data_6L8K # _entry.id 6L8K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6L8K pdb_00006l8k 10.2210/pdb6l8k/pdb WWPDB D_1300014304 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6L8K _pdbx_database_status.recvd_initial_deposition_date 2019-11-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Lingru, Z.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 524 _citation.language ? _citation.page_first 490 _citation.page_last 496 _citation.title 'Crystal structure of Arabidopsis terminal uridylyl transferase URT1.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2020.01.124 _citation.pdbx_database_id_PubMed 32008746 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhu, L.' 1 ? primary 'Hu, Q.' 2 ? primary 'Cheng, L.' 3 ? primary 'Jiang, Y.' 4 ? primary 'Lv, M.' 5 ? primary 'Liu, Y.' 6 ? primary 'Li, F.' 7 ? primary 'Shi, Y.' 8 ? primary 'Gong, Q.' 9 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 121.190 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6L8K _cell.details ? _cell.formula_units_Z ? _cell.length_a 122.766 _cell.length_a_esd ? _cell.length_b 64.928 _cell.length_b_esd ? _cell.length_c 66.371 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6L8K _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'UTP:RNA uridylyltransferase 1' 43406.594 1 2.7.7.52 ? ? ? 2 non-polymer syn ;URIDINE 5'-TRIPHOSPHATE ; 484.141 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGENLYFQGQRLLGQKARMVKMYMACRNDIHRYDATFIAIYKSLIPAEEELEKQRQLMAHLENLVAKEW PHAKLYLYGSCANSFGFPKSDIDVCLAIEGDDINKSEMLLKLAEILESDNLQNVQALTRARVPIVKLMDPVTGISCAICI NNVLAVVNTKLLRDYAQIDVRLRQLAFIVKHWAKSRRVNETYQGTLSSYAYVLMCIHFLQQRRPPILPCLQEMEPTYSVR VDNIRCTYFDNVDRLRNFGSNNRETIAELVWGFFNYWAYAHDYAYNVVSVRTGSILGKREKDWTRRVGNDRHLICIEDPF ETSHDLGRVVDKFSIRVLREEFERAARIMHQDPNPCAKLLEPYIPEDNNGQGHN ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGENLYFQGQRLLGQKARMVKMYMACRNDIHRYDATFIAIYKSLIPAEEELEKQRQLMAHLENLVAKEW PHAKLYLYGSCANSFGFPKSDIDVCLAIEGDDINKSEMLLKLAEILESDNLQNVQALTRARVPIVKLMDPVTGISCAICI NNVLAVVNTKLLRDYAQIDVRLRQLAFIVKHWAKSRRVNETYQGTLSSYAYVLMCIHFLQQRRPPILPCLQEMEPTYSVR VDNIRCTYFDNVDRLRNFGSNNRETIAELVWGFFNYWAYAHDYAYNVVSVRTGSILGKREKDWTRRVGNDRHLICIEDPF ETSHDLGRVVDKFSIRVLREEFERAARIMHQDPNPCAKLLEPYIPEDNNGQGHN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 GLU n 1 15 ASN n 1 16 LEU n 1 17 TYR n 1 18 PHE n 1 19 GLN n 1 20 GLY n 1 21 GLN n 1 22 ARG n 1 23 LEU n 1 24 LEU n 1 25 GLY n 1 26 GLN n 1 27 LYS n 1 28 ALA n 1 29 ARG n 1 30 MET n 1 31 VAL n 1 32 LYS n 1 33 MET n 1 34 TYR n 1 35 MET n 1 36 ALA n 1 37 CYS n 1 38 ARG n 1 39 ASN n 1 40 ASP n 1 41 ILE n 1 42 HIS n 1 43 ARG n 1 44 TYR n 1 45 ASP n 1 46 ALA n 1 47 THR n 1 48 PHE n 1 49 ILE n 1 50 ALA n 1 51 ILE n 1 52 TYR n 1 53 LYS n 1 54 SER n 1 55 LEU n 1 56 ILE n 1 57 PRO n 1 58 ALA n 1 59 GLU n 1 60 GLU n 1 61 GLU n 1 62 LEU n 1 63 GLU n 1 64 LYS n 1 65 GLN n 1 66 ARG n 1 67 GLN n 1 68 LEU n 1 69 MET n 1 70 ALA n 1 71 HIS n 1 72 LEU n 1 73 GLU n 1 74 ASN n 1 75 LEU n 1 76 VAL n 1 77 ALA n 1 78 LYS n 1 79 GLU n 1 80 TRP n 1 81 PRO n 1 82 HIS n 1 83 ALA n 1 84 LYS n 1 85 LEU n 1 86 TYR n 1 87 LEU n 1 88 TYR n 1 89 GLY n 1 90 SER n 1 91 CYS n 1 92 ALA n 1 93 ASN n 1 94 SER n 1 95 PHE n 1 96 GLY n 1 97 PHE n 1 98 PRO n 1 99 LYS n 1 100 SER n 1 101 ASP n 1 102 ILE n 1 103 ASP n 1 104 VAL n 1 105 CYS n 1 106 LEU n 1 107 ALA n 1 108 ILE n 1 109 GLU n 1 110 GLY n 1 111 ASP n 1 112 ASP n 1 113 ILE n 1 114 ASN n 1 115 LYS n 1 116 SER n 1 117 GLU n 1 118 MET n 1 119 LEU n 1 120 LEU n 1 121 LYS n 1 122 LEU n 1 123 ALA n 1 124 GLU n 1 125 ILE n 1 126 LEU n 1 127 GLU n 1 128 SER n 1 129 ASP n 1 130 ASN n 1 131 LEU n 1 132 GLN n 1 133 ASN n 1 134 VAL n 1 135 GLN n 1 136 ALA n 1 137 LEU n 1 138 THR n 1 139 ARG n 1 140 ALA n 1 141 ARG n 1 142 VAL n 1 143 PRO n 1 144 ILE n 1 145 VAL n 1 146 LYS n 1 147 LEU n 1 148 MET n 1 149 ASP n 1 150 PRO n 1 151 VAL n 1 152 THR n 1 153 GLY n 1 154 ILE n 1 155 SER n 1 156 CYS n 1 157 ALA n 1 158 ILE n 1 159 CYS n 1 160 ILE n 1 161 ASN n 1 162 ASN n 1 163 VAL n 1 164 LEU n 1 165 ALA n 1 166 VAL n 1 167 VAL n 1 168 ASN n 1 169 THR n 1 170 LYS n 1 171 LEU n 1 172 LEU n 1 173 ARG n 1 174 ASP n 1 175 TYR n 1 176 ALA n 1 177 GLN n 1 178 ILE n 1 179 ASP n 1 180 VAL n 1 181 ARG n 1 182 LEU n 1 183 ARG n 1 184 GLN n 1 185 LEU n 1 186 ALA n 1 187 PHE n 1 188 ILE n 1 189 VAL n 1 190 LYS n 1 191 HIS n 1 192 TRP n 1 193 ALA n 1 194 LYS n 1 195 SER n 1 196 ARG n 1 197 ARG n 1 198 VAL n 1 199 ASN n 1 200 GLU n 1 201 THR n 1 202 TYR n 1 203 GLN n 1 204 GLY n 1 205 THR n 1 206 LEU n 1 207 SER n 1 208 SER n 1 209 TYR n 1 210 ALA n 1 211 TYR n 1 212 VAL n 1 213 LEU n 1 214 MET n 1 215 CYS n 1 216 ILE n 1 217 HIS n 1 218 PHE n 1 219 LEU n 1 220 GLN n 1 221 GLN n 1 222 ARG n 1 223 ARG n 1 224 PRO n 1 225 PRO n 1 226 ILE n 1 227 LEU n 1 228 PRO n 1 229 CYS n 1 230 LEU n 1 231 GLN n 1 232 GLU n 1 233 MET n 1 234 GLU n 1 235 PRO n 1 236 THR n 1 237 TYR n 1 238 SER n 1 239 VAL n 1 240 ARG n 1 241 VAL n 1 242 ASP n 1 243 ASN n 1 244 ILE n 1 245 ARG n 1 246 CYS n 1 247 THR n 1 248 TYR n 1 249 PHE n 1 250 ASP n 1 251 ASN n 1 252 VAL n 1 253 ASP n 1 254 ARG n 1 255 LEU n 1 256 ARG n 1 257 ASN n 1 258 PHE n 1 259 GLY n 1 260 SER n 1 261 ASN n 1 262 ASN n 1 263 ARG n 1 264 GLU n 1 265 THR n 1 266 ILE n 1 267 ALA n 1 268 GLU n 1 269 LEU n 1 270 VAL n 1 271 TRP n 1 272 GLY n 1 273 PHE n 1 274 PHE n 1 275 ASN n 1 276 TYR n 1 277 TRP n 1 278 ALA n 1 279 TYR n 1 280 ALA n 1 281 HIS n 1 282 ASP n 1 283 TYR n 1 284 ALA n 1 285 TYR n 1 286 ASN n 1 287 VAL n 1 288 VAL n 1 289 SER n 1 290 VAL n 1 291 ARG n 1 292 THR n 1 293 GLY n 1 294 SER n 1 295 ILE n 1 296 LEU n 1 297 GLY n 1 298 LYS n 1 299 ARG n 1 300 GLU n 1 301 LYS n 1 302 ASP n 1 303 TRP n 1 304 THR n 1 305 ARG n 1 306 ARG n 1 307 VAL n 1 308 GLY n 1 309 ASN n 1 310 ASP n 1 311 ARG n 1 312 HIS n 1 313 LEU n 1 314 ILE n 1 315 CYS n 1 316 ILE n 1 317 GLU n 1 318 ASP n 1 319 PRO n 1 320 PHE n 1 321 GLU n 1 322 THR n 1 323 SER n 1 324 HIS n 1 325 ASP n 1 326 LEU n 1 327 GLY n 1 328 ARG n 1 329 VAL n 1 330 VAL n 1 331 ASP n 1 332 LYS n 1 333 PHE n 1 334 SER n 1 335 ILE n 1 336 ARG n 1 337 VAL n 1 338 LEU n 1 339 ARG n 1 340 GLU n 1 341 GLU n 1 342 PHE n 1 343 GLU n 1 344 ARG n 1 345 ALA n 1 346 ALA n 1 347 ARG n 1 348 ILE n 1 349 MET n 1 350 HIS n 1 351 GLN n 1 352 ASP n 1 353 PRO n 1 354 ASN n 1 355 PRO n 1 356 CYS n 1 357 ALA n 1 358 LYS n 1 359 LEU n 1 360 LEU n 1 361 GLU n 1 362 PRO n 1 363 TYR n 1 364 ILE n 1 365 PRO n 1 366 GLU n 1 367 ASP n 1 368 ASN n 1 369 ASN n 1 370 GLY n 1 371 GLN n 1 372 GLY n 1 373 HIS n 1 374 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 374 _entity_src_gen.gene_src_common_name 'Mouse-ear cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'URT1, At2g45620, F17K2.15' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code URT1_ARATH _struct_ref.pdbx_db_accession O64642 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GQRLLGQKARMVKMYMACRNDIHRYDATFIAIYKSLIPAEEELEKQRQLMAHLENLVAKEWPHAKLYLYGSCANSFGFPK SDIDVCLAIEGDDINKSEMLLKLAEILESDNLQNVQALTRARVPIVKLMDPVTGISCDICINNVLAVVNTKLLRDYAQID VRLRQLAFIVKHWAKSRRVNETYQGTLSSYAYVLMCIHFLQQRRPPILPCLQEMEPTYSVRVDNIRCTYFDNVDRLRNFG SNNRETIAELVWGFFNYWAYAHDYAYNVVSVRTGSILGKREKDWTRRVGNDRHLICIEDPFETSHDLGRVVDKFSIRVLR EEFERAARIMHQDPNPCAKLLEPYIPEDNNGQGHN ; _struct_ref.pdbx_align_begin 410 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6L8K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 20 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 374 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O64642 _struct_ref_seq.db_align_beg 410 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 764 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 410 _struct_ref_seq.pdbx_auth_seq_align_end 764 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6L8K MET A 1 ? UNP O64642 ? ? 'initiating methionine' 391 1 1 6L8K GLY A 2 ? UNP O64642 ? ? 'expression tag' 392 2 1 6L8K SER A 3 ? UNP O64642 ? ? 'expression tag' 393 3 1 6L8K SER A 4 ? UNP O64642 ? ? 'expression tag' 394 4 1 6L8K HIS A 5 ? UNP O64642 ? ? 'expression tag' 395 5 1 6L8K HIS A 6 ? UNP O64642 ? ? 'expression tag' 396 6 1 6L8K HIS A 7 ? UNP O64642 ? ? 'expression tag' 397 7 1 6L8K HIS A 8 ? UNP O64642 ? ? 'expression tag' 398 8 1 6L8K HIS A 9 ? UNP O64642 ? ? 'expression tag' 399 9 1 6L8K HIS A 10 ? UNP O64642 ? ? 'expression tag' 400 10 1 6L8K SER A 11 ? UNP O64642 ? ? 'expression tag' 401 11 1 6L8K SER A 12 ? UNP O64642 ? ? 'expression tag' 402 12 1 6L8K GLY A 13 ? UNP O64642 ? ? 'expression tag' 403 13 1 6L8K GLU A 14 ? UNP O64642 ? ? 'expression tag' 404 14 1 6L8K ASN A 15 ? UNP O64642 ? ? 'expression tag' 405 15 1 6L8K LEU A 16 ? UNP O64642 ? ? 'expression tag' 406 16 1 6L8K TYR A 17 ? UNP O64642 ? ? 'expression tag' 407 17 1 6L8K PHE A 18 ? UNP O64642 ? ? 'expression tag' 408 18 1 6L8K GLN A 19 ? UNP O64642 ? ? 'expression tag' 409 19 1 6L8K ALA A 157 ? UNP O64642 ASP 547 'engineered mutation' 547 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UTP non-polymer . ;URIDINE 5'-TRIPHOSPHATE ; ? 'C9 H15 N2 O15 P3' 484.141 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6L8K _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.61 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1M HEPES PH7.5, 10% PEG6000, 5% MPD ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-04-27 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 65.730 _reflns.entry_id 6L8K _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.999 _reflns.d_resolution_low 30.627 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8925 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.2 _reflns.pdbx_Rmerge_I_obs 0.106 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.857 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.999 _reflns_shell.d_res_low 3.4 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2924 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.499 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 112.390 _refine.B_iso_mean 61.8459 _refine.B_iso_min 27.940 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6L8K _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.9990 _refine.ls_d_res_low 30.6270 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8925 _refine.ls_number_reflns_R_free 430 _refine.ls_number_reflns_R_work 8495 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.2600 _refine.ls_percent_reflns_R_free 4.8200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1927 _refine.ls_R_factor_R_free 0.2396 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1904 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.400 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5w0n _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.8900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.9990 _refine_hist.d_res_low 30.6270 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2630 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 321 _refine_hist.pdbx_B_iso_mean_ligand 93.87 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2601 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 2687 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.540 ? 3650 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.043 ? 406 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 466 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.987 ? 1618 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.999 3.4323 . . 141 2783 98.0000 . . . 0.2977 0.0000 0.2483 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4323 4.3224 . . 144 2836 99.0000 . . . 0.2375 0.0000 0.1883 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3224 30.627 . . 145 2876 98.0000 . . . 0.2201 0.0000 0.1717 . . . . . . . . . . . # _struct.entry_id 6L8K _struct.title 'Structure of URT1 in complex with UTP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6L8K _struct_keywords.text 'Uridylyltransferase, Complex, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 40 ? ARG A 43 ? ASP A 430 ARG A 433 5 ? 4 HELX_P HELX_P2 AA2 TYR A 44 ? ILE A 56 ? TYR A 434 ILE A 446 1 ? 13 HELX_P HELX_P3 AA3 ALA A 58 ? TRP A 80 ? ALA A 448 TRP A 470 1 ? 23 HELX_P HELX_P4 AA4 ASN A 114 ? SER A 128 ? ASN A 504 SER A 518 1 ? 15 HELX_P HELX_P5 AA5 ASN A 162 ? GLN A 177 ? ASN A 552 GLN A 567 1 ? 16 HELX_P HELX_P6 AA6 ASP A 179 ? ARG A 196 ? ASP A 569 ARG A 586 1 ? 18 HELX_P HELX_P7 AA7 GLU A 200 ? GLY A 204 ? GLU A 590 GLY A 594 5 ? 5 HELX_P HELX_P8 AA8 SER A 207 ? ARG A 222 ? SER A 597 ARG A 612 1 ? 16 HELX_P HELX_P9 AA9 CYS A 229 ? MET A 233 ? CYS A 619 MET A 623 5 ? 5 HELX_P HELX_P10 AB1 ASN A 251 ? ARG A 256 ? ASN A 641 ARG A 646 5 ? 6 HELX_P HELX_P11 AB2 ASN A 257 ? ASN A 262 ? ASN A 647 ASN A 652 5 ? 6 HELX_P HELX_P12 AB3 THR A 265 ? ALA A 280 ? THR A 655 ALA A 670 1 ? 16 HELX_P HELX_P13 AB4 PHE A 333 ? ASP A 352 ? PHE A 723 ASP A 742 1 ? 20 HELX_P HELX_P14 AB5 ASN A 354 ? LEU A 359 ? ASN A 744 LEU A 749 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 223 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 613 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 224 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 614 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.84 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 84 ? TYR A 88 ? LYS A 474 TYR A 478 AA1 2 ASP A 101 ? ALA A 107 ? ASP A 491 ALA A 497 AA1 3 SER A 155 ? ILE A 160 ? SER A 545 ILE A 550 AA1 4 VAL A 142 ? MET A 148 ? VAL A 532 MET A 538 AA1 5 GLN A 132 ? ARG A 139 ? GLN A 522 ARG A 529 AA2 1 TYR A 237 ? ARG A 240 ? TYR A 627 ARG A 630 AA2 2 ARG A 245 ? TYR A 248 ? ARG A 635 TYR A 638 AA3 1 SER A 294 ? GLY A 297 ? SER A 684 GLY A 687 AA3 2 ASN A 286 ? SER A 289 ? ASN A 676 SER A 679 AA3 3 CYS A 315 ? GLU A 317 ? CYS A 705 GLU A 707 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 86 ? N TYR A 476 O CYS A 105 ? O CYS A 495 AA1 2 3 N LEU A 106 ? N LEU A 496 O CYS A 159 ? O CYS A 549 AA1 3 4 O ILE A 158 ? O ILE A 548 N VAL A 145 ? N VAL A 535 AA1 4 5 O ILE A 144 ? O ILE A 534 N LEU A 137 ? N LEU A 527 AA2 1 2 N VAL A 239 ? N VAL A 629 O CYS A 246 ? O CYS A 636 AA3 1 2 O LEU A 296 ? O LEU A 686 N VAL A 287 ? N VAL A 677 AA3 2 3 N VAL A 288 ? N VAL A 678 O CYS A 315 ? O CYS A 705 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id UTP _struct_site.pdbx_auth_seq_id 801 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 13 _struct_site.details 'binding site for residue UTP A 801' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 GLY A 89 ? GLY A 479 . ? 