data_6L8R # _entry.id 6L8R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6L8R pdb_00006l8r 10.2210/pdb6l8r/pdb WWPDB D_1300013973 ? ? BMRB 36293 ? 10.13018/BMR36293 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-11-11 2 'Structure model' 1 1 2021-05-12 3 'Structure model' 1 2 2021-11-24 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Database references' 3 4 'Structure model' Other 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 3 'Structure model' database_2 5 4 'Structure model' pdbx_database_status 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation_author.name' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_CSD' 5 3 'Structure model' '_citation.journal_id_ISSN' 6 3 'Structure model' '_citation.journal_volume' 7 3 'Structure model' '_citation.page_first' 8 3 'Structure model' '_citation.page_last' 9 3 'Structure model' '_citation.pdbx_database_id_DOI' 10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation.year' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' 15 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 16 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6L8R _pdbx_database_status.recvd_initial_deposition_date 2019-11-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'membrane-bound PD-L1-CD' _pdbx_database_related.db_id 36293 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Maorong, W.' 1 ? 'Cao, Y.' 2 ? 'Bin, W.' 3 ? 'Bo, O.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 5106 _citation.page_last 5106 _citation.title 'PD-L1 degradation is regulated by electrostatic membrane association of its cytoplasmic domain.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-021-25416-7 _citation.pdbx_database_id_PubMed 34429434 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wen, M.' 1 0000-0002-8632-8247 primary 'Cao, Y.' 2 ? primary 'Wu, B.' 3 ? primary 'Xiao, T.' 4 ? primary 'Cao, R.' 5 ? primary 'Wang, Q.' 6 ? primary 'Liu, X.' 7 ? primary 'Xue, H.' 8 ? primary 'Yu, Y.' 9 ? primary 'Lin, J.' 10 0000-0002-2126-1571 primary 'Xu, C.' 11 0000-0002-4968-6782 primary 'Xu, J.' 12 ? primary 'OuYang, B.' 13 0000-0002-2877-0635 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Programmed cell death 1 ligand 1' _entity.formula_weight 3797.370 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'hPD-L1,B7 homolog 1,B7-H1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET _entity_poly.pdbx_seq_one_letter_code_can GPRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 ARG n 1 4 LEU n 1 5 ARG n 1 6 LYS n 1 7 GLY n 1 8 ARG n 1 9 MET n 1 10 MET n 1 11 ASP n 1 12 VAL n 1 13 LYS n 1 14 LYS n 1 15 CYS n 1 16 GLY n 1 17 ILE n 1 18 GLN n 1 19 ASP n 1 20 THR n 1 21 ASN n 1 22 SER n 1 23 LYS n 1 24 LYS n 1 25 GLN n 1 26 SER n 1 27 ASP n 1 28 THR n 1 29 HIS n 1 30 LEU n 1 31 GLU n 1 32 GLU n 1 33 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 33 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 258 258 GLY GLY A . n A 1 2 PRO 2 259 259 PRO PRO A . n A 1 3 ARG 3 260 260 ARG ARG A . n A 1 4 LEU 4 261 261 LEU LEU A . n A 1 5 ARG 5 262 262 ARG ARG A . n A 1 6 LYS 6 263 263 LYS LYS A . n A 1 7 GLY 7 264 264 GLY GLY A . n A 1 8 ARG 8 265 265 ARG ARG A . n A 1 9 MET 9 266 266 MET MET A . n A 1 10 MET 10 267 267 MET MET A . n A 1 11 ASP 11 268 268 ASP ASP A . n A 1 12 VAL 12 269 269 VAL VAL A . n A 1 13 LYS 13 270 270 LYS LYS A . n A 1 14 LYS 14 271 271 LYS LYS A . n A 1 15 CYS 15 272 272 CYS CYS A . n A 1 16 GLY 16 273 273 GLY GLY A . n A 1 17 ILE 17 274 274 ILE ILE A . n A 1 18 GLN 18 275 275 GLN GLN A . n A 1 19 ASP 19 276 276 ASP ASP A . n A 1 20 THR 20 277 277 THR THR A . n A 1 21 ASN 21 278 278 ASN ASN A . n A 1 22 SER 22 279 279 SER SER A . n A 1 23 LYS 23 280 280 LYS LYS A . n A 1 24 LYS 24 281 281 LYS LYS A . n A 1 25 GLN 25 282 282 GLN GLN A . n A 1 26 SER 26 283 283 SER SER A . n A 1 27 ASP 27 284 284 ASP ASP A . n A 1 28 THR 28 285 285 THR THR A . n A 1 29 HIS 29 286 286 HIS HIS A . n A 1 30 LEU 30 287 287 LEU LEU A . n A 1 31 GLU 31 288 288 GLU GLU A . n A 1 32 GLU 32 289 289 GLU GLU A . n A 1 33 THR 33 290 290 THR THR A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6L8R _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6L8R _struct.title 'membrane-bound PD-L1-CD' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6L8R _struct_keywords.text 'PD-L1, membrane-bound, cytoplasmic domain, stability, IMMUNOSUPPRESSANT' _struct_keywords.pdbx_keywords IMMUNOSUPPRESSANT # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PD1L1_HUMAN _struct_ref.pdbx_db_accession Q9NZQ7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RLRKGRMMDVKKCGIQDTNSKKQSDTHLEET _struct_ref.pdbx_align_begin 260 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6L8R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 33 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NZQ7 _struct_ref_seq.db_align_beg 260 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 290 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 260 _struct_ref_seq.pdbx_auth_seq_align_end 290 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6L8R GLY A 1 ? UNP Q9NZQ7 ? ? 'expression tag' 258 1 1 6L8R PRO A 2 ? UNP Q9NZQ7 ? ? 'expression tag' 259 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4290 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 263 ? ? -50.12 172.70 2 1 MET A 267 ? ? -119.78 -150.91 3 1 ASP A 268 ? ? -61.91 91.58 4 1 HIS A 286 ? ? -59.99 101.73 5 2 ARG A 260 ? ? -58.24 -169.30 6 2 LYS A 263 ? ? -53.28 178.53 7 2 MET A 267 ? ? -113.57 -151.88 8 2 ASP A 268 ? ? -66.64 89.12 9 2 ASN A 278 ? ? -124.65 -61.87 10 2 SER A 279 ? ? -173.87 128.04 11 3 PRO A 259 ? ? -58.92 89.90 12 3 ARG A 260 ? ? -78.61 -165.29 13 3 LYS A 263 ? ? -52.89 177.70 14 3 MET A 267 ? ? -122.80 -152.89 15 3 ASP A 268 ? ? -62.57 90.84 16 3 ASN A 278 ? ? -127.15 -62.67 17 3 SER A 279 ? ? 62.10 115.94 18 3 ASP A 284 ? ? -55.21 177.76 19 3 THR A 285 ? ? 17.68 83.29 20 4 ARG A 260 ? ? -64.72 -140.11 21 4 LYS A 263 ? ? -48.70 157.22 22 4 MET A 267 ? ? -128.11 -151.01 23 4 ASP A 268 ? ? -67.86 85.15 24 5 ARG A 260 ? ? -64.68 -167.77 25 5 LYS A 263 ? ? -55.74 -174.26 26 5 MET A 267 ? ? -106.92 -150.34 27 5 ASP A 268 ? ? -60.13 93.29 28 5 ASP A 276 ? ? -100.06 47.60 29 5 SER A 279 ? ? 63.56 115.36 30 5 ASP A 284 ? ? -59.48 -177.21 31 5 THR A 285 ? ? 19.17 -147.19 32 6 ARG A 260 ? ? 40.81 -158.65 33 6 LYS A 263 ? ? -49.62 171.09 34 6 MET A 267 ? ? -112.65 -150.76 35 6 ASP A 268 ? ? -66.83 85.01 36 6 ILE A 274 ? ? -45.17 104.41 37 6 ASP A 276 ? ? -150.26 89.59 38 6 THR A 285 ? ? -66.97 -177.74 39 7 ARG A 260 ? ? -64.89 -164.42 40 7 LYS A 263 ? ? -54.40 -178.63 41 7 MET A 267 ? ? -126.99 -154.61 42 7 ASP A 268 ? ? -67.55 87.01 43 7 ASN A 278 ? ? -127.02 -60.48 44 7 SER A 279 ? ? 55.63 93.30 45 7 ASP A 284 ? ? 57.89 175.55 46 7 THR A 285 ? ? 17.40 78.96 47 8 ARG A 260 ? ? -57.45 -170.41 48 8 ARG A 262 ? ? -110.18 -167.97 49 8 LYS A 263 ? ? -55.70 -176.73 50 8 ARG A 265 ? ? -66.48 -178.82 51 8 MET A 267 ? ? -104.65 -149.92 52 8 ASP A 268 ? ? -58.79 95.03 53 8 ASN A 278 ? ? -120.22 -65.24 54 8 SER A 279 ? ? 55.61 176.92 55 8 ASP A 284 ? ? 58.87 -173.64 56 8 THR A 285 ? ? -49.73 169.85 57 9 ARG A 260 ? ? -58.51 -168.33 58 9 LYS A 263 ? ? -54.99 173.29 59 9 MET A 267 ? ? -117.15 -150.19 60 9 ASP A 268 ? ? -60.94 93.49 61 9 ASP A 276 ? ? -83.70 48.78 62 9 SER A 279 ? ? 58.11 100.33 63 9 ASP A 284 ? ? -65.57 -116.24 64 10 ARG A 260 ? ? -60.09 -165.84 65 10 LYS A 263 ? ? -54.30 -178.61 66 10 MET A 267 ? ? -115.08 -150.13 67 10 ASP A 268 ? ? -61.86 98.09 68 10 LYS A 271 ? ? -60.98 -170.33 69 10 ASP A 276 ? ? -86.66 47.93 70 10 ASN A 278 ? ? -127.11 -63.08 71 10 SER A 279 ? ? 64.56 125.80 72 11 ARG A 260 ? ? -59.03 -167.59 73 11 LYS A 263 ? ? -54.54 -177.74 74 11 MET A 267 ? ? -126.37 -150.82 75 11 ASP A 268 ? ? -60.06 94.98 76 11 VAL A 269 ? ? -134.17 -37.56 77 11 ASP A 276 ? ? -93.83 48.02 78 11 SER A 279 ? ? 59.86 104.45 79 11 THR A 285 ? ? -62.22 -179.99 80 12 ARG A 260 ? ? -59.57 -166.58 81 12 LYS A 263 ? ? -55.75 -175.36 82 12 ARG A 265 ? ? -55.73 171.17 83 12 MET A 266 ? ? -58.65 83.36 84 12 ASP A 268 ? ? 