data_6L5K # _entry.id 6L5K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.331 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6L5K WWPDB D_1300014176 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6L5K _pdbx_database_status.recvd_initial_deposition_date 2019-10-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ryu, K.S.' 1 0000-0002-8422-6669 'Suh, J.Y.' 2 0000-0001-8720-3844 'Cha, S.Y.' 3 0000-0002-4692-8117 'Kim, Y.I.' 4 0000-0002-3926-5909 'Park, C.K.' 5 0000-0003-2866-7467 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 432 _citation.language ? _citation.page_first 4010 _citation.page_last 4022 _citation.title 'Determinants of PB1 Domain Interactions in Auxin Response Factor ARF5 and Repressor IAA17.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2020.04.007 _citation.pdbx_database_id_PubMed 32305460 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, Y.' 1 ? primary 'Park, C.' 2 ? primary 'Cha, S.' 3 ? primary 'Han, M.' 4 ? primary 'Ryu, K.S.' 5 ? primary 'Suh, J.Y.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6L5K _cell.details ? _cell.formula_units_Z ? _cell.length_a 79.894 _cell.length_a_esd ? _cell.length_b 79.894 _cell.length_b_esd ? _cell.length_c 116.025 _cell.length_c_esd ? _cell.volume 740593.520 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6L5K _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Auxin response factor 5' 10971.138 1 ? A788G,K797D,C825S,C866S,C869S,D183N,D187N,C203A ? ? 2 polymer man 'Auxin-responsive protein IAA17' 12769.635 1 ? ? ? ? 3 water nat water 18.015 15 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Auxin-responsive protein IAA24,Transcription factor MONOPTEROS' 2 'Auxin response 3,Indoleacetic acid-induced protein 17' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GTPRVRTYTDVQKTGSVGRSIDVTSFKDYEELKSAIESMFGLEGLLTHPQSSGWKLVYVDYESDVLLVGDDPWEEFVGSV RSIRILSPTEVQQMSEEG ; ;GTPRVRTYTDVQKTGSVGRSIDVTSFKDYEELKSAIESMFGLEGLLTHPQSSGWKLVYVDYESDVLLVGDDPWEEFVGSV RSIRILSPTEVQQMSEEG ; A ? 2 'polypeptide(L)' no no ;GGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYENK DGNWMLVGDVPWPMFVDTAKRLRLMKGSDAIGL ; ;GGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYENK DGNWMLVGDVPWPMFVDTAKRLRLMKGSDAIGL ; B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 PRO n 1 4 ARG n 1 5 VAL n 1 6 ARG n 1 7 THR n 1 8 TYR n 1 9 THR n 1 10 ASP n 1 11 VAL n 1 12 GLN n 1 13 LYS n 1 14 THR n 1 15 GLY n 1 16 SER n 1 17 VAL n 1 18 GLY n 1 19 ARG n 1 20 SER n 1 21 ILE n 1 22 ASP n 1 23 VAL n 1 24 THR n 1 25 SER n 1 26 PHE n 1 27 LYS n 1 28 ASP n 1 29 TYR n 1 30 GLU n 1 31 GLU n 1 32 LEU n 1 33 LYS n 1 34 SER n 1 35 ALA n 1 36 ILE n 1 37 GLU n 1 38 SER n 1 39 MET n 1 40 PHE n 1 41 GLY n 1 42 LEU n 1 43 GLU n 1 44 GLY n 1 45 LEU n 1 46 LEU n 1 47 THR n 1 48 HIS n 1 49 PRO n 1 50 GLN n 1 51 SER n 1 52 SER n 1 53 GLY n 1 54 TRP n 1 55 LYS n 1 56 LEU n 1 57 VAL n 1 58 TYR n 1 59 VAL n 1 60 ASP n 1 61 TYR n 1 62 GLU n 1 63 SER n 1 64 ASP n 1 65 VAL n 1 66 LEU n 1 67 LEU n 1 68 VAL n 1 69 GLY n 1 70 ASP n 1 71 ASP n 1 72 PRO n 1 73 TRP n 1 74 GLU n 1 75 GLU n 1 76 PHE n 1 77 VAL n 1 78 GLY n 1 79 SER n 1 80 VAL