1_555 ? 2 AC1 13 SER A 90 ? SER A 480 . ? 1_555 ? 3 AC1 13 ASN A 93 ? ASN A 483 . ? 1_555 ? 4 AC1 13 ALA A 165 ? ALA A 555 . ? 1_555 ? 5 AC1 13 ASN A 168 ? ASN A 558 . ? 1_555 ? 6 AC1 13 THR A 169 ? THR A 559 . ? 1_555 ? 7 AC1 13 LYS A 190 ? LYS A 580 . ? 1_555 ? 8 AC1 13 LYS A 194 ? LYS A 584 . ? 1_555 ? 9 AC1 13 SER A 207 ? SER A 597 . ? 1_555 ? 10 AC1 13 SER A 208 ? SER A 598 . ? 1_555 ? 11 AC1 13 TYR A 209 ? TYR A 599 . ? 1_555 ? 12 AC1 13 HIS A 324 ? HIS A 714 . ? 1_555 ? 13 AC1 13 LEU A 326 ? LEU A 716 . ? 1_555 ? # _atom_sites.entry_id 6L8K _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008146 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004931 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015402 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017612 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 391 ? ? ? A . n A 1 2 GLY 2 392 ? ? ? A . n A 1 3 SER 3 393 ? ? ? A . n A 1 4 SER 4 394 ? ? ? A . n A 1 5 HIS 5 395 ? ? ? A . n A 1 6 HIS 6 396 ? ? ? A . n A 1 7 HIS 7 397 ? ? ? A . n A 1 8 HIS 8 398 ? ? ? A . n A 1 9 HIS 9 399 ? ? ? A . n A 1 10 HIS 10 400 ? ? ? A . n A 1 11 SER 11 401 ? ? ? A . n A 1 12 SER 12 402 ? ? ? A . n A 1 13 GLY 13 403 ? ? ? A . n A 1 14 GLU 14 404 ? ? ? A . n A 1 15 ASN 15 405 ? ? ? A . n A 1 16 LEU 16 406 ? ? ? A . n A 1 17 TYR 17 407 ? ? ? A . n A 1 18 PHE 18 408 ? ? ? A . n A 1 19 GLN 19 409 ? ? ? A . n A 1 20 GLY 20 410 ? ? ? A . n A 1 21 GLN 21 411 ? ? ? A . n A 1 22 ARG 22 412 ? ? ? A . n A 1 23 LEU 23 413 ? ? ? A . n A 1 24 LEU 24 414 ? ? ? A . n A 1 25 GLY 25 415 ? ? ? A . n A 1 26 GLN 26 416 ? ? ? A . n A 1 27 LYS 27 417 ? ? ? A . n A 1 28 ALA 28 418 ? ? ? A . n A 1 29 ARG 29 419 ? ? ? A . n A 1 30 MET 30 420 ? ? ? A . n A 1 31 VAL 31 421 ? ? ? A . n A 1 32 LYS 32 422 ? ? ? A . n A 1 33 MET 33 423 ? ? ? A . n A 1 34 TYR 34 424 ? ? ? A . n A 1 35 MET 35 425 ? ? ? A . n A 1 36 ALA 36 426 426 ALA ALA A . n A 1 37 CYS 37 427 427 CYS CYS A . n A 1 38 ARG 38 428 428 ARG ARG A . n A 1 39 ASN 39 429 429 ASN ASN A . n A 1 40 ASP 40 430 430 ASP ASP A . n A 1 41 ILE 41 431 431 ILE ILE A . n A 1 42 HIS 42 432 432 HIS HIS A . n A 1 43 ARG 43 433 433 ARG ARG A . n A 1 44 TYR 44 434 434 TYR TYR A . n A 1 45 ASP 45 435 435 ASP ASP A . n A 1 46 ALA 46 436 436 ALA ALA A . n A 1 47 THR 47 437 437 THR THR A . n A 1 48 PHE 48 438 438 PHE PHE A . n A 1 49 ILE 49 439 439 ILE ILE A . n A 1 50 ALA 50 440 440 ALA ALA A . n A 1 51 ILE 51 441 441 ILE ILE A . n A 1 52 TYR 52 442 442 TYR TYR A . n A 1 53 LYS 53 443 443 LYS LYS A . n A 1 54 SER 54 444 444 SER SER A . n A 1 55 LEU 55 445 445 LEU LEU A . n A 1 56 ILE 56 446 446 ILE ILE A . n A 1 57 PRO 57 447 447 PRO PRO A . n A 1 58 ALA 58 448 448 ALA ALA A . n A 1 59 GLU 59 449 449 GLU GLU A . n A 1 60 GLU 60 450 450 GLU GLU A . n A 1 61 GLU 61 451 451 GLU GLU A . n A 1 62 LEU 62 452 452 LEU LEU A . n A 1 63 GLU 63 453 453 GLU GLU A . n A 1 64 LYS 64 454 454 LYS LYS A . n A 1 65 GLN 65 455 455 GLN GLN A . n A 1 66 ARG 66 456 456 ARG ARG A . n A 1 67 GLN 67 457 457 GLN GLN A . n A 1 68 LEU 68 458 458 LEU LEU A . n A 1 69 MET 69 459 459 MET MET A . n A 1 70 ALA 70 460 460 ALA ALA A . n A 1 71 HIS 71 461 461 HIS HIS A . n A 1 72 LEU 72 462 462 LEU LEU A . n A 1 73 GLU 73 463 463 GLU GLU A . n A 1 74 ASN 74 464 464 ASN ASN A . n A 1 75 LEU 75 465 465 LEU LEU A . n A 1 76 VAL 76 466 466 VAL VAL A . n A 1 77 ALA 77 467 467 ALA ALA A . n A 1 78 LYS 78 468 468 LYS LYS A . n A 1 79 GLU 79 469 469 GLU GLU A . n A 1 80 TRP 80 470 470 TRP TRP A . n A 1 81 PRO 81 471 471 PRO PRO A . n A 1 82 HIS 82 472 472 HIS HIS A . n A 1 83 ALA 83 473 473 ALA ALA A . n A 1 84 LYS 84 474 474 LYS LYS A . n A 1 85 LEU 85 475 475 LEU LEU A . n A 1 86 TYR 86 476 476 TYR TYR A . n A 1 87 LEU 87 477 477 LEU LEU A . n A 1 88 TYR 88 478 478 TYR TYR A . n A 1 89 GLY 89 479 479 GLY GLY A . n A 1 90 SER 90 480 480 SER SER A . n A 1 91 CYS 91 481 481 CYS CYS A . n A 1 92 ALA 92 482 482 ALA ALA A . n A 1 93 ASN 93 483 483 ASN ASN A . n A 1 94 SER 94 484 484 SER SER A . n A 1 95 PHE 95 485 485 PHE PHE A . n A 1 96 GLY 96 486 486 GLY GLY A . n A 1 97 