2.93 72.79 85 12 LYS A 271 ? ? -57.38 175.91 86 12 ASN A 278 ? ? -124.49 -61.51 87 12 SER A 279 ? ? 56.26 96.18 88 12 ASP A 284 ? ? 56.21 179.02 89 12 THR A 285 ? ? -58.06 102.80 90 12 GLU A 288 ? ? -57.44 104.01 91 13 ARG A 260 ? ? -148.99 -84.47 92 13 MET A 266 ? ? -61.05 99.57 93 13 MET A 267 ? ? -93.48 -151.98 94 13 ASP A 268 ? ? -60.62 93.60 95 13 ASN A 278 ? ? -127.09 -63.91 96 13 SER A 279 ? ? -175.81 129.13 97 14 ARG A 260 ? ? -65.27 -165.83 98 14 LYS A 263 ? ? -54.21 -178.79 99 14 MET A 266 ? ? -57.44 101.47 100 14 MET A 267 ? ? -95.49 -151.31 101 14 ASP A 268 ? ? -62.23 91.79 102 14 ASN A 278 ? ? -126.01 -61.02 103 14 SER A 279 ? ? 54.90 93.72 104 14 ASP A 284 ? ? 56.39 179.62 105 14 THR A 285 ? ? 18.75 -146.68 106 15 ARG A 260 ? ? 43.54 -160.20 107 15 LYS A 263 ? ? -54.83 177.26 108 15 ARG A 265 ? ? -56.91 -179.75 109 15 MET A 266 ? ? -63.04 81.77 110 15 ASP A 268 ? ? 2.80 73.41 111 15 ASN A 278 ? ? -122.09 -60.69 112 15 SER A 279 ? ? -170.75 127.21 113 16 ARG A 260 ? ? -49.47 170.62 114 16 LYS A 263 ? ? -55.97 -178.74 115 16 MET A 266 ? ? -56.75 106.72 116 16 MET A 267 ? ? -98.80 -151.30 117 16 ASP A 268 ? ? -60.14 93.86 118 16 ASP A 276 ? ? -87.55 47.87 119 16 ASN A 278 ? ? -126.22 -60.93 120 16 SER A 279 ? ? 54.21 91.78 121 16 ASP A 284 ? ? 57.15 -175.74 122 16 THR A 285 ? ? -57.16 170.80 123 17 ARG A 260 ? ? -58.78 -167.34 124 17 LYS A 263 ? ? -54.43 -178.31 125 17 MET A 267 ? ? -126.72 -152.38 126 17 ASP A 268 ? ? -59.87 95.18 127 17 VAL A 269 ? ? -133.93 -35.51 128 17 ASP A 276 ? ? -86.25 48.40 129 17 ASN A 278 ? ? -125.76 -54.65 130 17 SER A 279 ? ? 57.87 99.53 131 17 ASP A 284 ? ? -57.44 177.72 132 17 THR A 285 ? ? 17.67 77.06 133 18 ARG A 260 ? ? 58.43 -149.11 134 18 LYS A 263 ? ? -55.06 -178.32 135 18 MET A 267 ? ? -106.94 -150.21 136 18 ASP A 268 ? ? -60.53 92.31 137 18 ASP A 276 ? ? -88.34 48.03 138 18 SER A 279 ? ? 64.25 128.25 139 18 ASP A 284 ? ? 56.67 179.32 140 19 ARG A 260 ? ? -60.23 -165.62 141 19 LYS A 263 ? ? -54.54 -178.28 142 19 MET A 267 ? ? -121.98 -152.67 143 19 ASP A 268 ? ? -63.35 98.20 144 19 VAL A 269 ? ? -132.25 -39.59 145 19 ASN A 278 ? ? -121.73 -53.66 146 19 SER A 279 ? ? 59.53 166.95 147 20 LYS A 263 ? ? -51.98 176.99 148 20 MET A 267 ? ? -115.32 -151.07 149 20 ASP A 268 ? ? -67.62 85.84 150 20 ASP A 276 ? ? -84.54 49.90 151 20 ASN A 278 ? ? -123.15 -61.70 152 20 SER A 279 ? ? 61.09 108.33 # _pdbx_nmr_ensemble.entry_id 6L8R _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6L8R _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM 15N_13C_2H PD-L1-CD, 60 mM DMPG, 85 mM DHPC, 90% H2O/10% D2O' '90% H2O/10% D2O' '15N_13C_2H label' bicelle ? 2 '0.5 mM 15N_13C PD-L1-CD, 60 mM 2H DMPG, 85 mM 2H DHPC, 90% H2O/10% D2O' '90% H2O/10% D2O' '15N_13C label' bicelle ? 3 '0.5 mM 15N_2H PD-L1-CD, 60 mM POPG, 85 mM 2H DHPC, 90% H2O/10% D2O' '90% H2O/10% D2O' '15N_2H label for lipid NOE' bicelle ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 PD-L1-CD 0.5 ? mM 15N_13C_2H 1 DMPG 60 ? mM 'natural abundance' 1 DHPC 85 ? mM 'natural abundance' 2 PD-L1-CD 0.5 ? mM 15N_13C 2 DMPG 60 ? mM 2H 2 DHPC 85 ? mM 2H 3 PD-L1-CD 0.5 ? mM 15N_2H 3 POPG 60 ? mM 'natural abundance' 3 DHPC 85 ? mM 2H # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 3 1 1 '3D HNCO' 1 isotropic 4 1 1 '3D HNCA' 1 isotropic 5 1 1 '3D HN(CO)CA' 1 isotropic 7 1 1 '3D HNCACO' 1 isotropic 6 1 1 '3D HNCACB' 1 isotropic 9 1 2 '3D 1H-15N NOESY' 2 isotropic 8 1 2 '3D 1H-13C NOESY' 2 isotropic 10 1 2 '2D 1H-13C HSQC' 2 isotropic 11 1 3 '3D 1H-15N NOESY for lipid NOE' 2 isotropic 12 1 2 '3D HCCH-TOCSY' 2 isotropic # _pdbx_nmr_refine.entry_id 6L8R _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin 3.5.5 'Bruker Biospin' 2 'data analysis' NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'chemical shift assignment' Sparky ? Goddard 4 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 5 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 6 'peak picking' Sparky ? Goddard # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MET N N N N 214 MET CA C N S 215 MET C C N N 216 MET O O N N 217 MET CB C N N 218 MET CG C N N 219 MET SD S N N 220 MET CE C N N 221 MET OXT O N N 222 MET H H N N 223 MET H2 H N N 224 MET HA H N N 225 MET HB2 H N N 226 MET HB3 H N N 227 MET HG2 H N N 228 MET HG3 H N N 229 MET HE1 H N N 230 MET HE2 H N N 231 MET HE3 H N N 232 MET HXT H N N 233 PRO N N N N 234 PRO CA C N S 235 PRO C C N N 236 PRO O O N N 237 PRO CB C N N 238 PRO CG C N N 239 PRO CD C N N 240 PRO OXT O N N 241 PRO H H N N 242 PRO HA H N N 243 PRO HB2 H N N 244 PRO HB3 H N N 245 PRO HG2 H N N 246 PRO HG3 H N N 247 PRO HD2 H N N 248 PRO HD3 H N N 249 PRO HXT H N N 250 SER N N N N 251 SER CA C N S 252 SER C C N N 253 SER O O N N 254 SER CB C N N 255 SER OG O N N 256 SER OXT O N N 257 SER H H N N 258 SER H2 H N N 259 SER HA H N N 260 SER HB2 H N N 261 SER HB3 H N N 262 SER HG H N N 263 SER HXT H N N 264 THR N N N N 265 THR CA C N S 266 THR C C N N 267 THR O O N N 268 THR CB C N R 269 THR OG1 O N N 270 THR CG2 C N N 271 THR OXT O N N 272 THR H H N N 273 THR H2 H N N 274 THR HA H N N 275 THR HB H N N 276 THR HG1 H N N 277 THR HG21 H N N 278 THR HG22 H N N 279 THR HG23 H N N 280 THR HXT H N N 281 VAL N N N N 282 VAL CA C N S 283 VAL C C N N 284 VAL O O N N 285 VAL CB C N N 286 VAL CG1 C N N 287 VAL CG2 C N N 288 VAL OXT O N N 289 VAL H H N N 290 VAL H2 H N N 291 VAL HA H N N 292 VAL HB H N N 293 VAL HG11 H N N 294 VAL HG12 H N N 295 VAL