? 'SUBJECT OF INVESTIGATION' ? 3 SO4 ? ? SO4 ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'PHOSPHONOACETIC ACID' PAE 4 'MAGNESIUM ION' MG 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #