data_6LFQ # _entry.id 6LFQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.358 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6LFQ pdb_00006lfq 10.2210/pdb6lfq/pdb WWPDB D_1300014077 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6LFQ _pdbx_database_status.recvd_initial_deposition_date 2019-12-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chiu, Y.C.' 1 ? 'Hsu, C.H.' 2 0000-0002-0008-7383 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Catalysis' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2155-5435 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 11075 _citation.page_last 11090 _citation.title ;Expanding the Substrate Specificity of Macro Domains toward 3''-Isomer of O-Acetyl-ADP-ribose ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acscatal.1c01943 _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chiu, Y.C.' 1 ? primary 'Tseng, M.C.' 2 ? primary 'Hsu, C.H.' 3 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6LFQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.195 _cell.length_a_esd ? _cell.length_b 59.612 _cell.length_b_esd ? _cell.length_c 100.658 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6LFQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ;ADP-ribose 1''-phosphate phosphatase ; 20244.090 1 3.1.3.84,3.2.2.- ? ? ? 2 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 3 water nat water 18.015 52 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '[Protein ADP-ribosylglutamate] hydrolase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMSNITYVKGNILKPKSYARILIHSCNCNGSWGGGIAYQLALRYPKAEKDYVEVCEKYGSNLLGKCILLPSYENSDLL ICCLFTSSFGGSSHGEKQSILNYTKLALDKLKTFREAKDKTRTSEDSIGDYLNGHIKYPIGEYKLEMPQINSGIFGVPWK ETERVLEEFSGDMSFTVYQL ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMSNITYVKGNILKPKSYARILIHSCNCNGSWGGGIAYQLALRYPKAEKDYVEVCEKYGSNLLGKCILLPSYENSDLL ICCLFTSSFGGSSHGEKQSILNYTKLALDKLKTFREAKDKTRTSEDSIGDYLNGHIKYPIGEYKLEMPQINSGIFGVPWK ETERVLEEFSGDMSFTVYQL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 SER n 1 6 ASN n 1 7 ILE n 1 8 THR n 1 9 TYR n 1 10 VAL n 1 11 LYS n 1 12 GLY n 1 13 ASN n 1 14 ILE n 1 15 LEU n 1 16 LYS n 1 17 PRO n 1 18 LYS n 1 19 SER n 1 20 TYR n 1 21 ALA n 1 22 ARG n 1 23 ILE n 1 24 LEU n 1 25 ILE n 1 26 HIS n 1 27 SER n 1 28 CYS n 1 29 ASN n 1 30 CYS n 1 31 ASN n 1 32 GLY n 1 33 SER n 1 34 TRP n 1 35 GLY n 1 36 GLY n 1 37 GLY n 1 38 ILE n 1 39 ALA n 1 40 TYR n 1 41 GLN n 1 42 LEU n 1 43 ALA n 1 44 LEU n 1 45 ARG n 1 46 TYR n 1 47 PRO n 1 48 LYS n 1 49 ALA n 1 50 GLU n 1 51 LYS n 1 52 ASP n 1 53 TYR n 1 54 VAL n 1 55 GLU n 1 56 VAL n 1 57 CYS n 1 58 GLU n 1 59 LYS n 1 60 TYR n 1 61 GLY n 1 62 SER n 1 63 ASN n 1 64 LEU n 1 65 LEU n 1 66 GLY n 1 67 LYS n 1 68 CYS n 1 69 ILE n 1 70 LEU n 1 71 LEU n 1 72 PRO n 1 73 SER n 1 74 TYR n 1 75 GLU n 1 76 ASN n 1 77 SER n 1 78 ASP n 1 79 LEU n 1 80 LEU n 1 81 ILE n 1 82 CYS n 1 83 CYS n 1 84 LEU n 1 85 PHE n 1 86 THR n 1 87 SER n 1 88 SER n 1 89 PHE n 1 90 GLY n 1 91 GLY n 1 92 SER n 1 93 SER n 1 94 HIS n 1 95 GLY n 1 96 GLU n 1 97 LYS n 1 98 GLN n 1 99 SER n 1 100 ILE n 1 101 LEU n 1 102 ASN n 1 103 TYR n 1 104 THR n 1 105 LYS n 1 106 LEU n 1 107 ALA n 1 108 LEU n 1 109 ASP n 1 110 LYS n 1 111 LEU n 1 112 LYS n 1 113 THR n 1 114 PHE n 1 115 ARG n 1 116 GLU n 1 117 ALA n 1 118 LYS n 1 119 ASP n 1 120 LYS n 1 121 THR n 1 122 ARG n 1 123 THR n 1 124 SER n 1 125 GLU n 1 126 ASP n 1 127 SER n 1 128 ILE n 1 129 GLY n 1 130 ASP n 1 131 TYR n 1 132 LEU n 1 133 ASN n 1 134 GLY n 1 135 HIS n 1 136 ILE n 1 137 LYS n 1 138 TYR n 1 139 PRO n 1 140 ILE n 1 141 GLY n 1 142 GLU n 1 143 TYR n 1 144 LYS n 1 145 LEU n 1 146 GLU n 1 147 MET n 1 148 PRO n 1 149 GLN n 1 150 ILE n 1 151 ASN n 1 152 SER n 1 153 GLY n 1 154 ILE n 1 155 PHE n 1 156 GLY n 1 157 VAL n 1 158 PRO n 1 159 TRP n 1 160 LYS n 1 161 GLU n 1 162 THR n 1 163 GLU n 1 164 ARG n 1 165 VAL n 1 166 LEU n 1 167 GLU n 1 168 GLU n 1 169 PHE n 1 170 SER n 1 171 GLY n 1 172 ASP n 1 173 MET n 1 174 SER n 1 175 PHE n 1 176 THR n 1 177 VAL n 1 178 TYR n 1 179 GLN n 1 180 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 180 _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'POA1, YBR022W, YBR0304' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain S288c _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae S288c' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POA1_YEAST _struct_ref.pdbx_db_accession P38218 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSNITYVKGNILKPKSYARILIHSCNCNGSWGGGIAYQLALRYPKAEKDYVEVCEKYGSNLLGKCILLPSYENSDLLICC LFTSSFGGSSHGEKQSILNYTKLALDKLKTFREAKDKTRTSEDSIGDYLNGHIKYPIGEYKLEMPQINSGIFGVPWKETE RVLEEFSGDMSFTVYQL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6LFQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 180 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P38218 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 177 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 177 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6LFQ GLY A 1 ? UNP P38218 ? ? 'expression tag' -2 1 1 6LFQ SER A 2 ? UNP P38218 ? ? 'expression tag' -1 2 1 6LFQ HIS A 3 ? UNP P38218 ? ? 'expression tag' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6LFQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.82 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 32.52 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 283 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'HEPES sodium, Lithium sulfate monohydrate, Glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300-HS' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-11-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSRRC BEAMLINE TPS 05A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'TPS 05A' _diffrn_source.pdbx_synchrotron_site NSRRC # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6LFQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.3590 _reflns.d_resolution_low 29.8060 