PHE 97 487 487 PHE PHE A . n A 1 98 PRO 98 488 488 PRO PRO A . n A 1 99 LYS 99 489 489 LYS LYS A . n A 1 100 SER 100 490 490 SER SER A . n A 1 101 ASP 101 491 491 ASP ASP A . n A 1 102 ILE 102 492 492 ILE ILE A . n A 1 103 ASP 103 493 493 ASP ASP A . n A 1 104 VAL 104 494 494 VAL VAL A . n A 1 105 CYS 105 495 495 CYS CYS A . n A 1 106 LEU 106 496 496 LEU LEU A . n A 1 107 ALA 107 497 497 ALA ALA A . n A 1 108 ILE 108 498 498 ILE ILE A . n A 1 109 GLU 109 499 499 GLU GLU A . n A 1 110 GLY 110 500 500 GLY GLY A . n A 1 111 ASP 111 501 501 ASP ASP A . n A 1 112 ASP 112 502 502 ASP ASP A . n A 1 113 ILE 113 503 503 ILE ILE A . n A 1 114 ASN 114 504 504 ASN ASN A . n A 1 115 LYS 115 505 505 LYS LYS A . n A 1 116 SER 116 506 506 SER SER A . n A 1 117 GLU 117 507 507 GLU GLU A . n A 1 118 MET 118 508 508 MET MET A . n A 1 119 LEU 119 509 509 LEU LEU A . n A 1 120 LEU 120 510 510 LEU LEU A . n A 1 121 LYS 121 511 511 LYS LYS A . n A 1 122 LEU 122 512 512 LEU LEU A . n A 1 123 ALA 123 513 513 ALA ALA A . n A 1 124 GLU 124 514 514 GLU GLU A . n A 1 125 ILE 125 515 515 ILE ILE A . n A 1 126 LEU 126 516 516 LEU LEU A . n A 1 127 GLU 127 517 517 GLU GLU A . n A 1 128 SER 128 518 518 SER SER A . n A 1 129 ASP 129 519 519 ASP ASP A . n A 1 130 ASN 130 520 520 ASN ASN A . n A 1 131 LEU 131 521 521 LEU LEU A . n A 1 132 GLN 132 522 522 GLN GLN A . n A 1 133 ASN 133 523 523 ASN ASN A . n A 1 134 VAL 134 524 524 VAL VAL A . n A 1 135 GLN 135 525 525 GLN GLN A . n A 1 136 ALA 136 526 526 ALA ALA A . n A 1 137 LEU 137 527 527 LEU LEU A . n A 1 138 THR 138 528 528 THR THR A . n A 1 139 ARG 139 529 529 ARG ARG A . n A 1 140 ALA 140 530 530 ALA ALA A . n A 1 141 ARG 141 531 531 ARG ARG A . n A 1 142 VAL 142 532 532 VAL VAL A . n A 1 143 PRO 143 533 533 PRO PRO A . n A 1 144 ILE 144 534 534 ILE ILE A . n A 1 145 VAL 145 535 535 VAL VAL A . n A 1 146 LYS 146 536 536 LYS LYS A . n A 1 147 LEU 147 537 537 LEU LEU A . n A 1 148 MET 148 538 538 MET MET A . n A 1 149 ASP 149 539 539 ASP ASP A . n A 1 150 PRO 150 540 540 PRO PRO A . n A 1 151 VAL 151 541 541 VAL VAL A . n A 1 152 THR 152 542 542 THR THR A . n A 1 153 GLY 153 543 543 GLY GLY A . n A 1 154 ILE 154 544 544 ILE ILE A . n A 1 155 SER 155 545 545 SER SER A . n A 1 156 CYS 156 546 546 CYS CYS A . n A 1 157 ALA 157 547 547 ALA ALA A . n A 1 158 ILE 158 548 548 ILE ILE A . n A 1 159 CYS 159 549 549 CYS CYS A . n A 1 160 ILE 160 550 550 ILE ILE A . n A 1 161 ASN 161 551 551 ASN ASN A . n A 1 162 ASN 162 552 552 ASN ASN A . n A 1 163 VAL 163 553 553 VAL VAL A . n A 1 164 LEU 164 554 554 LEU LEU A . n A 1 165 ALA 165 555 555 ALA ALA A . n A 1 166 VAL 166 556 556 VAL VAL A . n A 1 167 VAL 167 557 557 VAL VAL A . n A 1 168 ASN 168 558 558 ASN ASN A . n A 1 169 THR 169 559 559 THR THR A . n A 1 170 LYS 170 560 560 LYS LYS A . n A 1 171 LEU 171 561 561 LEU LEU A . n A 1 172 LEU 172 562 562 LEU LEU A . n A 1 173 ARG 173 563 563 ARG ARG A . n A 1 174 ASP 174 564 564 ASP ASP A . n A 1 175 TYR 175 565 565 TYR TYR A . n A 1 176 ALA 176 566 566 ALA ALA A . n A 1 177 GLN 177 567 567 GLN GLN A . n A 1 178 ILE 178 568 568 ILE ILE A . n A 1 179 ASP 179 569 569 ASP ASP A . n A 1 180 VAL 180 570 570 VAL VAL A . n A 1 181 ARG 181 571 571 ARG ARG A . n A 1 182 LEU 182 572 572 LEU LEU A . n A 1 183 ARG 183 573 573 ARG ARG A . n A 1 184 GLN 184 574 574 GLN GLN A . n A 1 185 LEU 185 575 575 LEU LEU A . n A 1 186 ALA 186 576 576 ALA ALA A . n A 1 187 PHE 187 577 577 PHE PHE A . n A 1 188 ILE 188 578 578 ILE ILE A . n A 1 189 VAL 189 579 579 VAL VAL A . n A 1 190 LYS 190 580 580 LYS LYS A . n A 1 191 HIS 191 581 581 HIS HIS A . n A 1 192 TRP 192 582 582 TRP TRP A . n A 1 193 ALA 193 583 583 ALA ALA A . n A 1 194 LYS 194 584 584 LYS LYS A . n A 1 195 SER 195 585 585 SER SER A . n A 1 196 ARG 196 586 586 ARG ARG A . n A 1 197 ARG 197 587 587 ARG ARG A . n A 1 198 VAL 198 588 588 VAL VAL A . n A 1 199 ASN 199 589 589 ASN ASN A . n A 1 200 GLU 200 590 590 GLU GLU A . n A 1 201 THR 201 591 591 THR THR A . n A 1 202 TYR 202 592 592 TYR TYR A . n A 1 203 GLN 203 593 593 GLN GLN A . n A 1 204 GLY 204 594 594 GLY GLY A . n A 1 205 THR 205 595 595 THR THR A . n A 1 206 LEU 206 596 596 LEU LEU A . n A 1 207 SER 207 597 597 SER SER A . n A 1 208 SER 208 598 598 SER SER A . n A 1 209 TYR 209 599 599 TYR TYR A . n A 1 210 ALA 210 600 600 ALA ALA A . n A 1 211 TYR 211 601 601 TYR TYR A . n A 1 212 VAL 212 602 602 VAL VAL A . n A 1 213 LEU 213 603 603 LEU LEU A . n A 1 214 MET 214 604 604 MET MET A . n A 1 215 CYS 215 605 605 CYS CYS A . n A 1 216 ILE 216 606 606 ILE ILE A . n A 1 217 HIS 217 607 607 HIS HIS A . n A 1 218 PHE 218 608 608 PHE