HG13 H N N 296 VAL HG21 H N N 297 VAL HG22 H N N 298 VAL HG23 H N N 299 VAL HXT H N N 300 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLN N CA sing N N 71 GLN N H sing N N 72 GLN N H2 sing N N 73 GLN CA C sing N N 74 GLN CA CB sing N N 75 GLN CA HA sing N N 76 GLN C O doub N N 77 GLN C OXT sing N N 78 GLN CB CG sing N N 79 GLN CB HB2 sing N N 80 GLN CB HB3 sing N N 81 GLN CG CD sing N N 82 GLN CG HG2 sing N N 83 GLN CG HG3 sing N N 84 GLN CD OE1 doub N N 85 GLN CD NE2 sing N N 86 GLN NE2 HE21 sing N N 87 GLN NE2 HE22 sing N N 88 GLN OXT HXT sing N N 89 GLU N CA sing N N 90 GLU N H sing N N 91 GLU N H2 sing N N 92 GLU CA C sing N N 93 GLU CA CB sing N N 94 GLU CA HA sing N N 95 GLU C O doub N N 96 GLU C OXT sing N N 97 GLU CB CG sing N N 98 GLU CB HB2 sing N N 99 GLU CB HB3 sing N N 100 GLU CG CD sing N N 101 GLU CG HG2 sing N N 102 GLU CG HG3 sing N N 103 GLU CD OE1 doub N N 104 GLU CD OE2 sing N N 105 GLU OE2 HE2 sing N N 106 GLU OXT HXT sing N N 107 GLY N CA sing N N 108 GLY N H sing N N 109 GLY N H2 sing N N 110 GLY CA C sing N N 111 GLY CA HA2 sing N N 112 GLY CA HA3 sing N N 113 GLY C O doub N N 114 GLY C OXT sing N N 115 GLY OXT HXT sing N N 116 HIS N CA sing N N 117 HIS N H sing N N 118 HIS N H2 sing N N 119 HIS CA C sing N N 120 HIS CA CB sing N N 121 HIS CA HA sing N N 122 HIS C O doub N N 123 HIS C OXT sing N N 124 HIS CB CG sing N N 125 HIS CB HB2 sing N N 126 HIS CB HB3 sing N N 127 HIS CG ND1 sing Y N 128 HIS CG CD2 doub Y N 129 HIS ND1 CE1 doub Y N 130 HIS ND1 HD1 sing N N 131 HIS CD2 NE2 sing Y N 132 HIS CD2 HD2 sing N N 133 HIS CE1 NE2 sing Y N 134 HIS CE1 HE1 sing N N 135 HIS NE2 HE2 sing N N 136 HIS OXT HXT sing N N 137 ILE N CA sing N N 138 ILE N H sing N N 139 ILE N H2 sing N N 140 ILE CA C sing N N 141 ILE CA CB sing N N 142 ILE CA HA sing N N 143 ILE C O doub N N 144 ILE C OXT sing N N 145 ILE CB CG1 sing N N 146 ILE CB CG2 sing N N 147 ILE CB HB sing N N 148 ILE CG1 CD1 sing N N 149 ILE CG1 HG12 sing N N 150 ILE CG1 HG13 sing N N 151 ILE CG2 HG21 sing N N 152 ILE CG2 HG22 sing N N 153 ILE CG2 HG23 sing N N 154 ILE CD1 HD11 sing N N 155 ILE CD1 HD12 sing N N 156 ILE CD1 HD13 sing N N 157 ILE OXT HXT sing N N 158 LEU N CA sing N N 159 LEU N H sing N N 160 LEU N H2 sing N N 161 LEU CA C sing N N 162 LEU CA CB sing N N 163 LEU CA HA sing N N 164 LEU C O doub N N 165 LEU C OXT sing N N 166 LEU CB CG sing N N 167 LEU CB HB2 sing N N 168 LEU CB HB3 sing N N 169 LEU CG CD1 sing N N 170 LEU CG CD2 sing N N 171 LEU CG HG sing N N 172 LEU CD1 HD11 sing N N 173 LEU CD1 HD12 sing N N 174 LEU CD1 HD13 sing N N 175 LEU CD2 HD21 sing N N 176 LEU CD2 HD22 sing N N 177 LEU CD2 HD23 sing N N 178 LEU OXT HXT sing N N 179 LYS N CA sing N N 180 LYS N H sing N N 181 LYS N H2 sing N N 182 LYS CA C sing N N 183 LYS CA CB sing N N 184 LYS CA HA sing N N 185 LYS C O doub N N 186 LYS C OXT sing N N 187 LYS CB CG sing N N 188 LYS CB HB2 sing N N 189 LYS CB HB3 sing N N 190 LYS CG CD sing N N 191 LYS CG HG2 sing N N 192 LYS CG HG3 sing N N 193 LYS CD CE sing N N 194 LYS CD HD2 sing N N 195 LYS CD HD3 sing N N 196 LYS CE NZ sing N N 197 LYS CE HE2 sing N N 198 LYS CE HE3 sing N N 199 LYS NZ HZ1 sing N N 200 LYS NZ HZ2 sing N N 201 LYS NZ HZ3 sing N N 202 LYS OXT HXT sing N N 203 MET N CA sing N N 204 MET N H sing N N 205 MET N H2 sing N N 206 MET CA C sing N N 207 MET CA CB sing N N 208 MET CA HA sing N N 209 MET C O doub N N 210 MET C OXT sing N N 211 MET CB CG sing N N 212 MET CB HB2 sing N N 213 MET CB HB3 sing N N 214 MET CG SD sing N N 215 MET CG HG2 sing N N 216 MET CG HG3 sing N N 217 MET SD CE sing N N 218 MET CE HE1 sing N N 219 MET CE HE2 sing N N 220 MET CE HE3 sing N N 221 MET OXT HXT sing N N 222 PRO N CA sing N N 223 PRO N CD sing N N 224 PRO N H sing N N 225 PRO CA C sing N N 226 PRO CA CB sing N N 227 PRO CA HA sing N N 228 PRO C O doub N N 229 PRO C OXT sing N N 230 PRO CB CG sing N N 231 PRO CB HB2 sing N N 232 PRO CB HB3 sing N N 233 PRO CG CD sing N N 234 PRO CG HG2 sing N N 235 PRO CG HG3 sing N N 236 PRO CD HD2 sing N N 237 PRO CD HD3 sing N N 238 PRO OXT HXT sing N N 239 SER N CA sing N N 240 SER N H sing N N 241 SER N H2 sing N N 242 SER CA C sing N N 243 SER CA CB sing N N 244 SER CA HA sing N N 245 SER C O doub N N 246 SER C OXT sing N N 247 SER CB OG sing N N 248 SER CB HB2 sing N N 249 SER CB HB3 sing N N 250 SER OG HG sing N N 251 SER OXT HXT sing N N 252 THR N CA sing N N 253 THR N H sing N N 254 THR N H2 sing N N 255 THR CA C sing N N 256 THR CA CB sing N N 257 THR CA HA sing N N 258 THR C O doub N N 259 THR C OXT sing N N 260 THR CB OG1 sing N N 261 THR CB CG2 sing N N 262 THR CB HB sing N N 263 THR OG1 HG1 sing N N 264 THR CG2 HG21 sing N N 265 THR CG2 HG22 sing N N 266 THR CG2 HG23 sing N N 267 THR OXT HXT sing N N 268 VAL N CA sing N N 269 VAL N H sing N N 270 VAL N H2 sing N N 271 VAL CA C sing N N 272 VAL CA CB sing N N 273 VAL CA HA sing N N 274 VAL C O doub N N 275 VAL C OXT sing N N 276 VAL CB CG1 sing N N 277 VAL CB CG2 sing N N 278 VAL CB HB sing N N 279 VAL CG1 HG11 sing N N 280 VAL CG1 HG12 sing N N 281 VAL CG1 HG13 sing N N 282 VAL CG2 HG21 sing N N 283 VAL CG2 HG22 sing N N 284 VAL CG2 HG23 sing N N 285 VAL OXT HXT sing N N 286 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31861133009 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 600 ? 2 DD2 ? Varian 800 ? # _atom_sites.entry_id 6L8R _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_