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6209 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.971 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.359 _reflns_shell.d_res_low 2.444 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.911 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 88.160 _refine.B_iso_mean 29.5345 _refine.B_iso_min 8.360 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6LFQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3590 _refine.ls_d_res_low 29.8060 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6209 _refine.ls_number_reflns_R_free 621 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.3500 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1694 _refine.ls_R_factor_R_free 0.2552 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1601 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.1900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3590 _refine_hist.d_res_low 29.8060 _refine_hist.number_atoms_solvent 52 _refine_hist.number_atoms_total 1394 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 169 _refine_hist.pdbx_B_iso_mean_ligand 42.80 _refine_hist.pdbx_B_iso_mean_solvent 31.78 _refine_hist.pdbx_number_atoms_protein 1336 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3590 2.5961 . . 140 1267 90.0000 . . . 0.3209 0.0000 0.2008 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5961 2.9715 . . 156 1398 100.0000 . . . 0.2711 0.0000 0.1933 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9715 3.7426 . . 158 1428 99.0000 . . . 0.2770 0.0000 0.1571 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7426 29.8060 . . 167 1495 100.0000 . . . 0.2157 0.0000 0.1384 . . . . . . . . . . . # _struct.entry_id 6LFQ _struct.title 'Crystal structure of Poa1p in apo form' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6LFQ _struct_keywords.text 'deacetylase, macro domain, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 36 ? TYR A 46 ? GLY A 33 TYR A 43 1 ? 11 HELX_P HELX_P2 AA2 TYR A 46 ? GLY A 61 ? TYR A 43 GLY A 58 1 ? 16 HELX_P HELX_P3 AA3 SER A 62 ? LEU A 65 ? SER A 59 LEU A 62 5 ? 4 HELX_P HELX_P4 AA4 GLY A 90 ? HIS A 94 ? GLY A 87 HIS A 91 5 ? 5 HELX_P HELX_P5 AA5 GLU A 96 ? ASP A 119 ? GLU A 93 ASP A 116 1 ? 24 HELX_P HELX_P6 AA6 PRO A 139 ? TYR A 143 ? PRO A 136 TYR A 140 5 ? 5 HELX_P HELX_P7 AA7 PRO A 158 ? GLU A 168 ? PRO A 155 GLU A 165 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 7 ? LYS A 11 ? ILE A 4 LYS A 8 AA1 2 PHE A 175 ? GLN A 179 ? PHE A 172 GLN A 176 AA1 3 LYS A 144 ? MET A 147 ? LYS A 141 MET A 144 AA1 4 ARG A 22 ? ASN A 29 ? ARG A 19 ASN A 26 AA1 5 LEU A 79 ? SER A 87 ? LEU A 76 SER A 84 AA1 6 CYS A 68 ? PRO A 72 ? CYS A 65 PRO A 69 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 8 ? N THR A 5 O VAL A 177 ? O VAL A 174 AA1 2 3 O TYR A 178 ? O TYR A 175 N MET A 147 ? N MET A 144 AA1 3 4 O GLU A 146 ? O GLU A 143 N ILE A 25 ? N ILE A 22 AA1 4 5 N CYS A 28 ? N CYS A 25 O LEU A 84 ? O LEU A 81 AA1 5 6 O ILE A 81 ? O ILE A 78 N LEU A 71 ? N LEU A 68 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id GOL _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'binding site for residue GOL A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 GLY A 37 ? GLY A 34 . ? 1_555 ? 2 AC1 9 ILE A 38 ? ILE A 35 . ? 1_555 ? 3 AC1 9 SER A 62 ? SER A 59 . ? 8_455 ? 4 AC1 9 GLN A 149 ? GLN A 146 . ? 1_555 ? 5 AC1 9 ASN A 151 ? ASN A 148 . ? 1_555 ? 6 AC1 9 SER A 152 ? SER A 149 . ? 1_555 ? 7 AC1 9 GLY A 153 ? GLY A 150 . ? 1_555 ? 8 AC1 9 HOH C . ? HOH A 311 . ? 1_555 ? 9 AC1 9 HOH C . ? HOH A 330 . ? 1_555 ? # _atom_sites.entry_id 6LFQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020327 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016775 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009935 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 SER 5 2 2 SER SER A . n A 1 6 ASN 6 3 3 ASN ASN A . n A 1 7 ILE 7 4 4 ILE ILE A . n A 1 8 THR 8 5 5 THR THR A . n A 1 9 TYR 9 6 6 TYR TYR A . n A 1 10 VAL 10 7 7 VAL VAL A . n A 1 11 LYS 11 8 8 LYS LYS A . n A 1 12 GLY 12 9 9 GLY GLY A . n A 1 13 ASN 13 10 10 ASN ASN A . n A 1 14 ILE 14 11 11 ILE ILE A . n A 1 15 LEU 15 12 12 LEU LEU A . n A 1 16 LYS 16 13 13 LYS LYS A . n A 1 17 PRO 17 14 14 PRO PRO A . n A 1 18 LYS 18 15 15 LYS LYS A . n A 1 19 SER 19 16 16 SER SER A . n A 1 20 TYR 20 17 17 TYR TYR A . n A 1 21 ALA 21 18 18 ALA ALA A . n A 1 22 ARG 22 19 19 ARG ARG A . n A 1 23 ILE 23 20 20 ILE ILE A . n A 1 24 LEU 24 21 21 LEU LEU A . n A 1 25 ILE 25 22 22 ILE ILE A . n A 1 26 HIS 26 23 23 HIS HIS A . n A 1 27 SER 27 24 24 SER SER A . n A 1 28 CYS 28 25 25 CYS CYS A . n A 1 29 ASN 29 26 26 ASN ASN A . n A 1 30 CYS 30 27 27 CYS CYS A . n A 1 31 ASN 31 28 28 ASN ASN A . n A 1 32 GLY 32 29 29 GLY GLY A . n A 1 33 SER 33 30 30 SER SER A . n A 1 34 TRP 34 31 31 TRP TRP A . n A 1 35 GLY 35 32 32 GLY GLY A . n A 1 36 GLY 36 33 33 GLY GLY A . n A 1 37 GLY 37 34 34 GLY GLY A . n A 1 38 ILE 38 35 35 ILE ILE A . n A 1 39 ALA 39 36 36 ALA ALA A . n A 1 40 TYR 40 37 37 TYR TYR A . n A 1 41 GLN 41 38 38 GLN GLN A . n A 1 42 LEU 42 39 39 LEU LEU A . n A 1 43 ALA 43 40 40 ALA ALA A . n A 1 44 LEU 44 41 41 LEU LEU A . n A 1 45 ARG 45 42 42 ARG ARG A . n A 1 46 TYR 46 43 43 TYR TYR A . n A 1 47 PRO 47 44 44 PRO PRO A . n A 1 48 LYS 48 45 45 LYS LYS A . n A 1 49 ALA 49 46 46 ALA ALA A . n A 1 50 GLU 50 47 47 GLU GLU A . n A 1 51 LYS 51 48 48 LYS LYS A . n A 1 52 ASP 52 49 49 ASP ASP A . n A 1 53 TYR 53 50 50 TYR TYR A . n A 1 54 VAL 54 51 51 VAL VAL A . n A 1 55 GLU 55 52 52 GLU GLU A . n A 1 56 VAL 56 53 53 VAL VAL A . n A 1 57 CYS 57 54 54 CYS CYS A . n A 1 58 GLU 58 55 55 GLU GLU A . n A 1 59 LYS 59 56 56 LYS LYS A . n A 1 60 TYR 60 57 57 TYR TYR A . n A 1 61 GLY 61 58 58 GLY GLY A . n A 1 62 SER 62 59 59 SER SER A . n A 1 63 ASN 63 60 60 ASN ASN A . n A 1 64 LEU 64 61 61 LEU LEU A . n A 1 65 LEU 65 62 62 LEU LEU A . n A 1 66 GLY 66 63 63 GLY GLY A . n A 1 67 LYS 67 64 64 LYS LYS A . n A 1 68 CYS 68 65 65 CYS CYS A . n A 1 69 ILE 69 66 66 ILE ILE A . n A 1 70 LEU 70 67 67 LEU LEU A . n A 1 71 LEU 71 68 68 LEU LEU A . n A 1 72 PRO 72 69 69 PRO PRO A . n A 1 73 SER 73 70 70 SER SER A . n A 1 74 TYR 74 71 71 TYR TYR A . n A 1 75 GLU 75 72 72 GLU GLU A . n A 1 76 ASN 76 73 73 ASN ASN A . n A 1 77 SER 77 74 74 SER SER A . n A 1 78 ASP 78 75 75 ASP ASP A . n A 1 79 LEU 79 76 76 LEU LEU A . n A 1 80 LEU 80 77 77 LEU LEU A . n A 1 81 ILE 81 78 78 ILE ILE A . n A 1 82 CYS 82 79 79 CYS CYS A . n A 1 83 CYS 83 80 80 CYS CYS A . n A 1 84 LEU 84 81 81 LEU LEU A . n A 1 85 PHE 85 82 82 PHE PHE A . n A 1 86 THR 86 83 83 THR THR A . n A 1 87 SER 87 84 84 SER SER A . n A 1 88 SER 88 85 85 SER SER A . n A 1 89 PHE 89 86 86 PHE PHE A . n A 1 90 GLY 90 87 87 GLY GLY A . n A 1 91 GLY 91 88 88 GLY GLY A . n A 1 92 SER 92 89 89 SER SER A . n A 1 93 SER 93 90 90 SER SER A . n A 1 94 HIS 94 91 91 HIS HIS A . n A 1 95 GLY 95 92 92 GLY GLY A . n A 1 96 GLU 96 93 93 GLU GLU A . n A 1 97 LYS 97 94 94 LYS LYS A . n A 1 98 GLN 98 95 95 GLN GLN A . n A 1 99 SER 99 96 96 SER SER A . n A 1 100 ILE 100 97 97 ILE ILE A . n A 1 101 LEU 101 98 98 LEU LEU A . n A 1 102 ASN 102 99 99 ASN ASN A . n A 1 103 TYR 103 100 100 TYR TYR A . n A 1 104 THR 104 101 101 THR THR A . n A 1 105 LYS 105 102 102 LYS LYS A . n A 1 106 LEU 106 103 103 LEU LEU A . n A 1 107 ALA 107 104 104 ALA ALA A . n A 1 108 LEU 108 105 105 LEU LEU A . n A 1 109 ASP 109 106 106 ASP ASP A . n A 1 110 LYS 110 107 107 LYS LYS A . n A 1 111 LEU 111 108 108 LEU LEU A . n A 1 112 LYS 112 109 109 LYS LYS A . n A 1 113 THR 113 110 110 THR THR A . n A 1 114 PHE 114 111 111 PHE PHE A . n A 1 115 ARG 115 112 112 ARG ARG A . n A 1 116 GLU 116 113 113 GLU GLU A . n A 1 117 ALA 117 114 114 ALA ALA A . n A 1 118 LYS 118 115 115 LYS LYS A . n A 1 119 ASP 119 116 116 ASP ASP A . n A 1 120 LYS 120 117 ? ? ? A . n A 1 121 THR 121 118 ? ? ? A . n A 1 122 ARG 122 119 ? ? ? A . n A 1 123 THR 123 120 ? ? ? A . n A 1 124 SER 124 121 ? ? ? A . n A 1 125 GLU 125 122 ? ? ? A . n A 1 126 ASP 126 123 ? ? ? A . n A 1 127 SER 127 124 124 SER SER A . n A 1 128 ILE 128 125 125 ILE ILE A . n A 1 129 GLY 129 126 126 GLY GLY A . n A 1 130 ASP 130 127 127 ASP ASP A . n A 1 131 TYR 131 128 128 TYR TYR A . n A 1 132 LEU 132 129 129 LEU LEU A . n A 1 133 ASN 133 130 130 ASN ASN A . n A 1 134 GLY 134 131 131 GLY GLY A . n A 1 135 HIS 135 132 132 HIS HIS A . n A 1 136 ILE 136 133 133 ILE ILE A . n A 1 137 LYS 137 134 134 LYS LYS A . n A 1 138 TYR 138 135 135 TYR TYR A . n A 1 139 PRO 139 136 136 PRO PRO A . n A 1 140 ILE 140 137 137 ILE ILE A . n A 1 141 GLY 141 138 138 GLY GLY A . n A 1 142 GLU 142 139 139 GLU GLU A . n A 1 143 TYR 143 140 140 TYR TYR A . n A 1 144 LYS 144 141 141 LYS LYS A . n A 1 145 LEU 145 142 142 LEU LEU A . n A 1 146 GLU 146 143 143 GLU GLU A . n A 1 147 MET 147 144 144 MET MET A . n A 1 148 PRO 148 145 145 PRO PRO A . n A 1 149 GLN 149 146 146 GLN GLN A . n A 1 150 ILE 150 147 147 ILE ILE A . n A 1 151 ASN 151 148 148 ASN ASN A . n A 1 152 SER 152 149 149 SER SER A . n A 1 153 GLY 153 150 150 GLY GLY A . n A 1 154 ILE 154 151 151 ILE ILE A . n A 1 155 PHE 155 152 152 PHE PHE A . n A 1 156 GLY 156 153 153 GLY GLY A . n A 1 157 VAL 157 154 154 VAL VAL A . n A 1 158 PRO 158 155 155 PRO PRO A . n A 1 159 TRP 159 156 156 TRP TRP A . n A 1 160 LYS 160 157 157 LYS LYS A . n A 1 161 GLU 161 158 158 GLU GLU A . n A 1 162 THR 162 159 159 THR THR A . n A 1 163 GLU 163 160 160 GLU GLU A . n A 1 164 ARG 164 161 161 ARG ARG A . n A 1 165 VAL 165 162 162 VAL VAL A . n A 1 166 LEU 166 163 163 LEU LEU A . n A 1 167 GLU 167 164 164 GLU GLU A . n A 1 168 GLU 168 165 165 GLU GLU A . n A 1 169 PHE 169 166 166 PHE PHE A . n A 1 170 SER 170 167 167 SER SER A . n A 1 171 GLY 171 168 168 GLY GLY A . n A 1 172 ASP 172 169 169 ASP ASP A . n A 1 173 MET 173 170 170 MET MET A . n A 1 174 SER 174 171 171 SER SER A . n A 1 175 PHE 175 172 172 PHE PHE A . n A 1 176 THR 176 173 173 THR THR A . n A 1 177 VAL 177 174 174 VAL VAL A . n A 1 178 TYR 178 175 175 TYR TYR A . n A 1 179 GLN 179 176 176 GLN GLN A . n A 1 180 LEU 180 177 177 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 201 1 GOL GOL A . C 3 HOH 1 301 49 HOH HOH A . C 3 HOH 2 302 8 HOH HOH A . C 3 HOH 3 303 14 HOH HOH A . C 3 HOH 4 304 50 HOH HOH A . C 3 HOH 5 305 10 HOH HOH A . C 3 HOH 6 306 17 HOH HOH A . C 3 HOH 7 307 1 HOH HOH A . C 3 HOH 8 308 20 HOH HOH A . C 3 HOH 9 309 18 HOH HOH A . C 3 HOH 10 310 37 HOH HOH A . C 3 HOH 11 311 2 HOH HOH A . C 3 HOH 12 312 35 HOH HOH A . C 3 HOH 13 313 25 HOH HOH A . C 3 HOH 14 314 23 HOH HOH A . C 3 HOH 15 315 4 HOH HOH A . C 3 HOH 16 316 30 HOH HOH A . C 3 HOH 17 317 12 HOH HOH A . C 3 HOH 18 318 5 HOH HOH A . C 3 HOH 19 319 15 HOH HOH A . C 3 HOH 20 320 42 HOH HOH A . C 3 HOH 21 321 32 HOH HOH A . C 3 HOH 22 322 28 HOH HOH A . C 3 HOH 23 323 3 HOH HOH A . C 3 HOH 24 324 13 HOH HOH A . C 3 HOH 25 325 39 HOH HOH A . C 3 HOH 26 326 16 HOH HOH A . C 3 HOH 27 327 33 HOH HOH A . C 3 HOH 28 328 38 HOH HOH A . C 3 HOH 29 329 34 HOH HOH A . C 3 HOH 30 330 43 HOH HOH A . C 3 HOH 31 331 19 HOH HOH A . C 3 HOH 32 332 40 HOH HOH A . C 3 HOH 33 333 9 HOH HOH A . C 3 HOH 34 334 46 HOH HOH A . C 3 HOH 35 335 6 HOH HOH A . C 3 HOH 36 336 29 HOH HOH A . C 3 HOH 37 337 36 HOH HOH A . C 3 HOH 38 338 11 HOH HOH A . C 3 HOH 39 339 47 HOH HOH A . C 3 HOH 40 340 44 HOH HOH A . C 3 HOH 41 341 45 HOH HOH A . C 3 HOH 42 342 52 HOH HOH A . C 3 HOH 43 343 26 HOH HOH A . C 3 HOH 44 344 51 HOH HOH A . C 3 HOH 45 345 7 HOH HOH A . C 3 HOH 46 346 41 HOH HOH A . C 3 HOH 47 347 27 HOH HOH A . C 3 HOH 48 348 31 HOH HOH A . C 3 HOH 49 349 24 HOH HOH A . C 3 HOH 50 350 48 HOH HOH A . C 3 HOH 51 351 22 HOH HOH A . C 3 HOH 52 352 21 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 260 ? 1 MORE -1 ? 1 'SSA (A^2)' 8270 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 310 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-12-09 2 'Structure model' 1 1 2022-06-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 2 'Structure model' '_citation_author.identifier_ORCID' 12 2 'Structure model' '_database_2.pdbx_DOI' 13 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 9.5787 11.1619 16.3263 0.1315 ? 0.0053 ? -0.0061 ? 0.1498 ? 0.0151 ? 0.1094 ? 0.6516 ? -0.4383 ? -0.4520 ? 0.1288 ? -0.0561 ? 0.4666 ? -0.0848 ? 0.0630 ? -0.2076 ? 0.0549 ? 0.0551 ? -0.0488 ? 0.0010 ? -0.0938 ? 0.0061 ? 2 'X-RAY DIFFRACTION' ? refined 13.1389 9.8725 11.9194 0.1158 ? 0.0083 ? -0.0790 ? 0.0774 ? -0.0367 ? 0.1580 ? 0.1445 ? -0.0141 ? 0.0002 ? 0.3281 ? -0.0389 ? 0.0379 ? -0.2802 ? 0.4244 ? 0.1584 ? -0.3497 ? 0.2725 ? 0.4862 ? 0.1697 ? 0.2722 ? -0.0431 ? 3 'X-RAY DIFFRACTION' ? refined 20.2973 19.5261 16.3802 0.1220 ? -0.0103 ? -0.0064 ? 0.1201 ? 0.0180 ? 0.1478 ? 0.2535 ? -0.0656 ? 0.0573 ? 0.0403 ? -0.0584 ? 0.0988 ? -0.0389 ? 0.0383 ? 0.0383 ? 0.0405 ? -0.0375 ? -0.2350 ? -0.1109 ? 0.0543 ? -0.0226 ? 4 'X-RAY DIFFRACTION' ? refined 14.9066 6.9534 2.5289 0.3415 ? 0.0070 ? -0.0652 ? 0.2038 ? -0.0312 ? 0.1113 ? 0.0262 ? 0.0327 ? 0.0206 ? 0.0970 ? -0.0676 ? 0.0773 ? 0.0026 ? 0.3444 ? -0.3875 ? 0.0006 ? -0.4850 ? 0.1497 ? 0.1133 ? 0.2895 ? -0.0092 ? 5 'X-RAY DIFFRACTION' ? refined 10.6595 24.5066 13.7312 0.1306 ? 0.0562 ? 0.0397 ? 0.1117 ? 0.0321 ? 0.1535 ? 0.4977 ? -0.0052 ? -0.1787 ? 0.2182 ? 0.0294 ? 0.3373 ? 0.1483 ? 0.0697 ? 0.1918 ? -0.0949 ? -0.0523 ? -0.2026 ? -0.4629 ? 0.0397 ? 0.0096 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 2 ? ? A 61 ? ;chain 'A' and (resid 2 through 61 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 62 ? ? A 84 ? ;chain 'A' and (resid 62 through 84 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 85 ? ? A 115 ? ;chain 'A' and (resid 85 through 115 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 116 ? ? A 136 ? ;chain 'A' and (resid 116 through 136 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 137 ? ? A 177 ? ;chain 'A' and (resid 137 through 177 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 6LFQ _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 347 ? ? O A HOH 349 ? ? 1.94 2 1 N A SER 2 ? ? O A HOH 301 ? ? 2.08 3 1 O A ILE 137 ? ? O A HOH 302 ? ? 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 71 ? ? 70.61 -43.93 2 1 ASN A 130 ? ? -50.28 102.13 3 1 ASN A 148 ? ? 71.09 -4.20 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A LYS 117 ? A LYS 120 6 1 Y 1 A THR 118 ? A THR 121 7 1 Y 1 A ARG 119 ? A ARG 122 8 1 Y 1 A THR 120 ? A THR 123 9 1 Y 1 A SER 121 ? A SER 124 10 1 Y 1 A GLU 122 ? A GLU 125 11 1 Y 1 A ASP 123 ? A ASP 126 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministry of Science and Technology (Taiwan)' Taiwan 108-2628-B-002-013 1 'Ministry of Science and Technology (Taiwan)' Taiwan 108-2113-M-002-011 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'monomeric protein' #