PHE A . n A 1 219 LEU 219 609 609 LEU LEU A . n A 1 220 GLN 220 610 610 GLN GLN A . n A 1 221 GLN 221 611 611 GLN GLN A . n A 1 222 ARG 222 612 612 ARG ARG A . n A 1 223 ARG 223 613 613 ARG ARG A . n A 1 224 PRO 224 614 614 PRO PRO A . n A 1 225 PRO 225 615 615 PRO PRO A . n A 1 226 ILE 226 616 616 ILE ILE A . n A 1 227 LEU 227 617 617 LEU LEU A . n A 1 228 PRO 228 618 618 PRO PRO A . n A 1 229 CYS 229 619 619 CYS CYS A . n A 1 230 LEU 230 620 620 LEU LEU A . n A 1 231 GLN 231 621 621 GLN GLN A . n A 1 232 GLU 232 622 622 GLU GLU A . n A 1 233 MET 233 623 623 MET MET A . n A 1 234 GLU 234 624 624 GLU GLU A . n A 1 235 PRO 235 625 625 PRO PRO A . n A 1 236 THR 236 626 626 THR THR A . n A 1 237 TYR 237 627 627 TYR TYR A . n A 1 238 SER 238 628 628 SER SER A . n A 1 239 VAL 239 629 629 VAL VAL A . n A 1 240 ARG 240 630 630 ARG ARG A . n A 1 241 VAL 241 631 631 VAL VAL A . n A 1 242 ASP 242 632 632 ASP ASP A . n A 1 243 ASN 243 633 633 ASN ASN A . n A 1 244 ILE 244 634 634 ILE ILE A . n A 1 245 ARG 245 635 635 ARG ARG A . n A 1 246 CYS 246 636 636 CYS CYS A . n A 1 247 THR 247 637 637 THR THR A . n A 1 248 TYR 248 638 638 TYR TYR A . n A 1 249 PHE 249 639 639 PHE PHE A . n A 1 250 ASP 250 640 640 ASP ASP A . n A 1 251 ASN 251 641 641 ASN ASN A . n A 1 252 VAL 252 642 642 VAL VAL A . n A 1 253 ASP 253 643 643 ASP ASP A . n A 1 254 ARG 254 644 644 ARG ARG A . n A 1 255 LEU 255 645 645 LEU LEU A . n A 1 256 ARG 256 646 646 ARG ARG A . n A 1 257 ASN 257 647 647 ASN ASN A . n A 1 258 PHE 258 648 648 PHE PHE A . n A 1 259 GLY 259 649 649 GLY GLY A . n A 1 260 SER 260 650 650 SER SER A . n A 1 261 ASN 261 651 651 ASN ASN A . n A 1 262 ASN 262 652 652 ASN ASN A . n A 1 263 ARG 263 653 653 ARG ARG A . n A 1 264 GLU 264 654 654 GLU GLU A . n A 1 265 THR 265 655 655 THR THR A . n A 1 266 ILE 266 656 656 ILE ILE A . n A 1 267 ALA 267 657 657 ALA ALA A . n A 1 268 GLU 268 658 658 GLU GLU A . n A 1 269 LEU 269 659 659 LEU LEU A . n A 1 270 VAL 270 660 660 VAL VAL A . n A 1 271 TRP 271 661 661 TRP TRP A . n A 1 272 GLY 272 662 662 GLY GLY A . n A 1 273 PHE 273 663 663 PHE PHE A . n A 1 274 PHE 274 664 664 PHE PHE A . n A 1 275 ASN 275 665 665 ASN ASN A . n A 1 276 TYR 276 666 666 TYR TYR A . n A 1 277 TRP 277 667 667 TRP TRP A . n A 1 278 ALA 278 668 668 ALA ALA A . n A 1 279 TYR 279 669 669 TYR TYR A . n A 1 280 ALA 280 670 670 ALA ALA A . n A 1 281 HIS 281 671 671 HIS HIS A . n A 1 282 ASP 282 672 672 ASP ASP A . n A 1 283 TYR 283 673 673 TYR TYR A . n A 1 284 ALA 284 674 674 ALA ALA A . n A 1 285 TYR 285 675 675 TYR TYR A . n A 1 286 ASN 286 676 676 ASN ASN A . n A 1 287 VAL 287 677 677 VAL VAL A . n A 1 288 VAL 288 678 678 VAL VAL A . n A 1 289 SER 289 679 679 SER SER A . n A 1 290 VAL 290 680 680 VAL VAL A . n A 1 291 ARG 291 681 681 ARG ARG A . n A 1 292 THR 292 682 682 THR THR A . n A 1 293 GLY 293 683 683 GLY GLY A . n A 1 294 SER 294 684 684 SER SER A . n A 1 295 ILE 295 685 685 ILE ILE A . n A 1 296 LEU 296 686 686 LEU LEU A . n A 1 297 GLY 297 687 687 GLY GLY A . n A 1 298 LYS 298 688 688 LYS LYS A . n A 1 299 ARG 299 689 689 ARG ARG A . n A 1 300 GLU 300 690 690 GLU GLU A . n A 1 301 LYS 301 691 691 LYS LYS A . n A 1 302 ASP 302 692 ? ? ? A . n A 1 303 TRP 303 693 ? ? ? A . n A 1 304 THR 304 694 ? ? ? A . n A 1 305 ARG 305 695 ? ? ? A . n A 1 306 ARG 306 696 ? ? ? A . n A 1 307 VAL 307 697 ? ? ? A . n A 1 308 GLY 308 698 ? ? ? A . n A 1 309 ASN 309 699 ? ? ? A . n A 1 310 ASP 310 700 ? ? ? A . n A 1 311 ARG 311 701 701 ARG ARG A . n A 1 312 HIS 312 702 702 HIS HIS A . n A 1 313 LEU 313 703 703 LEU LEU A . n A 1 314 ILE 314 704 704 ILE ILE A . n A 1 315 CYS 315 705 705 CYS CYS A . n A 1 316 ILE 316 706 706 ILE ILE A . n A 1 317 GLU 317 707 707 GLU GLU A . n A 1 318 ASP 318 708 708 ASP ASP A . n A 1 319 PRO 319 709 709 PRO PRO A . n A 1 320 PHE 320 710 710 PHE PHE A . n A 1 321 GLU 321 711 711 GLU GLU A . n A 1 322 THR 322 712 712 THR THR A . n A 1 323 SER 323 713 713 SER SER A . n A 1 324 HIS 324 714 714 HIS HIS A . n A 1 325 ASP 325 715 715 ASP ASP A . n A 1 326 LEU 326 716 716 LEU LEU A . n A 1 327 GLY 327 717 717 GLY GLY A . n A 1 328 ARG 328 718 718 ARG ARG A . n A 1 329 VAL 329 719 719 VAL VAL A . n A 1 330 VAL 330 720 720 VAL VAL A . n A 1 331 ASP 331 721 721 ASP ASP A . n A 1 332 LYS 332 722 722 LYS LYS A . n A 1 333 PHE 333 723 723 PHE PHE A . n A 1 334 SER 334 724 724 SER SER A . n A 1 335 ILE 335 725 725 ILE ILE A . n A 1 336 ARG 336 726 726 ARG ARG A . n A 1 337 VAL 337 727 727 VAL VAL A . n A 1 338 LEU 338 728 728 LEU LEU A . n A 1 339 ARG 339 729 729 ARG ARG A . n A 1 340 GLU 340 730 730 GLU GLU A . n A 1 341 GLU 341 731 731 GLU GLU A . n A 1 342 PHE 342 732 732 PHE PHE A . n A 1 343 GLU 343 733 733 GLU GLU A . n A 1 344 ARG 344 734 734 ARG ARG A . n A 1 345 ALA 345 735 735 ALA ALA A . n A 1 346 ALA 346 736 736 ALA ALA A . n A 1 347 ARG 347 737 737 ARG ARG A . n A 1 348 ILE 348 738 738 ILE ILE A . n A 1 349 MET 349 739 739 MET MET A . n A 1 350 HIS 350 740 740 HIS HIS A . n A 1 351 GLN 351 741 741 GLN GLN A . n A 1 352 ASP 352 742 742 ASP ASP A . n A 1 353 PRO 353 743 743 PRO PRO A . n A 1 354 ASN 354 744 744 ASN ASN A . n A 1 355 PRO 355 745 745 PRO PRO A . n A 1 356 CYS 356 746 746 CYS CYS A . n A 1 357 ALA 357 747 747 ALA ALA A . n A 1 358 LYS 358 748 748 LYS LYS A . n A 1 359 LEU 359 749 749 LEU LEU A . n A 1 360 LEU 360 750 750 LEU LEU A . n A 1 361 GLU 361 751 751 GLU GLU A . n A 1 362 PRO 362 752 752 PRO PRO A . n A 1 363 TYR 363 753 753 TYR TYR A . n A 1 364 ILE 364 754 754 ILE ILE A . n A 1 365 PRO 365 755 755 PRO PRO A . n A 1 366 GLU 366 756 ? ? ? A . n A 1 367 ASP 367 757 ? ? ? A . n A 1 368 ASN 368 758 ? ? ? A . n A 1 369 ASN 369 759 ? ? ? A . n A 1 370 GLY 370 760 ? ? ? A . n A 1 371 GLN 371 761 ? ? ? A . n A 1 372 GLY 372 762 ? ? ? A . n A 1 373 HIS 373 763 ? ? ? A . n A 1 374 ASN 374 764 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id UTP _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 801 _pdbx_nonpoly_scheme.auth_seq_num 801 _pdbx_nonpoly_scheme.pdb_mon_id UTP _pdbx_nonpoly_scheme.auth_mon_id UTP _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 690 ? 1 MORE -3 ? 1 'SSA (A^2)' 16010 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-01-29 2 'Structure model' 1 1 2020-02-26 3 'Structure model' 1 2 2020-04-01 4 'Structure model' 1 3 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 4 'Structure model' '_database_2.pdbx_DOI' 14 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 25.7610 _pdbx_refine_tls.origin_y -0.8185 _pdbx_refine_tls.origin_z 18.1913 _pdbx_refine_tls.T[1][1] 0.3033 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0343 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0334 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.4257 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0126 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.3412 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.7574 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.5872 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.1355 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.7135 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.1328 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.3481 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0418 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.1107 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0111 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0487 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0882 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.1415 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0343 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.1492 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.1317 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 426 ? ? A 755 ? ALL 2 'X-RAY DIFFRACTION' 1 ? ? A 801 ? ? A 801 ? ALL # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10_2155 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 6L8K _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OG _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 SER _pdbx_validate_symm_contact.auth_seq_id_1 684 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OG _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 SER _pdbx_validate_symm_contact.auth_seq_id_2 684 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_656 _pdbx_validate_symm_contact.dist 2.06 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 490 ? ? -104.50 41.39 2 1 ASP A 502 ? ? -85.72 40.51 3 1 ARG A 531 ? ? 83.31 -0.58 4 1 ASN A 552 ? ? -96.30 55.66 5 1 GLN A 741 ? ? -133.38 -35.23 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 474 ? CG ? A LYS 84 CG 2 1 Y 1 A LYS 474 ? CD ? A LYS 84 CD 3 1 Y 1 A LYS 474 ? CE ? A LYS 84 CE 4 1 Y 1 A LYS 474 ? NZ ? A LYS 84 NZ 5 1 Y 1 A ASP 632 ? CG ? A ASP 242 CG 6 1 Y 1 A ASP 632 ? OD1 ? A ASP 242 OD1 7 1 Y 1 A ASP 632 ? OD2 ? A ASP 242 OD2 8 1 Y 1 A ARG 646 ? CG ? A ARG 256 CG 9 1 Y 1 A ARG 646 ? CD ? A ARG 256 CD 10 1 Y 1 A ARG 646 ? NE ? A ARG 256 NE 11 1 Y 1 A ARG 646 ? CZ ? A ARG 256 CZ 12 1 Y 1 A ARG 646 ? NH1 ? A ARG 256 NH1 13 1 Y 1 A ARG 646 ? NH2 ? A ARG 256 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 391 ? A MET 1 2 1 Y 1 A GLY 392 ? A GLY 2 3 1 Y 1 A SER 393 ? A SER 3 4 1 Y 1 A SER 394 ? A SER 4 5 1 Y 1 A HIS 395 ? A HIS 5 6 1 Y 1 A HIS 396 ? A HIS 6 7 1 Y 1 A HIS 397 ? A HIS 7 8 1 Y 1 A HIS 398 ? A HIS 8 9 1 Y 1 A HIS 399 ? A HIS 9 10 1 Y 1 A HIS 400 ? A HIS 10 11 1 Y 1 A SER 401 ? A SER 11 12 1 Y 1 A SER 402 ? A SER 12 13 1 Y 1 A GLY 403 ? A GLY 13 14 1 Y 1 A GLU 404 ? A GLU 14 15 1 Y 1 A ASN 405 ? A ASN 15 16 1 Y 1 A LEU 406 ? A LEU 16 17 1 Y 1 A TYR 407 ? A TYR 17 18 1 Y 1 A PHE 408 ? A PHE 18 19 1 Y 1 A GLN 409 ? A GLN 19 20 1 Y 1 A GLY 410 ? A GLY 20 21 1 Y 1 A GLN 411 ? A GLN 21 22 1 Y 1 A ARG 412 ? A ARG 22 23 1 Y 1 A LEU 413 ? A LEU 23 24 1 Y 1 A LEU 414 ? A LEU 24 25 1 Y 1 A GLY 415 ? A GLY 25 26 1 Y 1 A GLN 416 ? A GLN 26 27 1 Y 1 A LYS 417 ? A LYS 27 28 1 Y 1 A ALA 418 ? A ALA 28 29 1 Y 1 A ARG 419 ? A ARG 29 30 1 Y 1 A MET 420 ? A MET 30 31 1 Y 1 A VAL 421 ? A VAL 31 32 1 Y 1 A LYS 422 ? A LYS 32 33 1 Y 1 A MET 423 ? A MET 33 34 1 Y 1 A TYR 424 ? A TYR 34 35 1 Y 1 A MET 425 ? A MET 35 36 1 Y 1 A ASP 692 ? A ASP 302 37 1 Y 1 A TRP 693 ? A TRP 303 38 1 Y 1 A THR 694 ? A THR 304 39 1 Y 1 A ARG 695 ? A ARG 305 40 1 Y 1 A ARG 696 ? A ARG 306 41 1 Y 1 A VAL 697 ? A VAL 307 42 1 Y 1 A GLY 698 ? A GLY 308 43 1 Y 1 A ASN 699 ? A ASN 309 44 1 Y 1 A ASP 700 ? A ASP 310 45 1 Y 1 A GLU 756 ? A GLU 366 46 1 Y 1 A ASP 757 ? A ASP 367 47 1 Y 1 A ASN 758 ? A ASN 368 48 1 Y 1 A ASN 759 ? A ASN 369 49 1 Y 1 A GLY 760 ? A GLY 370 50 1 Y 1 A GLN 761 ? A GLN 371 51 1 Y 1 A GLY 762 ? A GLY 372 52 1 Y 1 A HIS 763 ? A HIS 373 53 1 Y 1 A ASN 764 ? A ASN 374 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 UTP PA P N R 369 UTP O1A O N N 370 UTP O2A O N N 371 UTP O3A O N N 372 UTP "O5'" O N N 373 UTP PB P N S 374 UTP O1B O N N 375 UTP O2B O N N 376 UTP O3B O N N 377 UTP PG P N N 378 UTP O1G O N N 379 UTP O2G O N N 380 UTP O3G O N N 381 UTP "C5'" C N N 382 UTP "C4'" C N R 383 UTP "O4'" O N N 384 UTP "C1'" C N R 385 UTP "C2'" C N R 386 UTP "O2'" O N N 387 UTP "C3'" C N S 388 UTP "O3'" O N N 389 UTP N1 N Y N 390 UTP C6 C Y N 391 UTP C2 C Y N 392 UTP O2 O N N 393 UTP N3 N Y N 394 UTP C4 C Y N 395 UTP O4 O N N 396 UTP C5 C Y N 397 UTP H2A H N N 398 UTP H1B H N N 399 UTP H1G H N N 400 UTP H3G H N N 401 UTP "H5'1" H N N 402 UTP "H5'2" H N N 403 UTP "H4'" H N N 404 UTP "H1'" H N N 405 UTP "H2'" H N N 406 UTP HA H N N 407 UTP "H3'" H N N 408 UTP HB H N N 409 UTP H6 H N N 410 UTP H3 H N N 411 UTP H5 H N N 412 VAL N N N N 413 VAL CA C N S 414 VAL C C N N 415 VAL O O N N 416 VAL CB C N N 417 VAL CG1 C N N 418 VAL CG2 C N N 419 VAL OXT O N N 420 VAL H H N N 421 VAL H2 H N N 422 VAL HA H N N 423 VAL HB H N N 424 VAL HG11 H N N 425 VAL HG12 H N N 426 VAL HG13 H N N 427 VAL HG21 H N N 428 VAL HG22 H N N 429 VAL HG23 H N N 430 VAL HXT H N N 431 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 UTP PA O1A doub N N 356 UTP PA O2A sing N N 357 UTP PA O3A sing N N 358 UTP PA "O5'" sing N N 359 UTP O2A H2A sing N N 360 UTP O3A PB sing N N 361 UTP "O5'" "C5'" sing N N 362 UTP PB O1B sing N N 363 UTP PB O2B doub N N 364 UTP PB O3B sing N N 365 UTP O1B H1B sing N N 366 UTP O3B PG sing N N 367 UTP PG O1G sing N N 368 UTP PG O2G doub N N 369 UTP PG O3G sing N N 370 UTP O1G H1G sing N N 371 UTP O3G H3G sing N N 372 UTP "C5'" "C4'" sing N N 373 UTP "C5'" "H5'1" sing N N 374 UTP "C5'" "H5'2" sing N N 375 UTP "C4'" "O4'" sing N N 376 UTP "C4'" "C3'" sing N N 377 UTP "C4'" "H4'" sing N N 378 UTP "O4'" "C1'" sing N N 379 UTP "C1'" "C2'" sing N N 380 UTP "C1'" N1 sing N N 381 UTP "C1'" "H1'" sing N N 382 UTP "C2'" "O2'" sing N N 383 UTP "C2'" "C3'" sing N N 384 UTP "C2'" "H2'" sing N N 385 UTP "O2'" HA sing N N 386 UTP "C3'" "O3'" sing N N 387 UTP "C3'" "H3'" sing N N 388 UTP "O3'" HB sing N N 389 UTP N1 C6 sing Y N 390 UTP N1 C2 sing Y N 391 UTP C6 C5 doub Y N 392 UTP C6 H6 sing N N 393 UTP C2 O2 doub N N 394 UTP C2 N3 sing Y N 395 UTP N3 C4 sing Y N 396 UTP N3 H3 sing N N 397 UTP C4 O4 doub N N 398 UTP C4 C5 sing Y N 399 UTP C5 H5 sing N N 400 VAL N CA sing N N 401 VAL N H sing N N 402 VAL N H2 sing N N 403 VAL CA C sing N N 404 VAL CA CB sing N N 405 VAL CA HA sing N N 406 VAL C O doub N N 407 VAL C OXT sing N N 408 VAL CB CG1 sing N N 409 VAL CB CG2 sing N N 410 VAL CB HB sing N N 411 VAL CG1 HG11 sing N N 412 VAL CG1 HG12 sing N N 413 VAL CG1 HG13 sing N N 414 VAL CG2 HG21 sing N N 415 VAL CG2 HG22 sing N N 416 VAL CG2 HG23 sing N N 417 VAL OXT HXT sing N N 418 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name ;URIDINE 5'-TRIPHOSPHATE ; _pdbx_entity_nonpoly.comp_id UTP # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5W0N _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #