data_6L7Z # _entry.id 6L7Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6L7Z pdb_00006l7z 10.2210/pdb6l7z/pdb WWPDB D_1300014210 ? ? BMRB 28032 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 28032 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6L7Z _pdbx_database_status.recvd_initial_deposition_date 2019-11-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Basak, A.J.' 1 0000-0001-8615-5705 'Lee, W.' 2 0000-0002-0964-203X 'Samanta, D.' 3 0000-0002-5733-6694 'De, S.' 4 0000-0002-4347-3137 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 432 _citation.language ? _citation.page_first 5938 _citation.page_last 5950 _citation.title ;Structural Insights into N-terminal IgV Domain of BTNL2, a T Cell Inhibitory Molecule, Suggests a Non-canonical Binding Interface for Its Putative Receptors. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2020.09.013 _citation.pdbx_database_id_PubMed 32976909 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Basak, A.J.' 1 ? primary 'Maiti, S.' 2 ? primary 'Hansda, A.' 3 ? primary 'Mahata, D.' 4 ? primary 'Duraivelan, K.' 5 ? primary 'Kundapura, S.V.' 6 ? primary 'Lee, W.' 7 ? primary 'Mukherjee, G.' 8 ? primary 'De, S.' 9 ? primary 'Samanta, D.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Butyrophilin-like protein 2' _entity.formula_weight 13340.078 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDFRVVGPNLPILAKVGEDALLTCQLLPKRTTAHMEVRWYRSDPDMPVIMYRDGAEVTGLPMEGYGGRAEWMEDSTEEGS VALKIRQVQPSDDGQYWCRFQEGDYWRETSVLLQVAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MDFRVVGPNLPILAKVGEDALLTCQLLPKRTTAHMEVRWYRSDPDMPVIMYRDGAEVTGLPMEGYGGRAEWMEDSTEEGS VALKIRQVQPSDDGQYWCRFQEGDYWRETSVLLQVAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 PHE n 1 4 ARG n 1 5 VAL n 1 6 VAL n 1 7 GLY n 1 8 PRO n 1 9 ASN n 1 10 LEU n 1 11 PRO n 1 12 ILE n 1 13 LEU n 1 14 ALA n 1 15 LYS n 1 16 VAL n 1 17 GLY n 1 18 GLU n 1 19 ASP n 1 20 ALA n 1 21 LEU n 1 22 LEU n 1 23 THR n 1 24 CYS n 1 25 GLN n 1 26 LEU n 1 27 LEU n 1 28 PRO n 1 29 LYS n 1 30 ARG n 1 31 THR n 1 32 THR n 1 33 ALA n 1 34 HIS n 1 35 MET n 1 36 GLU n 1 37 VAL n 1 38 ARG n 1 39 TRP n 1 40 TYR n 1 41 ARG n 1 42 SER n 1 43 ASP n 1 44 PRO n 1 45 ASP n 1 46 MET n 1 47 PRO n 1 48 VAL n 1 49 ILE n 1 50 MET n 1 51 TYR n 1 52 ARG n 1 53 ASP n 1 54 GLY n 1 55 ALA n 1 56 GLU n 1 57 VAL n 1 58 THR n 1 59 GLY n 1 60 LEU n 1 61 PRO n 1 62 MET n 1 63 GLU n 1 64 GLY n 1 65 TYR n 1 66 GLY n 1 67 GLY n 1 68 ARG n 1 69 ALA n 1 70 GLU n 1 71 TRP n 1 72 MET n 1 73 GLU n 1 74 ASP n 1 75 SER n 1 76 THR n 1 77 GLU n 1 78 GLU n 1 79 GLY n 1 80 SER n 1 81 VAL n 1 82 ALA n 1 83 LEU n 1 84 LYS n 1 85 ILE n 1 86 ARG n 1 87 GLN n 1 88 VAL n 1 89 GLN n 1 90 PRO n 1 91 SER n 1 92 ASP n 1 93 ASP n 1 94 GLY n 1 95 GLN n 1 96 TYR n 1 97 TRP n 1 98 CYS n 1 99 ARG n 1 100 PHE n 1 101 GLN n 1 102 GLU n 1 103 GLY n 1 104 ASP n 1 105 TYR n 1 106 TRP n 1 107 ARG n 1 108 GLU n 1 109 THR n 1 110 SER n 1 111 VAL n 1 112 LEU n 1 113 LEU n 1 114 GLN n 1 115 VAL n 1 116 ALA n 1 117 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 117 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Btnl2, Gm315, Ng9' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BTNL2_MOUSE _struct_ref.pdbx_db_accession O70355 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DFRVVGPNLPILAKVGEDALLTCQLLPKRTTAHMEVRWYRSDPDMPVIMYRDGAEVTGLPMEGYGGRAEWMEDSTEEGSV ALKIRQVQPSDDGQYWCRFQEGDYWRETSVLLQVAA ; _struct_ref.pdbx_align_begin 28 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6L7Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 117 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O70355 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 143 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 117 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6L7Z _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O70355 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 2 2 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 2 2 '3D CBCA(CO)NH' 1 isotropic 4 2 2 '3D HNCACB' 1 isotropic 5 2 2 '3D HNCO' 1 isotropic 6 2 2 '3D HCCH-TOCSY' 1 isotropic 7 2 2 '3D HBHA(CO)NH' 1 isotropic 8 1 1 '2D 1H-1H NOESY' 1 isotropic 9 1 1 '3D 1H-15N NOESY' 1 isotropic 10 1 1 '3D 1H-15N TOCSY' 1 isotropic 11 2 2 '3D 1H-13C NOESY' 1 isotropic 12 2 2 '3D HN(CA)CO' 1 isotropic # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 atm 1 6.5 90 ? ? mM conditions_1 ? pH ? ? K 2 298 atm 1 6.5 90 ? ? mM conditions_2 ? pH ? ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.6 mM [U-99% 15N] BTNL2, 20 mM sodium phosphate, 50 mM sodium chloride, 93% H2O/7% D2O' '93% H2O/7% D2O' 15N_sample solution ? 2 '0.4 mM [U-99% 13C; U-99% 15N] BTNL2, 20 mM sodium phosphate, 50 mM sodium chloride, 93% H2O/7% D2O' '93% H2O/7% D2O' 15N_13C_sample solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details 'Cryoprobe equipped' # _pdbx_nmr_refine.entry_id 6L7Z _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # _pdbx_nmr_ensemble.entry_id 6L7Z _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6L7Z _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 'data analysis' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' 3 'structure calculation' PONDEROSA-C/S ? 'Lee W, Petit CM, Cornilescu G, Stark JL, Markley JL' 4 refinement PONDEROSA-C/S ? 'Lee W, Petit CM, Cornilescu G, Stark JL, Markley JL' 5 refinement PyMOL ? 'The PyMOL Molecular Graphics System, Version 2.0 Schrodinger, LLC.' 6 refinement NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' 7 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6L7Z _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6L7Z _struct.title 'Solution NMR structure of the N-terminal immunoglobulin variable domain of BTNL2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6L7Z _struct_keywords.text 'Immunoglobulin fold, T cell co-inhibitory molecule, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 63 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 68 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 63 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 68 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 24 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 98 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 24 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 98 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.028 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 5 ? VAL A 6 ? VAL A 5 VAL A 6 AA1 2 ALA A 20 ? LEU A 26 ? ALA A 20 LEU A 26 AA1 3 SER A 80 ? ILE A 85 ? SER A 80 ILE A 85 AA1 4 ALA A 69 ? TRP A 71 ? ALA A 69 TRP A 71 AA2 1 ALA A 55 ? GLU A 56 ? ALA A 55 GLU A 56 AA2 2 ILE A 49 ? ARG A 52 ? ILE A 49 ARG A 52 AA2 3 GLU A 36 ? TRP A 39 ? GLU A 36 TRP A 39 AA2 4 GLY A 94 ? GLU A 102 ? GLY A 94 GLU A 102 AA2 5 TYR A 105 ? LEU A 113 ? TYR A 105 LEU A 113 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 6 ? N VAL A 6 O GLN A 25 ? O GLN A 25 AA1 2 3 N LEU A 22 ? N LEU A 22 O LEU A 83 ? O LEU A 83 AA1 3 4 O LYS A 84 ? O LYS A 84 N GLU A 70 ? N GLU A 70 AA2 1 2 O ALA A 55 ? O ALA A 55 N ARG A 52 ? N ARG A 52 AA2 2 3 O TYR A 51 ? O TYR A 51 N VAL A 37 ? N VAL A 37 AA2 3 4 N GLU A 36 ? N GLU A 36 O GLN A 101 ? O GLN A 101 AA2 4 5 N CYS A 98 ? N CYS A 98 O THR A 109 ? O THR A 109 # _atom_sites.entry_id 6L7Z _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 TRP 71 71 71 TRP TRP A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 TRP 97 97 97 TRP TRP A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 TRP 106 106 106 TRP TRP A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ALA 117 117 117 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-10-14 2 'Structure model' 1 1 2020-11-18 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 BTNL2 0.6 ? mM '[U-99% 15N]' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 50 ? mM 'natural abundance' 2 BTNL2 0.4 ? mM '[U-99% 13C; U-99% 15N]' 2 'sodium phosphate' 20 ? mM 'natural abundance' 2 'sodium chloride' 50 ? mM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 30 ? ? 178.28 128.82 2 1 THR A 31 ? ? 58.54 119.60 3 1 SER A 42 ? ? 49.45 18.92 4 1 GLU A 78 ? ? -108.39 48.61 5 1 GLN A 87 ? ? 52.63 73.31 6 2 ASP A 2 ? ? 62.70 142.37 7 2 ARG A 30 ? ? 179.70 127.85 8 2 THR A 31 ? ? 59.49 138.91 9 2 THR A 32 ? ? -89.00 31.37 10 2 SER A 42 ? ? 56.33 16.67 11 2 GLU A 78 ? ? -106.20 50.56 12 3 PRO A 8 ? ? -52.08 94.98 13 3 ARG A 30 ? ? 179.88 126.98 14 3 THR A 31 ? ? 55.28 157.10 15 3 ARG A 41 ? ? -110.42 78.65 16 3 SER A 42 ? ? 55.67 15.88 17 3 GLU A 63 ? ? -174.83 79.74 18 3 VAL A 88 ? ? -49.54 158.70 19 4 PRO A 8 ? ? -52.91 -8.29 20 4 ASN A 9 ? ? -35.28 153.03 21 4 THR A 31 ? ? 41.81 -165.01 22 4 SER A 42 ? ? 49.39 19.10 23 4 LEU A 60 ? ? 60.53 157.08 24 4 MET A 62 ? ? 66.55 81.02 25 4 GLU A 63 ? ? -50.04 92.81 26 5 ASP A 2 ? ? 62.67 -90.62 27 5 PRO A 28 ? ? -12.48 129.59 28 5 THR A 32 ? ? -91.23 39.13 29 6 ARG A 30 ? ? -173.04 128.80 30 6 THR A 31 ? ? 48.64 -171.56 31 6 SER A 42 ? ? 52.02 18.47 32 6 THR A 58 ? ? 50.19 94.59 33 6 LEU A 60 ? ? 57.14 137.56 34 6 GLU A 63 ? ? -43.86 109.87 35 6 GLU A 78 ? ? -88.09 35.24 36 7 ASP A 2 ? ? 67.69 -70.15 37 7 ARG A 30 ? ? -171.18 128.25 38 7 THR A 31 ? ? 47.20 -173.03 39 7 SER A 42 ? ? 54.01 17.25 40 7 LEU A 60 ? ? 58.60 164.06 41 7 GLU A 63 ? ? -56.92 94.10 42 7 GLU A 77 ? ? 47.93 28.07 43 7 GLU A 78 ? ? -112.46 72.24 44 8 PRO A 8 ? ? -46.10 101.35 45 8 GLU A 78 ? ? -101.15 54.28 46 9 THR A 31 ? ? -48.12 151.52 47 9 THR A 32 ? ? -88.63 36.31 48 9 ARG A 41 ? ? -117.21 78.56 49 9 THR A 58 ? ? 50.43 76.72 50 9 THR A 109 ? ? -143.52 -159.61 51 10 PRO A 8 ? ? -51.96 109.09 52 10 ARG A 30 ? ? -174.99 129.61 53 10 THR A 31 ? ? 42.62 -163.75 54 10 SER A 42 ? ? 50.56 16.69 55 10 MET A 62 ? ? -142.81 16.92 56 10 GLU A 77 ? ? 43.12 27.48 57 10 GLU A 78 ? ? -108.50 53.64 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Department of Science & Technology (DST, India)' India ECR/2016/000847 1 'Department of Science & Technology (DST, India)' India ECR/2016/000923 2 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #