data_6L79 # _entry.id 6L79 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.365 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6L79 pdb_00006l79 10.2210/pdb6l79/pdb WWPDB D_1300014317 ? ? # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2023-02-08 _pdbx_database_PDB_obs_spr.pdb_id 7VQF _pdbx_database_PDB_obs_spr.replace_pdb_id 6L79 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6L79 _pdbx_database_status.recvd_initial_deposition_date 2019-11-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ray, S.' 1 ? 'Singh, J.' 2 ? 'Sahu, S.' 3 ? 'Panjikar, S.' 4 ? 'Krishnamoorthy, G.' 5 ? 'Anand, R.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Insights into Mechanism of Allosteric Regulation and Signal Transduction of the Phenol Sensing Protein, MopR' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ray, S.' 1 ? primary 'Singh, J.' 2 ? primary 'Sahu, S.' 3 ? primary 'Panjikar, S.' 4 ? primary 'Krishnamoorthy, G.' 5 ? primary 'Anand, R.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6L79 _cell.details ? _cell.formula_units_Z ? _cell.length_a 65.910 _cell.length_a_esd ? _cell.length_b 119.300 _cell.length_b_esd ? _cell.length_c 56.790 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6L79 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Phenol regulator MopR' 26427.246 1 ? G148P ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer nat PHENOL 94.111 1 ? ? ? ? 4 water nat water 18.015 23 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Transcription regulator' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSPAKDVKVYKKILEQNKDIQDLLDKIVFDAQHGQIWFDENRMLLMHTSILGFLRKDLYQMLGLERTKRFFIRCGYQAGM RDAEVTSKLRPNLNEAEAFMAGPQMHGIRGMVQVEVNELHLSHDLKQFYADFNWLNSFEAEVHLSEFPASDQPACWMLLG YACGYSSFVMGQTIIYQETHCVAQGDEHCRIIGKPLSEWENADELIRFMSPDAVSDEIIALQAELNQLK ; _entity_poly.pdbx_seq_one_letter_code_can ;MSPAKDVKVYKKILEQNKDIQDLLDKIVFDAQHGQIWFDENRMLLMHTSILGFLRKDLYQMLGLERTKRFFIRCGYQAGM RDAEVTSKLRPNLNEAEAFMAGPQMHGIRGMVQVEVNELHLSHDLKQFYADFNWLNSFEAEVHLSEFPASDQPACWMLLG YACGYSSFVMGQTIIYQETHCVAQGDEHCRIIGKPLSEWENADELIRFMSPDAVSDEIIALQAELNQLK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 PRO n 1 4 ALA n 1 5 LYS n 1 6 ASP n 1 7 VAL n 1 8 LYS n 1 9 VAL n 1 10 TYR n 1 11 LYS n 1 12 LYS n 1 13 ILE n 1 14 LEU n 1 15 GLU n 1 16 GLN n 1 17 ASN n 1 18 LYS n 1 19 ASP n 1 20 ILE n 1 21 GLN n 1 22 ASP n 1 23 LEU n 1 24 LEU n 1 25 ASP n 1 26 LYS n 1 27 ILE n 1 28 VAL n 1 29 PHE n 1 30 ASP n 1 31 ALA n 1 32 GLN n 1 33 HIS n 1 34 GLY n 1 35 GLN n 1 36 ILE n 1 37 TRP n 1 38 PHE n 1 39 ASP n 1 40 GLU n 1 41 ASN n 1 42 ARG n 1 43 MET n 1 44 LEU n 1 45 LEU n 1 46 MET n 1 47 HIS n 1 48 THR n 1 49 SER n 1 50 ILE n 1 51 LEU n 1 52 GLY n 1 53 PHE n 1 54 LEU n 1 55 ARG n 1 56 LYS n 1 57 ASP n 1 58 LEU n 1 59 TYR n 1 60 GLN n 1 61 MET n 1 62 LEU n 1 63 GLY n 1 64 LEU n 1 65 GLU n 1 66 ARG n 1 67 THR n 1 68 LYS n 1 69 ARG n 1 70 PHE n 1 71 PHE n 1 72 ILE n 1 73 ARG n 1 74 CYS n 1 75 GLY n 1 76 TYR n 1 77 GLN n 1 78 ALA n 1 79 GLY n 1 80 MET n 1 81 ARG n 1 82 ASP n 1 83 ALA n 1 84 GLU n 1 85 VAL n 1 86 THR n 1 87 SER n 1 88 LYS n 1 89 LEU n 1 90 ARG n 1 91 PRO n 1 92 ASN n 1 93 LEU n 1 94 ASN n 1 95 GLU n 1 96 ALA n 1 97 GLU n 1 98 ALA n 1 99 PHE n 1 100 MET n 1 101 ALA n 1 102 GLY n 1 103 PRO n 1 104 GLN n 1 105 MET n 1 106 HIS n 1 107 GLY n 1 108 ILE n 1 109 ARG n 1 110 GLY n 1 111 MET n 1 112 VAL n 1 113 GLN n 1 114 VAL n 1 115 GLU n 1 116 VAL n 1 117 ASN n 1 118 GLU n 1 119 LEU n 1 120 HIS n 1 121 LEU n 1 122 SER n 1 123 HIS n 1 124 ASP n 1 125 LEU n 1 126 LYS n 1 127 GLN n 1 128 PHE n 1 129 TYR n 1 130 ALA n 1 131 ASP n 1 132 PHE n 1 133 ASN n 1 134 TRP n 1 135 LEU n 1 136 ASN n 1 137 SER n 1 138 PHE n 1 139 GLU n 1 140 ALA n 1 141 GLU n 1 142 VAL n 1 143 HIS n 1 144 LEU n 1 145 SER n 1 146 GLU n 1 147 PHE n 1 148 PRO n 1 149 ALA n 1 150 SER n 1 151 ASP n 1 152 GLN n 1 153 PRO n 1 154 ALA n 1 155 CYS n 1 156 TRP n 1 157 MET n 1 158 LEU n 1 159 LEU n 1 160 GLY n 1 161 TYR n 1 162 ALA n 1 163 CYS n 1 164 GLY n 1 165 TYR n 1 166 SER n 1 167 SER n 1 168 PHE n 1 169 VAL n 1 170 MET n 1 171 GLY n 1 172 GLN n 1 173 THR n 1 174 ILE n 1 175 ILE n 1 176 TYR n 1 177 GLN n 1 178 GLU n 1 179 THR n 1 180 HIS n 1 181 CYS n 1 182 VAL n 1 183 ALA n 1 184 GLN n 1 185 GLY n 1 186 ASP n 1 187 GLU n 1 188 HIS n 1 189 CYS n 1 190 ARG n 1 191 ILE n 1 192 ILE n 1 193 GLY n 1 194 LYS n 1 195 PRO n 1 196 LEU n 1 197 SER n 1 198 GLU n 1 199 TRP n 1 200 GLU n 1 201 ASN n 1 202 ALA n 1 203 ASP n 1 204 GLU n 1 205 LEU n 1 206 ILE n 1 207 ARG n 1 208 PHE n 1 209 MET n 1 210 SER n 1 211 PRO n 1 212 ASP n 1 213 ALA n 1 214 VAL n 1 215 SER n 1 216 ASP n 1 217 GLU n 1 218 ILE n 1 219 ILE n 1 220 ALA n 1 221 LEU n 1 222 GLN n 1 223 ALA n 1 224 GLU n 1 225 LEU n 1 226 ASN n 1 227 GLN n 1 228 LEU n 1 229 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 229 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene mopR _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Acinetobacter guillouiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 106649 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MOPR_ACIGI _struct_ref.pdbx_db_accession Q43965 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSPAKDVKVYKKILEQNKDIQDLLDKIVFDAQHGQIWFDENRMLLMHTSILGFLRKDLYQMLGLERTKRFFIRCGYQAGM RDAEVTSKLRPNLNEAEAFMAGPQMHGIRGMVQVEVNELHLSHDLKQFYADFNWLNSFEAEVHLSEFGASDQPACWMLLG YACGYSSFVMGQTIIYQETHCVAQGDEHCRIIGKPLSEWENADELIRFMSPDAVSDEIIALQAELNQLK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6L79 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 229 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q43965 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 229 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 229 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6L79 _struct_ref_seq_dif.mon_id PRO _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 148 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q43965 _struct_ref_seq_dif.db_mon_id GLY _struct_ref_seq_dif.pdbx_seq_db_seq_num 148 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 148 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IPH non-polymer . PHENOL ? 'C6 H6 O' 94.111 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6L79 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.11 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.77 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 300 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Mg-acetate, 4H2O, 15% w/v PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-29 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate 54.39 _reflns.entry_id 6L79 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.20 _reflns.d_resolution_low 19.23 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11510 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.87 _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.16 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.2 _reflns_shell.d_res_low 2.32 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1122 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.0 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 186.810 _refine.B_iso_mean 65.5484 _refine.B_iso_min 27.570 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6L79 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2000 _refine.ls_d_res_low 19.2300 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11510 _refine.ls_number_reflns_R_free 962 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.5200 _refine.ls_percent_reflns_R_free 8.3600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2104 _refine.ls_R_factor_R_free 0.2470 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2070 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.330 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5KBE _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.5100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2000 _refine_hist.d_res_low 19.2300 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 1558 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 192 _refine_hist.pdbx_B_iso_mean_ligand 76.63 _refine_hist.pdbx_B_iso_mean_solvent 62.41 _refine_hist.pdbx_number_atoms_protein 1522 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _refine_ls_shell.R_factor_R_free 0.341 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.338 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.d_res_high 2.201 _refine_ls_shell.d_res_low 2.28 _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 1122 _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.percent_reflns_obs 96.89 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? # _struct.entry_id 6L79 _struct.title 'Crystal structure of the G148P mutant of aromatic sensor domain of MopR in complex with phenol' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6L79 _struct_keywords.text 'NtrC, regulator, phenol, hinge, tryptophan, fluorescence, allostery, sensor, ATPase, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 15 ? ASP A 19 ? GLU A 15 ASP A 19 5 ? 5 HELX_P HELX_P2 AA2 ILE A 20 ? LYS A 26 ? ILE A 20 LYS A 26 1 ? 7 HELX_P HELX_P3 AA3 HIS A 47 ? GLY A 63 ? HIS A 47 GLY A 63 1 ? 17 HELX_P HELX_P4 AA4 GLY A 63 ? ARG A 90 ? GLY A 63 ARG A 90 1 ? 28 HELX_P HELX_P5 AA5 ASN A 94 ? MET A 100 ? ASN A 94 MET A 100 1 ? 7 HELX_P HELX_P6 AA6 MET A 100 ? ARG A 109 ? MET A 100 ARG A 109 1 ? 10 HELX_P HELX_P7 AA7 SER A 137 ? PHE A 147 ? SER A 137 PHE A 147 1 ? 11 HELX_P HELX_P8 AA8 CYS A 155 ? GLY A 171 ? CYS A 155 GLY A 171 1 ? 17 HELX_P HELX_P9 AA9 CYS A 181 ? GLY A 185 ? CYS A 181 GLY A 185 5 ? 5 HELX_P HELX_P10 AB1 SER A 197 ? GLU A 200 ? SER A 197 GLU A 200 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 155 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 155 A ZN 601 1_555 ? ? ? ? ? ? ? 2.286 ? ? metalc2 metalc ? ? A GLU 178 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 178 A ZN 601 1_555 ? ? ? ? ? ? ? 1.956 ? ? metalc3 metalc ? ? A CYS 181 SG A ? ? 1_555 B ZN . ZN ? ? A CYS 181 A ZN 601 1_555 ? ? ? ? ? ? ? 2.389 ? ? metalc4 metalc ? ? A CYS 181 SG B ? ? 1_555 B ZN . ZN ? ? A CYS 181 A ZN 601 1_555 ? ? ? ? ? ? ? 2.383 ? ? metalc5 metalc ? ? A CYS 189 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 189 A ZN 601 1_555 ? ? ? ? ? ? ? 2.429 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 27 ? ASP A 30 ? ILE A 27 ASP A 30 AA1 2 GLN A 35 ? PHE A 38 ? GLN A 35 PHE A 38 AA1 3 ASN A 41 ? MET A 43 ? ASN A 41 MET A 43 AA2 1 GLN A 113 ? SER A 122 ? GLN A 113 SER A 122 AA2 2 GLN A 127 ? LEU A 135 ? GLN A 127 LEU A 135 AA2 3 CYS A 189 ? PRO A 195 ? CYS A 189 PRO A 195 AA2 4 ILE A 174 ? HIS A 180 ? ILE A 174 HIS A 180 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 30 ? N ASP A 30 O GLN A 35 ? O GLN A 35 AA1 2 3 N ILE A 36 ? N ILE A 36 O MET A 43 ? O MET A 43 AA2 1 2 N GLN A 113 ? N GLN A 113 O LEU A 135 ? O LEU A 135 AA2 2 3 N TRP A 134 ? N TRP A 134 O CYS A 189 ? O CYS A 189 AA2 3 4 O ARG A 190 ? O ARG A 190 N HIS A 180 ? N HIS A 180 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 601 ? 4 'binding site for residue ZN A 601' AC2 Software A IPH 602 ? 9 'binding site for residue IPH A 602' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 155 ? CYS A 155 . ? 1_555 ? 2 AC1 4 GLU A 178 ? GLU A 178 . ? 1_555 ? 3 AC1 4 CYS A 181 ? CYS A 181 . ? 1_555 ? 4 AC1 4 CYS A 189 ? CYS A 189 . ? 1_555 ? 5 AC2 9 HIS A 106 ? HIS A 106 . ? 1_555 ? 6 AC2 9 VAL A 114 ? VAL A 114 . ? 1_555 ? 7 AC2 9 PHE A 132 ? PHE A 132 . ? 1_555 ? 8 AC2 9 TRP A 134 ? TRP A 134 . ? 1_555 ? 9 AC2 9 TYR A 161 ? TYR A 161 . ? 1_555 ? 10 AC2 9 ALA A 162 ? ALA A 162 . ? 1_555 ? 11 AC2 9 SER A 166 ? SER A 166 . ? 1_555 ? 12 AC2 9 TYR A 176 ? TYR A 176 . ? 1_555 ? 13 AC2 9 ILE A 191 ? ILE A 191 . ? 1_555 ? # _atom_sites.entry_id 6L79 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.015172 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008382 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017609 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 ALA 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 VAL 7 7 ? ? ? A . n A 1 8 LYS 8 8 ? ? ? A . n A 1 9 VAL 9 9 ? ? ? A . n A 1 10 TYR 10 10 ? ? ? A . n A 1 11 LYS 11 11 ? ? ? A . n A 1 12 LYS 12 12 ? ? ? A . n A 1 13 ILE 13 13 ? ? ? A . n A 1 14 LEU 14 14 14 LEU ALA A . n A 1 15 GLU 15 15 15 GLU ALA A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 LYS 18 18 18 LYS ALA A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 TRP 134 134 134 TRP TRP A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 ASN 136 136 136 ASN ASN A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 CYS 155 155 155 CYS CYS A . n A 1 156 TRP 156 156 156 TRP TRP A . n A 1 157 MET 157 157 157 MET MET A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 CYS 163 163 163 CYS CYS A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 PHE 168 168 168 PHE PHE A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 MET 170 170 170 MET MET A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 THR 173 173 173 THR THR A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 TYR 176 176 176 TYR TYR