n 1 81 ARG n 1 82 SER n 1 83 ILE n 1 84 ARG n 1 85 ILE n 1 86 LEU n 1 87 SER n 1 88 PRO n 1 89 THR n 1 90 GLU n 1 91 VAL n 1 92 GLN n 1 93 GLN n 1 94 MET n 1 95 SER n 1 96 GLU n 1 97 GLU n 1 98 GLY n 2 1 GLY n 2 2 GLY n 2 3 PRO n 2 4 GLU n 2 5 ALA n 2 6 ALA n 2 7 ALA n 2 8 PHE n 2 9 VAL n 2 10 LYS n 2 11 VAL n 2 12 SER n 2 13 MET n 2 14 ASP n 2 15 GLY n 2 16 ALA n 2 17 PRO n 2 18 TYR n 2 19 LEU n 2 20 ARG n 2 21 LYS n 2 22 ILE n 2 23 ASP n 2 24 LEU n 2 25 ARG n 2 26 MET n 2 27 TYR n 2 28 LYS n 2 29 SER n 2 30 TYR n 2 31 ASP n 2 32 GLU n 2 33 LEU n 2 34 SER n 2 35 ASN n 2 36 ALA n 2 37 LEU n 2 38 SER n 2 39 ASN n 2 40 MET n 2 41 PHE n 2 42 SER n 2 43 SER n 2 44 PHE n 2 45 THR n 2 46 MET n 2 47 GLY n 2 48 LYS n 2 49 HIS n 2 50 GLY n 2 51 GLY n 2 52 GLU n 2 53 GLU n 2 54 GLY n 2 55 MET n 2 56 ILE n 2 57 ASP n 2 58 PHE n 2 59 MET n 2 60 ASN n 2 61 GLU n 2 62 ARG n 2 63 LYS n 2 64 LEU n 2 65 MET n 2 66 ASP n 2 67 LEU n 2 68 VAL n 2 69 ASN n 2 70 SER n 2 71 TRP n 2 72 ASP n 2 73 TYR n 2 74 VAL n 2 75 PRO n 2 76 SER n 2 77 TYR n 2 78 GLU n 2 79 ASN n 2 80 LYS n 2 81 ASP n 2 82 GLY n 2 83 ASN n 2 84 TRP n 2 85 MET n 2 86 LEU n 2 87 VAL n 2 88 GLY n 2 89 ASP n 2 90 VAL n 2 91 PRO n 2 92 TRP n 2 93 PRO n 2 94 MET n 2 95 PHE n 2 96 VAL n 2 97 ASP n 2 98 THR n 2 99 ALA n 2 100 LYS n 2 101 ARG n 2 102 LEU n 2 103 ARG n 2 104 LEU n 2 105 MET n 2 106 LYS n 2 107 GLY n 2 108 SER n 2 109 ASP n 2 110 ALA n 2 111 ILE n 2 112 GLY n 2 113 LEU n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 98 'Mouse-ear cress' ? 'ARF5, IAA24, MP, At1g19850, F6F9.10' ? ? ? ? ? ? 'Arabidopsis thaliana' 3702 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 113 'Mouse-ear cress' ? 'IAA17, AXR3, At1g04250, F19P19.31' ? ? ? ? ? ? 'Arabidopsis thaliana' 3702 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP ARFE_ARATH P93024 ? 1 ;ATPRVRTYTKVQKTGSVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVDYESDVLLVGDDPWEEFVGCV RCIRILSPTEVQQMSEEG ; 788 2 UNP IAA17_ARATH P93830 ? 2 ;GGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDK DGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGL ; 105 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6L5K A 1 ? 98 ? P93024 788 ? 885 ? 788 885 2 2 6L5K B 1 ? 113 ? P93830 105 ? 217 ? 105 217 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6L5K GLY A 1 ? UNP P93024 ALA 788 'engineered mutation' 788 1 1 6L5K ASP A 10 ? UNP P93024 LYS 797 'engineered mutation' 797 2 1 6L5K SER A 38 ? UNP P93024 CYS 825 'engineered mutation' 825 3 1 6L5K SER A 79 ? UNP P93024 CYS 866 'engineered mutation' 866 4 1 6L5K SER A 82 ? UNP P93024 CYS 869 'engineered mutation' 869 5 2 6L5K ASN B 79 ? UNP P93830 ASP 183 'engineered mutation' 183 6 2 6L5K ASN B 83 ? UNP P93830 ASP 187 'engineered mutation' 187 7 2 6L5K ALA B 99 ? UNP P93830 CYS 203 'engineered mutation' 203 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6L5K _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.90 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 68.46 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'LIQUID DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-12-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97960 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97960 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate 66.36 _reflns.entry_id 6L5K _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.9 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8612 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.99 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 43.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.989 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.90 _reflns_shell.d_res_low 3.01 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 8594 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.0 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.438 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 81.02 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6L5K _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.91 _refine.ls_d_res_low 35.73 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8596 _refine.ls_number_reflns_R_free 860 _refine.ls_number_reflns_R_work 7736 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.07 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2302 _refine.ls_R_factor_R_free 0.2698 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2257 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.53 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4chk,2muk _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.2326 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5638 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.91 _refine_hist.d_res_low 35.73 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 1396 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1381 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0106 ? 1412 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.1579 ? 1908 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0596 ? 206 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0061 ? 240 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 7.4430 ? 839 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.91 3.09 . . 136 1225 95.58 . . . 0.4134 . 0.3752 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.09 3.33 . . 140 1256 97.42 . . . 0.3372 . 0.3198 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.33 3.66 . . 140 1265 98.80 . . . 0.3231 . 0.2565 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.66 4.19 . . 142 1276 98.34 . . . 0.2654 . 0.1974 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.19 5.28 . . 145 1305 98.77 . . . 0.2136 . 0.1717 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.28 35.73 . . 157 1409 99.43 . . . 0.2401 . 0.2061 . . . . . . . . . . . # _struct.entry_id 6L5K _struct.title 'ARF5 Aux/IAA17 Complex' _struct.pdbx_descriptor 'Auxin response factor 5, Auxin-responsive protein IAA17' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6L5K _struct_keywords.text 'auxin, auxin response factor, AUX/IAA, Complex, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 22 ? PHE A 26 ? ASP A 809 PHE A 813 5 ? 5 HELX_P HELX_P2 AA2 ASP A 28 ? PHE A 40 ? ASP A 815 PHE A 827 1 ? 13 HELX_P HELX_P3 AA3 PRO A 72 ? SER A 79 ? PRO A 859 SER A 866 1 ? 8 HELX_P HELX_P4 AA4 THR A 89 ? SER A 95 ? THR A 876 SER A 882 1 ? 7 HELX_P HELX_P5 AA5 ARG B 25 ? TYR B 27 ? ARG B 129 TYR B 131 5 ? 3 HELX_P HELX_P6 AA6 SER B 29 ? PHE B 41 ? SER B 133 PHE B 145 1 ? 13 HELX_P HELX_P7 AA7 PHE B 41 ? MET B 46 ? PHE B 145 MET B 150 1 ? 6 HELX_P HELX_P8 AA8 PRO B 91 ? ALA B 99 ? PRO B 195 ALA B 203 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 19 ? ILE A 21 ? ARG A 806 ILE A 808 AA1 2 THR A 9 ? LYS A 13 ? THR A 796 LYS A 800 AA1 3 VAL A 80 ? LEU A 86 ? VAL A 867 LEU A 873 AA1 4 LYS A 55 ? ASP A 60 ? LYS A 842 ASP A 847 AA1 5 VAL A 65 ? LEU A 67 ? VAL A 852 LEU A 854 AA2 1 ARG B 20 ? ASP B 23 ? ARG B 124 ASP B 127 AA2 2 PHE B 8 ? MET B 13 ? PHE B 112 MET B 117 AA2 3 LEU B 102 ? LYS B 106 ? LEU B 206 LYS B 210 AA2 4 TYR B 73 ? GLU B 78 ? TYR B 177 GLU B 182 AA2 5 TRP B 84 ? LEU B 86 ? TRP B 188 LEU B 190 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ARG A 19 ? O ARG A 806 N VAL A 11 ? N VAL A 798 AA1 2 3 N ASP A 10 ? N ASP A 797 O ILE A 83 ? O ILE A 870 AA1 3 4 O SER A 82 ? O SER A 869 N VAL A 59 ? N VAL A 846 AA1 4 5 N TYR A 58 ? N TYR A 845 O LEU A 66 ? O LEU A 853 AA2 1 2 O ARG B 20 ? O ARG B 124 N VAL B 11 ? N VAL B 115 AA2 2 3 N LYS B 10 ? N LYS B 114 O LEU B 102 ? O LEU B 206 AA2 3 4 O ARG B 103 ? O ARG B 207 N SER B 76 ? N SER B 180 AA2 4 5 N TYR B 77 ? N TYR B 181 O MET B 85 ? O MET B 189 # _atom_sites.entry_id 6L5K _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012517 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012517 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008619 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 788 ? ? ? A . n A 1 2 THR 2 789 ? ? ? A . n A 1 3 PRO 3 790 ? ? ? A . n A 1 4 ARG 4 791 ? ? ? A . n A 1 5 VAL 5 792 792 VAL VAL A . n A 1 6 ARG 6 793 793 ARG ARG A . n A 1 7 THR 7 794 794 THR THR A . n A 1 8 TYR 8 795 795 TYR TYR A . n A 1 9 THR 9 796 796 THR THR A . n A 1 10 ASP 10 797 797 ASP ASP A . n A 1 11 VAL 11 798 798 VAL VAL A . n A 1 12 GLN 12 799 799 GLN GLN A . n A 1 13 LYS 13 800 800 LYS LYS A . n A 1 14 THR 14 801 801 THR THR A . n A 1 15 GLY 15 802 802 GLY GLY A . n A 1 16 SER 16 803 803 SER SER A . n A 1 17 VAL 17 804 804 VAL VAL A . n A 1 18 GLY 18 805 805 GLY GLY A . n A 1 19 ARG 19 806 806 ARG ARG A . n A 1 20 SER 20 807 807 SER SER A . n A 1 21 ILE 21 808 808 ILE ILE A . n A 1 22 ASP 22 809 809 ASP ASP A . n A 1 23 VAL 23 810 810 VAL VAL A . n A 1 24 THR 24 811 811 THR THR A . n A 1 25 SER 25 812 812 SER SER A . n A 1 26 PHE 26 813 813 PHE PHE A . n A 1 27 LYS 27 814 814 LYS LYS A . n A 1 28 ASP 28 815 815 ASP ASP A . n A 1 29 TYR 29 816 816 TYR TYR A . n A 1 30 GLU 30 817 817 GLU GLU A . n A 1 31 GLU 31 818 818 GLU GLU A . n A 1 32 LEU 32 819 819 LEU LEU A . n A 1 33 LYS 33 820 820 LYS LYS A . n A 1 34 SER 34 821 821 SER SER A . n A 1 35 ALA 35 822 822 ALA ALA A . n A 1 36 ILE 36 823 823 ILE ILE A . n A 1 37 GLU 37 824 824 GLU GLU A . n A 1 38 SER 38 825 825 SER SER A . n A 1 39 MET 39 826 826 MET MET A . n A 1 40 PHE 40 827 827 PHE PHE A . n A 1 41 GLY 41 828 828 GLY GLY A . n A 1 42 LEU 42 829 829 LEU LEU A . n A 1 43 GLU 43 830 830 GLU GLU A . n A 1 44 GLY 44 831 831 GLY GLY A . n A 1 45 LEU 45 832 832 LEU LEU A . n A 1 46 LEU 46 833 833 LEU LEU A . n A 1 47 THR 47 834 834 THR THR A . n A 1 48 HIS 48 835 835 HIS HIS A . n A 1 49 PRO 49 836 836 PRO PRO A . n A 1 50 GLN 50 837 837 GLN GLN A . n A 1 51 SER 51 838 838 SER SER A . n A 1 52 SER 52 839 839 SER SER A . n A 1 53 GLY 53 840 840 GLY GLY A . n A 1 54 TRP 54 841 841 TRP TRP A . n A 1 55 LYS 55 842 842 LYS LYS A . n A 1 56 LEU 56 843 843 LEU LEU A . n A 1 57 VAL 57 844 844 VAL VAL A . n A 1 58 TYR 58 845 845 TYR TYR A . n A 1 59 VAL 59 846 846 VAL VAL A . n A 1 60 ASP 60 847 847 ASP ASP A . n A 1 61 TYR 61 848 848 TYR TYR A . n A 1 62 GLU 62 849 849 GLU GLU A . n A 1 63 SER 63 850 850 SER SER A . n A 1 64 ASP 64 851 851 ASP ASP A . n A 1 65 VAL 65 852 852 VAL VAL A . n A 1 66 LEU 66 853 853 LEU LEU A . n A 1 67 LEU 67 854 854 LEU LEU A . n A 1 68 VAL 68 855 855 VAL VAL A . n A 1 69 GLY 69 856 856 GLY GLY A . n A 1 70 ASP 70 857 857 ASP ASP A . n A 1 71 ASP 71 858 858 ASP ASP A . n A 1 72 PRO 72 859 859 PRO PRO A . n A 1 73 TRP 73 860 860 TRP TRP A . n A 1 74 GLU 74 861 861 GLU GLU A . n A 1 75 GLU 75 862 862 GLU GLU A . n A 1 76 PHE 76 863 863 PHE PHE A . n A 1 77 VAL 77 864 864 VAL VAL A . n A 1 78 GLY 78 865 865 GLY GLY A . n A 1 79 SER 79 866 866 SER SER A . n A 1 80 VAL 80 867 867 VAL VAL A . n A 1 81 ARG 81 868 868 ARG ARG A . n A 1 82 SER 82 869 869 SER SER A . n A 1 83 ILE 83 870 870 ILE ILE A . n A 1 84 ARG 84 871 871 ARG ARG A . n A 1 85 ILE 85 872 872 ILE ILE A . n A 1 86 LEU 86 873 873 LEU LEU A . n A 1 87 SER 87 874 874 SER SER A . n A 1 88 PRO 88 875 875 PRO PRO A . n A 1 89 THR 89 876 876 THR THR A . n A 1 90 GLU 90 877 877 GLU GLU A . n A 1 91 VAL 91 878 878 VAL VAL A . n A 1 92 GLN 92 879 879 GLN GLN A . n A 1 93 GLN 93 880 880 GLN GLN A . n A 1 94 MET 94 881 881 MET MET A . n A 1 95 SER 95 882 882 SER SER A . n A 1 96 GLU 96 883 883 GLU GLU A . n A 1 97 GLU 97 884 ? ? ? A . n A 1 98 GLY 98 885 ? ? ? A . n B 2 1 GLY 1 105 ? ? ? B . n B 2 2 GLY 2 106 ? ? ? B . n B 2 3 PRO 3 107 ? ? ? B . n B 2 4 GLU 4 108 ? ? ? B . n B 2 5 ALA 5 109 109 ALA ALA B . n B 2 6 ALA 6 110 110 ALA ALA B . n B 2 7 ALA 7 111 111 ALA ALA B . n B 2 8 PHE 8 112 112 PHE PHE B . n B 2 9 VAL 9 113 113 VAL VAL B . n B 2 10 LYS 10 114 114 LYS LYS B . n B 2 11 VAL 11 115 115 VAL VAL B . n B 2 12 SER 12 116 116 SER SER B . n B 2 13 MET 13 117 117 MET MET B . n B 2 14 ASP 14 118 118 ASP ASP B . n B 2 15 GLY 15 119 119 GLY GLY B . n B 2 16 ALA 16 120 120 ALA ALA B . n B 2 17 PRO 17 121 121 PRO PRO B . n B 2 18 TYR 18 122 122 TYR TYR B . n B 2 19 LEU 19 123 123 LEU LEU B . n B 2 20 ARG 20 124 124 ARG ARG B . n B 2 21 LYS 21 125 125 LYS LYS B . n B 2 22 ILE 22 126 126 ILE ILE B . n B 2 23 ASP 23 127 127 ASP ASP B . n B 2 24 LEU 24 128 128 LEU LEU B . n B 2 25 ARG 25 129 129 ARG ARG B . n B 2 26 MET 26 130 130 MET MET B . n B 2 27 TYR 27 131 131 TYR TYR B . n B 2 28 LYS 28 132 132 LYS LYS B . n B 2 29 SER 29 133 133 SER SER B . n B 2 30 TYR 30 134 134 TYR TYR B . n B 2 31 ASP 31 135 135 ASP ASP B . n B 2 32 GLU 32 136 136 GLU GLU B . n B 2 33 LEU 33 137 137 LEU LEU B . n B 2 34 SER 34 138 138 SER SER B . n B 2 35 ASN 35 139 139 ASN ASN B . n B 2 36 ALA 36 140 140 ALA ALA B . n B 2 37 LEU 37 141 141 LEU LEU B . n B 2 38 SER 38 142 142 SER SER B . n B 2 39 ASN 39 143 143 ASN ASN B . n B 2 40 MET 40 144 144 MET MET B . n B 2 41 PHE 41 145 145 PHE PHE B . n B 2 42 SER 42 146 146 SER SER B . n B 2 43 SER 43 147 147 SER SER B . n B 2 44 PHE 44 148 148 PHE PHE B . n B 2 45 THR 45 149 149 THR THR B . n B 2 46 MET 46 150 150 MET MET B . n B 2 47 GLY 47 151 151 GLY GLY B . n B 2 48 LYS 48 152 ? ? ? B . n B 2 49 HIS 49 153 ? ? ? B . n B 2 50 GLY 50 154 ? ? ? B . n B 2 51 GLY 51 155 ? ? ? B . n B 2 52 GLU 52 156 ? ? ? B . n B 2 53 GLU 53 157 ? ? ? B . n B 2 54 GLY 54 158 ? ? ? B . n B 2 55 MET 55 159 ? ? ? B . n B 2 56 ILE 56 160 ? ? ? B . n B 2 57 ASP 57 161 ? ? ? B . n B 2 58 PHE 58 162 ? ? ? B . n B 2 59 MET 59 163 ? ? ? B . n B 2 60 ASN 60 164 ? ? ? B . n B 2 61 GLU 61 165 ? ? ? B . n B 2 62 ARG 62 166 ? ? ? B . n B 2 63 LYS 63 167 ? ? ? B . n B 2 64 LEU 64 168 ? ? ? B . n B 2 65 MET 65 169 ? ? ? B . n B 2 66 ASP 66 170 ? ? ? B . n B 2 67 LEU 67 171 ? ? ? B . n B 2 68 VAL 68 172 ? ? ? B . n B 2 69 ASN 69 173 ? ? ? B . n B 2 70 SER 70 174 174 SER SER B . n B 2 71 TRP 71 175 175 TRP TRP B . n B 2 72 ASP 72 176 176 ASP ASP B . n B 2 73 TYR 73 177 177 TYR TYR B . n B 2 74 VAL 74 178 178 VAL VAL B . n B 2 75 PRO 75 179 179 PRO PRO B . n B 2 76 SER 76 180 180 SER SER B . n B 2 77 TYR 77 181 181 TYR TYR B . n B 2 78 GLU 78 182 182 GLU GLU B . n B 2 79 ASN 79 183 183 ASN ASN B . n B 2 80 LYS 80 184 184 LYS LYS B . n B 2 81 ASP 81 185 185 ASP ASP B . n B 2 82 GLY 82 186 186 GLY GLY B . n B 2 83 ASN 83 187 187 ASN ASN B . n B 2 84 TRP 84 188 188 TRP TRP B . n B 2 85 MET 85 189 189 MET MET B . n B 2 86 LEU 86 190 190 LEU LEU B . n B 2 87 VAL 87 191 191 VAL VAL B . n B 2 88 GLY 88 192 192 GLY GLY B . n B 2 89 ASP 89 193 193 ASP ASP B . n B 2 90 VAL 90 194 194 VAL VAL B . n B 2 91 PRO 91 195 195 PRO PRO B . n B 2 92 TRP 92 196 196 TRP TRP B . n B 2 93 PRO 93 197 197 PRO PRO B . n B 2 94 MET 94 198 198 MET MET B . n B 2 95 PHE 95 199 199 PHE PHE B . n B 2 96 VAL 96 200 200 VAL VAL B . n B 2 97 ASP 97 201 201 ASP ASP B . n B 2 98 THR 98 202 202 THR THR B . n B 2 99 ALA 99 203 203 ALA ALA B . n B 2 100 LYS 100 204 204 LYS LYS B . n B 2 101 ARG 101 205 205 ARG ARG B . n B 2 102 LEU 102 206 206 LEU LEU B . n B 2 103 ARG 103 207 207 ARG ARG B . n B 2 104 LEU 104 208 208 LEU LEU B . n B 2 105 MET 105 209 209 MET MET B . n B 2 106 LYS 106 210 210 LYS LYS B . n B 2 107 GLY 107 211 211 GLY GLY B . n B 2 108 SER 108 212 ? ? ? B . n B 2 109 ASP 109 213 ? ? ? B . n B 2 110 ALA 110 214 ? ? ? B . n B 2 111 ILE 111 215 ? ? ? B . n B 2 112 GLY 112 216 ? ? ? B . n B 2 113 LEU 113 217 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 901 3 HOH HOH A . C 3 HOH 2 902 14 HOH HOH A . C 3 HOH 3 903 6 HOH HOH A . C 3 HOH 4 904 12 HOH HOH A . C 3 HOH 5 905 2 HOH HOH A . C 3 HOH 6 906 10 HOH HOH A . C 3 HOH 7 907 1 HOH HOH A . C 3 HOH 8 908 7 HOH HOH A . D 3 HOH 1 301 8 HOH HOH B . D 3 HOH 2 302 5 HOH HOH B . D 3 HOH 3 303 11 HOH HOH B . D 3 HOH 4 304 15 HOH HOH B . D 3 HOH 5 305 13 HOH HOH B . D 3 HOH 6 306 9 HOH HOH B . D 3 HOH 7 307 4 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1200 ? 1 MORE -4 ? 1 'SSA (A^2)' 9930 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2020-09-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -18.7358452676 -12.7344700375 -19.4244655915 1.60180255362 ? -0.0221454567638 ? -0.227760725924 ? 0.866682628901 ? -0.160657346461 ? 0.669987199664 ? 8.78094786882 ? -0.534204683072 ? 2.06394573157 ? 4.63001586971 ? -1.49245485616 ? 4.26681233545 ? 0.115892814369 ? -1.17815316478 ? 0.166607493835 ? 0.612236737931 ? 1.54033524694 ? 1.77824974004 ? 0.0624558493516 ? -2.60778850618 ? 0.592130174437 ? 2 'X-RAY DIFFRACTION' ? refined -10.4269033153 -9.46141839731 -21.2149014707 1.16235994499 ? 0.302800283806 ? -0.326535656975 ? 0.657165439634 ? -0.144615148013 ? 0.477253970587 ? 8.14960181337 ? 1.63821604734 ? 2.95081409365 ? 1.55056978224 ? 1.56329875154 ? 7.95248949359 ? 0.997518826816 ? -1.01959087733 ? -1.69032296186 ? -0.43160168617 ? 0.170043396919 ? -0.360551905025 ? 1.54071537098 ? -0.189128628151 ? -0.15403680862 ? 3 'X-RAY DIFFRACTION' ? refined -4.3415026425 1.60229781839 -25.7928103962 1.22506430871 ? -0.0850777196189 ? -0.287412373084 ? 0.78692406405 ? 0.141088201126 ? 0.456633946546 ? 2.27324722542 ? 1.52473603994 ? 1.06619537256 ? 3.14673688727 ? 3.48389964478 ? 4.68490823076 ? -0.77844719459 ? -1.58828403955 ? -1.53892359755 ? 2.13976227222 ? 1.38654660038 ? -0.577220757788 ? -0.310649170794 ? 0.215507198822 ? -0.26797979696 ? 4 'X-RAY DIFFRACTION' ? refined -17.7436377788 0.4800582418 -17.383855649 0.708194463518 ? 0.0123203540929 ? -0.129561533813 ? 0.677494649321 ? -0.0529163028861 ? 0.361504901661 ? 4.4762417027 ? 0.0205084816788 ? 0.210075992418 ? 9.51048072884 ? -1.20624692187 ? 3.6751642364 ? 0.207741437535 ? -0.833764151949 ? 0.015892592531 ? 0.629936265383 ? 0.0992746526358 ? 0.439616576703 ? 0.55196786838 ? -0.186732205738 ? -0.495148805099 ? 5 'X-RAY DIFFRACTION' ? refined -13.1780345062 12.5200638588 -8.23521694897 0.972459673699 ? -0.108990494902 ? -0.000762822922833 ? 0.981276632525 ? -0.134839453017 ? 0.33643554137 ? 4.15251103264 ? -1.42290715359 ? 0.195782195642 ? 6.07304923474 ? 1.94781645437 ? 8.19014901728 ? 0.456355845629 ? -0.0527570696581 ? 0.284022814094 ? -0.526699049586 ? -0.456779577466 ? -0.629606018911 ? -0.200564484844 ? 1.6876856956 ? -0.241143603212 ? 6 'X-RAY DIFFRACTION' ? refined -14.807131117 23.5345546488 -15.6727607158 0.651462762728 ? 0.0164676704119 ? 0.904782280651 ? 0.640919932763 ? 0.786419300192 ? 1.24931924385 ? 5.41986214545 ? 1.59710548907 ? -5.23356600513 ? 1.6782739536 ? -1.33537920301 ? 5.31521901631 ? -1.18638740082 ? 3.22695008794 ? -0.386938573335 ? -0.378070123793 ? -1.44188222545 ? -1.42609625255 ? 0.0588417886359 ? 1.29640731172 ? -1.60080356315 ? 7 'X-RAY DIFFRACTION' ? refined -22.4701128441 15.2565417143 -0.743797717395 0.846460084158 ? 0.102519982795 ? 0.0680878519973 ? 1.14667533689 ? -0.300898505852 ? 0.523698475811 ? 6.56447110282 ? -1.80484386994 ? -1.32307406333 ? 8.05177919895 ? 0.791776492744 ? 2.20448590203 ? -0.193599440478 ? -1.04370384796 ? 0.109073427554 ? 1.19306275825 ? 0.360155875637 ? 0.654358416586 ? -0.00225248098889 ? -0.693303910604 ? 0.291401779896 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 792 through 800 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 801 through 827 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 828 through 841 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 842 through 883 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 109 through 149 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 150 through 177 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 178 through 211 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLN _pdbx_validate_symm_contact.auth_seq_id_1 879 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLN _pdbx_validate_symm_contact.auth_seq_id_2 879 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 8_554 _pdbx_validate_symm_contact.dist 1.71 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLN _pdbx_validate_rmsd_angle.auth_seq_id_1 879 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 GLN _pdbx_validate_rmsd_angle.auth_seq_id_2 879 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 GLN _pdbx_validate_rmsd_angle.auth_seq_id_3 879 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 100.05 _pdbx_validate_rmsd_angle.angle_target_value 113.40 _pdbx_validate_rmsd_angle.angle_deviation -13.35 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.20 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 834 ? ? -119.60 76.28 2 1 SER A 838 ? ? 62.38 71.48 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 788 ? A GLY 1 2 1 Y 1 A THR 789 ? A THR 2 3 1 Y 1 A PRO 790 ? A PRO 3 4 1 Y 1 A ARG 791 ? A ARG 4 5 1 Y 1 A GLU 884 ? A GLU 97 6 1 Y 1 A GLY 885 ? A GLY 98 7 1 Y 1 B GLY 105 ? B GLY 1 8 1 Y 1 B GLY 106 ? B GLY 2 9 1 Y 1 B PRO 107 ? B PRO 3 10 1 Y 1 B GLU 108 ? B GLU 4 11 1 Y 1 B LYS 152 ? B LYS 48 12 1 Y 1 B HIS 153 ? B HIS 49 13 1 Y 1 B GLY 154 ? B GLY 50 14 1 Y 1 B GLY 155 ? B GLY 51 15 1 Y 1 B GLU 156 ? B GLU 52 16 1 Y 1 B GLU 157 ? B GLU 53 17 1 Y 1 B GLY 158 ? B GLY 54 18 1 Y 1 B MET 159 ? B MET 55 19 1 Y 1 B ILE 160 ? B ILE 56 20 1 Y 1 B ASP 161 ? B ASP 57 21 1 Y 1 B PHE 162 ? B PHE 58 22 1 Y 1 B MET 163 ? B MET 59 23 1 Y 1 B ASN 164 ? B ASN 60 24 1 Y 1 B GLU 165 ? B GLU 61 25 1 Y 1 B ARG 166 ? B ARG 62 26 1 Y 1 B LYS 167 ? B LYS 63 27 1 Y 1 B LEU 168 ? B LEU 64 28 1 Y 1 B MET 169 ? B MET 65 29 1 Y 1 B ASP 170 ? B ASP 66 30 1 Y 1 B LEU 171 ? B LEU 67 31 1 Y 1 B VAL 172 ? B VAL 68 32 1 Y 1 B ASN 173 ? B ASN 69 33 1 Y 1 B SER 212 ? B SER 108 34 1 Y 1 B ASP 213 ? B ASP 109 35 1 Y 1 B ALA 214 ? B ALA 110 36 1 Y 1 B ILE 215 ? B ILE 111 37 1 Y 1 B GLY 216 ? B GLY 112 38 1 Y 1 B LEU 217 ? B LEU 113 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 41 21 2' _space_group.name_Hall 'P 4abw 2nw' _space_group.IT_number 92 _space_group.crystal_system tetragonal _space_group.id 1 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/4 3 y+1/2,-x+1/2,z+3/4 4 x+1/2,-y+1/2,-z+3/4 5 -x+1/2,y+1/2,-z+1/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 #