A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 HIS 180 180 180 HIS HIS A . n A 1 181 CYS 181 181 181 CYS CYS A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 HIS 188 188 188 HIS HIS A . n A 1 189 CYS 189 189 189 CYS CYS A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 ILE 192 192 192 ILE ILE A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 LYS 194 194 194 LYS LYS A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 GLU 198 198 198 GLU GLU A . n A 1 199 TRP 199 199 199 TRP TRP A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 ASN 201 201 201 ASN ASN A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 ASP 203 203 203 ASP ASP A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 ILE 206 206 206 ILE ILE A . n A 1 207 ARG 207 207 207 ARG ALA A . n A 1 208 PHE 208 208 208 PHE ALA A . n A 1 209 MET 209 209 ? ? ? A . n A 1 210 SER 210 210 ? ? ? A . n A 1 211 PRO 211 211 ? ? ? A . n A 1 212 ASP 212 212 ? ? ? A . n A 1 213 ALA 213 213 ? ? ? A . n A 1 214 VAL 214 214 ? ? ? A . n A 1 215 SER 215 215 ? ? ? A . n A 1 216 ASP 216 216 ? ? ? A . n A 1 217 GLU 217 217 ? ? ? A . n A 1 218 ILE 218 218 ? ? ? A . n A 1 219 ILE 219 219 ? ? ? A . n A 1 220 ALA 220 220 ? ? ? A . n A 1 221 LEU 221 221 ? ? ? A . n A 1 222 GLN 222 222 ? ? ? A . n A 1 223 ALA 223 223 ? ? ? A . n A 1 224 GLU 224 224 ? ? ? A . n A 1 225 LEU 225 225 ? ? ? A . n A 1 226 ASN 226 226 ? ? ? A . n A 1 227 GLN 227 227 ? ? ? A . n A 1 228 LEU 228 228 ? ? ? A . n A 1 229 LYS 229 229 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 601 601 ZN ZN A . C 3 IPH 1 602 602 IPH IPH A . D 4 HOH 1 701 13 HOH HOH A . D 4 HOH 2 702 9 HOH HOH A . D 4 HOH 3 703 12 HOH HOH A . D 4 HOH 4 704 23 HOH HOH A . D 4 HOH 5 705 19 HOH HOH A . D 4 HOH 6 706 2 HOH HOH A . D 4 HOH 7 707 21 HOH HOH A . D 4 HOH 8 708 16 HOH HOH A . D 4 HOH 9 709 5 HOH HOH A . D 4 HOH 10 710 20 HOH HOH A . D 4 HOH 11 711 1 HOH HOH A . D 4 HOH 12 712 8 HOH HOH A . D 4 HOH 13 713 22 HOH HOH A . D 4 HOH 14 714 14 HOH HOH A . D 4 HOH 15 715 17 HOH HOH A . D 4 HOH 16 716 3 HOH HOH A . D 4 HOH 17 717 6 HOH HOH A . D 4 HOH 18 718 18 HOH HOH A . D 4 HOH 19 719 10 HOH HOH A . D 4 HOH 20 720 4 HOH HOH A . D 4 HOH 21 721 15 HOH HOH A . D 4 HOH 22 722 7 HOH HOH A . D 4 HOH 23 723 11 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 280 ? 1 MORE 7 ? 1 'SSA (A^2)' 10690 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 711 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 155 ? A CYS 155 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 OE2 ? A GLU 178 ? A GLU 178 ? 1_555 110.3 ? 2 SG ? A CYS 155 ? A CYS 155 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG A A CYS 181 ? A CYS 181 ? 1_555 115.4 ? 3 OE2 ? A GLU 178 ? A GLU 178 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG A A CYS 181 ? A CYS 181 ? 1_555 114.4 ? 4 SG ? A CYS 155 ? A CYS 155 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG B A CYS 181 ? A CYS 181 ? 1_555 110.1 ? 5 OE2 ? A GLU 178 ? A GLU 178 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG B A CYS 181 ? A CYS 181 ? 1_555 102.8 ? 6 SG A A CYS 181 ? A CYS 181 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG B A CYS 181 ? A CYS 181 ? 1_555 18.1 ? 7 SG ? A CYS 155 ? A CYS 155 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG ? A CYS 189 ? A CYS 189 ? 1_555 112.9 ? 8 OE2 ? A GLU 178 ? A GLU 178 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG ? A CYS 189 ? A CYS 189 ? 1_555 110.5 ? 9 SG A A CYS 181 ? A CYS 181 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG ? A CYS 189 ? A CYS 189 ? 1_555 92.3 ? 10 SG B A CYS 181 ? A CYS 181 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG ? A CYS 189 ? A CYS 189 ? 1_555 109.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-11-04 2 'Structure model' 1 1 2023-02-08 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Obsolete ? ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_PDB_obs_spr 3 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code' 4 2 'Structure model' '_pdbx_database_status.status_code_sf' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 19.0220 _pdbx_refine_tls.origin_y 13.3183 _pdbx_refine_tls.origin_z -2.7065 _pdbx_refine_tls.T[1][1] 0.3582 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0268 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0458 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.2454 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0328 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.2740 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 3.2147 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 1.3606 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.5019 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 3.0185 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.8978 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 3.1122 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0339 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.2366 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.3422 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.1009 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0540 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.2743 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.3460 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0510 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0295 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 14 ? ? A 208 ? ? 2 'X-RAY DIFFRACTION' 1 ? ? A 601 ? ? A 602 ? ? 3 'X-RAY DIFFRACTION' 1 ? ? A 701 ? ? A 723 ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 5 # _pdbx_entry_details.entry_id 6L79 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CB A LEU 58 ? ? O A HOH 701 ? ? 1.50 2 1 CG A LEU 58 ? ? O A HOH 701 ? ? 2.04 3 1 O A LEU 54 ? ? O A HOH 701 ? ? 2.09 4 1 CB A LEU 54 ? ? O A HOH 703 ? ? 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 17 ? ? -67.95 11.18 2 1 ASP A 39 ? ? 60.07 -126.54 3 1 PRO A 91 ? ? -101.46 40.92 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 14 ? CG ? A LEU 14 CG 2 1 Y 1 A LEU 14 ? CD1 ? A LEU 14 CD1 3 1 Y 1 A LEU 14 ? CD2 ? A LEU 14 CD2 4 1 Y 1 A GLU 15 ? CG ? A GLU 15 CG 5 1 Y 1 A GLU 15 ? CD ? A GLU 15 CD 6 1 Y 1 A GLU 15 ? OE1 ? A GLU 15 OE1 7 1 Y 1 A GLU 15 ? OE2 ? A GLU 15 OE2 8 1 Y 1 A GLN 16 ? CG ? A GLN 16 CG 9 1 Y 1 A GLN 16 ? CD ? A GLN 16 CD 10 1 Y 1 A GLN 16 ? OE1 ? A GLN 16 OE1 11 1 Y 1 A GLN 16 ? NE2 ? A GLN 16 NE2 12 1 Y 1 A LYS 18 ? CG ? A LYS 18 CG 13 1 Y 1 A LYS 18 ? CD ? A LYS 18 CD 14 1 Y 1 A LYS 18 ? CE ? A LYS 18 CE 15 1 Y 1 A LYS 18 ? NZ ? A LYS 18 NZ 16 1 Y 1 A GLN 32 ? CG ? A GLN 32 CG 17 1 Y 1 A GLN 32 ? CD ? A GLN 32 CD 18 1 Y 1 A GLN 32 ? OE1 ? A GLN 32 OE1 19 1 Y 1 A GLN 32 ? NE2 ? A GLN 32 NE2 20 1 Y 1 A LYS 56 ? CG ? A LYS 56 CG 21 1 Y 1 A LYS 56 ? CD ? A LYS 56 CD 22 1 Y 1 A LYS 56 ? CE ? A LYS 56 CE 23 1 Y 1 A LYS 56 ? NZ ? A LYS 56 NZ 24 1 Y 1 A ARG 81 ? CG ? A ARG 81 CG 25 1 Y 1 A ARG 81 ? CD ? A ARG 81 CD 26 1 Y 1 A ARG 81 ? NE ? A ARG 81 NE 27 1 Y 1 A ARG 81 ? CZ ? A ARG 81 CZ 28 1 Y 1 A ARG 81 ? NH1 ? A ARG 81 NH1 29 1 Y 1 A ARG 81 ? NH2 ? A ARG 81 NH2 30 1 Y 1 A LEU 93 ? CG ? A LEU 93 CG 31 1 Y 1 A LEU 93 ? CD1 ? A LEU 93 CD1 32 1 Y 1 A LEU 93 ? CD2 ? A LEU 93 CD2 33 1 Y 1 A LYS 126 ? CG ? A LYS 126 CG 34 1 Y 1 A LYS 126 ? CD ? A LYS 126 CD 35 1 Y 1 A LYS 126 ? CE ? A LYS 126 CE 36 1 Y 1 A LYS 126 ? NZ ? A LYS 126 NZ 37 1 Y 1 A GLN 127 ? CG ? A GLN 127 CG 38 1 Y 1 A GLN 127 ? CD ? A GLN 127 CD 39 1 Y 1 A GLN 127 ? OE1 ? A GLN 127 OE1 40 1 Y 1 A GLN 127 ? NE2 ? A GLN 127 NE2 41 1 Y 1 A GLU 200 ? CG ? A GLU 200 CG 42 1 Y 1 A GLU 200 ? CD ? A GLU 200 CD 43 1 Y 1 A GLU 200 ? OE1 ? A GLU 200 OE1 44 1 Y 1 A GLU 200 ? OE2 ? A GLU 200 OE2 45 1 Y 1 A ASP 203 ? CG ? A ASP 203 CG 46 1 Y 1 A ASP 203 ? OD1 ? A ASP 203 OD1 47 1 Y 1 A ASP 203 ? OD2 ? A ASP 203 OD2 48 1 Y 1 A ILE 206 ? CG1 ? A ILE 206 CG1 49 1 Y 1 A ILE 206 ? CG2 ? A ILE 206 CG2 50 1 Y 1 A ILE 206 ? CD1 ? A ILE 206 CD1 51 1 Y 1 A ARG 207 ? CG ? A ARG 207 CG 52 1 Y 1 A ARG 207 ? CD ? A ARG 207 CD 53 1 Y 1 A ARG 207 ? NE ? A ARG 207 NE 54 1 Y 1 A ARG 207 ? CZ ? A ARG 207 CZ 55 1 Y 1 A ARG 207 ? NH1 ? A ARG 207 NH1 56 1 Y 1 A ARG 207 ? NH2 ? A ARG 207 NH2 57 1 Y 1 A PHE 208 ? CG ? A PHE 208 CG 58 1 Y 1 A PHE 208 ? CD1 ? A PHE 208 CD1 59 1 Y 1 A PHE 208 ? CD2 ? A PHE 208 CD2 60 1 Y 1 A PHE 208 ? CE1 ? A PHE 208 CE1 61 1 Y 1 A PHE 208 ? CE2 ? A PHE 208 CE2 62 1 Y 1 A PHE 208 ? CZ ? A PHE 208 CZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A ALA 4 ? A ALA 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A VAL 7 ? A VAL 7 8 1 Y 1 A LYS 8 ? A LYS 8 9 1 Y 1 A VAL 9 ? A VAL 9 10 1 Y 1 A TYR 10 ? A TYR 10 11 1 Y 1 A LYS 11 ? A LYS 11 12 1 Y 1 A LYS 12 ? A LYS 12 13 1 Y 1 A ILE 13 ? A ILE 13 14 1 Y 1 A MET 209 ? A MET 209 15 1 Y 1 A SER 210 ? A SER 210 16 1 Y 1 A PRO 211 ? A PRO 211 17 1 Y 1 A ASP 212 ? A ASP 212 18 1 Y 1 A ALA 213 ? A ALA 213 19 1 Y 1 A VAL 214 ? A VAL 214 20 1 Y 1 A SER 215 ? A SER 215 21 1 Y 1 A ASP 216 ? A ASP 216 22 1 Y 1 A GLU 217 ? A GLU 217 23 1 Y 1 A ILE 218 ? A ILE 218 24 1 Y 1 A ILE 219 ? A ILE 219 25 1 Y 1 A ALA 220 ? A ALA 220 26 1 Y 1 A LEU 221 ? A LEU 221 27 1 Y 1 A GLN 222 ? A GLN 222 28 1 Y 1 A ALA 223 ? A ALA 223 29 1 Y 1 A GLU 224 ? A GLU 224 30 1 Y 1 A LEU 225 ? A LEU 225 31 1 Y 1 A ASN 226 ? A ASN 226 32 1 Y 1 A GLN 227 ? A GLN 227 33 1 Y 1 A LEU 228 ? A LEU 228 34 1 Y 1 A LYS 229 ? A LYS 229 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Department of Science & Technology (DST, India)' India EMR/2015/002121 1 'Board of Research in Nuclear Sciences (BRNS)' India 20150237B02RP00614-BRNS 2 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 IPH ? ? IPH ? ? 'SUBJECT OF INVESTIGATION' ? 2 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 PHENOL IPH 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #