data_6LL6 # _entry.id 6LL6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6LL6 pdb_00006ll6 10.2210/pdb6ll6/pdb WWPDB D_1300015001 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-02-26 2 'Structure model' 1 1 2024-03-27 3 'Structure model' 1 2 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6LL6 _pdbx_database_status.recvd_initial_deposition_date 2019-12-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yoshizawa, T.' 1 ? 'Fujita, J.' 2 ? 'Terakada, H.' 3 ? 'Ozawa, M.' 4 ? 'Kuroda, N.' 5 ? 'Tanaka, S.' 6 ? 'Uehara, R.' 7 ? 'Matsumura, H.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_id_ASTM ACSFEN _citation.journal_id_CSD ? _citation.journal_id_ISSN 2053-230X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 76 _citation.language ? _citation.page_first 86 _citation.page_last 93 _citation.title 'Crystal structures of the cell-division protein FtsZ from Klebsiella pneumoniae and Escherichia coli.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2053230X2000076X _citation.pdbx_database_id_PubMed 32039890 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yoshizawa, T.' 1 ? primary 'Fujita, J.' 2 ? primary 'Terakado, H.' 3 ? primary 'Ozawa, M.' 4 ? primary 'Kuroda, N.' 5 ? primary 'Tanaka, S.I.' 6 ? primary 'Uehara, R.' 7 ? primary 'Matsumura, H.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cell division protein FtsZ' 31813.107 1 ? ? ? ? 2 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE" 443.201 1 ? ? ? ? 3 water nat water 18.015 10 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDA LRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDK LLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSP LLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIG ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDA LRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDK LLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSP LLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "GUANOSINE-5'-DIPHOSPHATE" GDP 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ALA n 1 5 VAL n 1 6 ILE n 1 7 LYS n 1 8 VAL n 1 9 ILE n 1 10 GLY n 1 11 VAL n 1 12 GLY n 1 13 GLY n 1 14 GLY n 1 15 GLY n 1 16 GLY n 1 17 ASN n 1 18 ALA n 1 19 VAL n 1 20 GLU n 1 21 HIS n 1 22 MET n 1 23 VAL n 1 24 ARG n 1 25 GLU n 1 26 ARG n 1 27 ILE n 1 28 GLU n 1 29 GLY n 1 30 VAL n 1 31 GLU n 1 32 PHE n 1 33 PHE n 1 34 ALA n 1 35 VAL n 1 36 ASN n 1 37 THR n 1 38 ASP n 1 39 ALA n 1 40 GLN n 1 41 ALA n 1 42 LEU n 1 43 ARG n 1 44 LYS n 1 45 THR n 1 46 ALA n 1 47 VAL n 1 48 GLY n 1 49 GLN n 1 50 THR n 1 51 ILE n 1 52 GLN n 1 53 ILE n 1 54 GLY n 1 55 SER n 1 56 GLY n 1 57 ILE n 1 58 THR n 1 59 LYS n 1 60 GLY n 1 61 LEU n 1 62 GLY n 1 63 ALA n 1 64 GLY n 1 65 ALA n 1 66 ASN n 1 67 PRO n 1 68 GLU n 1 69 VAL n 1 70 GLY n 1 71 ARG n 1 72 ASN n 1 73 ALA n 1 74 ALA n 1 75 ASP n 1 76 GLU n 1 77 ASP n 1 78 ARG n 1 79 ASP n 1 80 ALA n 1 81 LEU n 1 82 ARG n 1 83 ALA n 1 84 ALA n 1 85 LEU n 1 86 GLU n 1 87 GLY n 1 88 ALA n 1 89 ASP n 1 90 MET n 1 91 VAL n 1 92 PHE n 1 93 ILE n 1 94 ALA n 1 95 ALA n 1 96 GLY n 1 97 MET n 1 98 GLY n 1 99 GLY n 1 100 GLY n 1 101 THR n 1 102 GLY n 1 103 THR n 1 104 GLY n 1 105 ALA n 1 106 ALA n 1 107 PRO n 1 108 VAL n 1 109 VAL n 1 110 ALA n 1 111 GLU n 1 112 VAL n 1 113 ALA n 1 114 LYS n 1 115 ASP n 1 116 LEU n 1 117 GLY n 1 118 ILE n 1 119 LEU n 1 120 THR n 1 121 VAL n 1 122 ALA n 1 123 VAL n 1 124 VAL n 1 125 THR n 1 126 LYS n 1 127 PRO n 1 128 PHE n 1 129 ASN n 1 130 PHE n 1 131 GLU n 1 132 GLY n 1 133 LYS n 1 134 LYS n 1 135 ARG n 1 136 MET n 1 137 ALA n 1 138 PHE n 1 139 ALA n 1 140 GLU n 1 141 GLN n 1 142 GLY n 1 143 ILE n 1 144 THR n 1 145 GLU n 1 146 LEU n 1 147 SER n 1 148 LYS n 1 149 HIS n 1 150 VAL n 1 151 ASP n 1 152 SER n 1 153 LEU n 1 154 ILE n 1 155 THR n 1 156 ILE n 1 157 PRO n 1 158 ASN n 1 159 ASP n 1 160 LYS n 1 161 LEU n 1 162 LEU n 1 163 LYS n 1 164 VAL n 1 165 LEU n 1 166 GLY n 1 167 ARG n 1 168 GLY n 1 169 ILE n 1 170 SER n 1 171 LEU n 1 172 LEU n 1 173 ASP n 1 174 ALA n 1 175 PHE n 1 176 GLY n 1 177 ALA n 1 178 ALA n 1 179 ASN n 1 180 ASP n 1 181 VAL n 1 182 LEU n 1 183 LYS n 1 184 GLY n 1 185 ALA n 1 186 VAL n 1 187 GLN n 1 188 GLY n 1 189 ILE n 1 190 ALA n 1 191 GLU n 1 192 LEU n 1 193 ILE n 1 194 THR n 1 195 ARG n 1 196 PRO n 1 197 GLY n 1 198 LEU n 1 199 MET n 1 200 ASN n 1 201 VAL n 1 202 ASP n 1 203 PHE n 1 204 ALA n 1 205 ASP n 1 206 VAL n 1 207 ARG n 1 208 THR n 1 209 VAL n 1 210 MET n 1 211 SER n 1 212 GLU n 1 213 MET n 1 214 GLY n 1 215 TYR n 1 216 ALA n 1 217 MET n 1 218 MET n 1 219 GLY n 1 220 SER n 1 221 GLY n 1 222 VAL n 1 223 ALA n 1 224 SER n 1 225 GLY n 1 226 GLU n 1 227 ASP n 1 228 ARG n 1 229 ALA n 1 230 GLU n 1 231 GLU n 1 232 ALA n 1 233 ALA n 1 234 GLU n 1 235 MET n 1 236 ALA n 1 237 ILE n 1 238 SER n 1 239 SER n 1 240 PRO n 1 241 LEU n 1 242 LEU n 1 243 GLU n 1 244 ASP n 1 245 ILE n 1 246 ASP n 1 247 LEU n 1 248 SER n 1 249 GLY n 1 250 ALA n 1 251 ARG n 1 252 GLY n 1 253 VAL n 1 254 LEU n 1 255 VAL n 1 256 ASN n 1 257 ILE n 1 258 THR n 1 259 ALA n 1 260 GLY n 1 261 PHE n 1 262 ASP n 1 263 LEU n 1 264 ARG n 1 265 LEU n 1 266 ASP n 1 267 GLU n 1 268 PHE n 1 269 GLU n 1 270 THR n 1 271 VAL n 1 272 GLY n 1 273 ASN n 1 274 THR n 1 275 ILE n 1 276 ARG n 1 277 ALA n 1 278 PHE n 1 279 ALA n 1 280 SER n 1 281 ASP n 1 282 ASN n 1 283 ALA n 1 284 THR n 1 285 VAL n 1 286 VAL n 1 287 ILE n 1 288 GLY n 1 289 THR n 1 290 SER n 1 291 LEU n 1 292 ASP n 1 293 PRO n 1 294 ASP n 1 295 MET n 1 296 ASN n 1 297 ASP n 1 298 GLU n 1 299 LEU n 1 300 ARG n 1 301 VAL n 1 302 THR n 1 303 VAL n 1 304 VAL n 1 305 ALA n 1 306 THR n 1 307 GLY n 1 308 ILE n 1 309 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 309 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ftsZ, DNQ45_06620' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 83333 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GDP 'RNA linking' n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 8 ? ? ? A . n A 1 2 HIS 2 9 ? ? ? A . n A 1 3 MET 3 10 ? ? ? A . n A 1 4 ALA 4 11 11 ALA ALA A . n A 1 5 VAL 5 12 12 VAL VAL A . n A 1 6 ILE 6 13 13 ILE ILE A . n A 1 7 LYS 7 14 14 LYS LYS A . n A 1 8 VAL 8 15 15 VAL VAL A . n A 1 9 ILE 9 16 16 ILE ILE A . n A 1 10 GLY 10 17 17 GLY GLY A . n A 1 11 VAL 11 18 18 VAL VAL A . n A 1 12 GLY 12 19 19 GLY GLY A . n A 1 13 GLY 13 20 20 GLY GLY A . n A 1 14 GLY 14 21 21 GLY GLY A . n A 1 15 GLY 15 22 22 GLY GLY A . n A 1 16 GLY 16 23 23 GLY GLY A . n A 1 17 ASN 17 24 24 ASN ASN A . n A 1 18 ALA 18 25 25 ALA ALA A . n A 1 19 VAL 19 26 26 VAL VAL A . n A 1 20 GLU 20 27 27 GLU GLU A . n A 1 21 HIS 21 28 28 HIS HIS A . n A 1 22 MET 22 29 29 MET MET A . n A 1 23 VAL 23 30 30 VAL VAL A . n A 1 24 ARG 24 31 31 ARG ARG A . n A 1 25 GLU 25 32 32 GLU GLU A . n A 1 26 ARG 26 33 33 ARG ARG A . n A 1 27 ILE 27 34 34 ILE ILE A . n A 1 28 GLU 28 35 35 GLU GLU A . n A 1 29 GLY 29 36 36 GLY GLY A . n A 1 30 VAL 30 37 37 VAL VAL A . n A 1 31 GLU 31 38 38 GLU GLU A . n A 1 32 PHE 32 39 39 PHE PHE A . n A 1 33 PHE 33 40 40 PHE PHE A . n A 1 34 ALA 34 41 41 ALA ALA A . n A 1 35 VAL 35 42 42 VAL VAL A . n A 1 36 ASN 36 43 43 ASN ASN A . n A 1 37 THR 37 44 44 THR THR A . n A 1 38 ASP 38 45 45 ASP ASP A . n A 1 39 ALA 39 46 46 ALA ALA A . n A 1 40 GLN 40 47 47 GLN GLN A . n A 1 41 ALA 41 48 48 ALA ALA A . n A 1 42 LEU 42 49 49 LEU LEU A . n A 1 43 ARG 43 50 50 ARG ARG A . n A 1 44 LYS 44 51 51 LYS LYS A . n A 1 45 THR 45 52 52 THR THR A . n A 1 46 ALA 46 53 53 ALA ALA A . n A 1 47 VAL 47 54 54 VAL VAL A . n A 1 48 GLY 48 55 55 GLY GLY A . n A 1 49 GLN 49 56 56 GLN GLN A . n A 1 50 THR 50 57 57 THR THR A . n A 1 51 ILE 51 58 58 ILE ILE A . n A 1 52 GLN 52 59 59 GLN GLN A . n A 1 53 ILE 53 60 60 ILE ILE A . n A 1 54 GLY 54 61 61 GLY GLY A . n A 1 55 SER 55 62 62 SER SER A . n A 1 56 GLY 56 63 ? ? ? A . n A 1 57 ILE 57 64 ? ? ? A . n A 1 58 THR 58 65 ? ? ? A . n A 1 59 LYS 59 66 ? ? ? A . n A 1 60 GLY 60 67 ? ? ? A . n A 1 61 LEU 61 68 68 LEU LEU A . n A 1 62 GLY 62 69 69 GLY GLY A . n A 1 63 ALA 63 70 70 ALA ALA A . n A 1 64 GLY 64 71 71 GLY GLY A . n A 1 65 ALA 65 72 72 ALA ALA A . n A 1 66 ASN 66 73 73 ASN ASN A . n A 1 67 PRO 67 74 74 PRO PRO A . n A 1 68 GLU 68 75 75 GLU GLU A . n A 1 69 VAL 69 76 76 VAL VAL A . n A 1 70 GLY 70 77 77 GLY GLY A . n A 1 71 ARG 71 78 78 ARG ARG A . n A 1 72 ASN 72 79 79 ASN ASN A . n A 1 73 ALA 73 80 80 ALA ALA A . n A 1 74 ALA 74 81 81 ALA ALA A . n A 1 75 ASP 75 82 82 ASP ASP A . n A 1 76 GLU 76 83 83 GLU GLU A . n A 1 77 ASP 77 84 84 ASP ASP A . n A 1 78 ARG 78 85 85 ARG ARG A . n A 1 79 ASP 79 86 86 ASP ASP A . n A 1 80 ALA 80 87 87 ALA ALA A . n A 1 81 LEU 81 88 88 LEU LEU A . n A 1 82 ARG 82 89 89 ARG ARG A . n A 1 83 ALA 83 90 90 ALA ALA A . n A 1 84 ALA 84 91 91 ALA ALA A . n A 1 85 LEU 85 92 92 LEU LEU A . n A 1 86 GLU 86 93 93 GLU GLU A . n A 1 87 GLY 87 94 94 GLY GLY A . n A 1 88 ALA 88 95 95 ALA ALA A . n A 1 89 ASP 89 96 96 ASP ASP A . n A 1 90 MET 90 97 97 MET MET A . n A 1 91 VAL 91 98 98 VAL VAL A . n A 1 92 PHE 92 99 99 PHE PHE A . n A 1 93 ILE 93 100 100 ILE ILE A . n A 1 94 ALA 94 101 101 ALA ALA A . n A 1 95 ALA 95 102 102 ALA ALA A . n A 1 96 GLY 96 103 103 GLY GLY A . n A 1 97 MET 97 104 104 MET MET A . n A 1 98 GLY 98 105 105 GLY GLY A . n A 1 99 GLY 99 106 106 GLY GLY A . n A 1 100 GLY 100 107 107 GLY GLY A . n A 1 101 THR 101 108 108 THR THR A . n A 1 102 GLY 102 109 109 GLY GLY A . n A 1 103 THR 103 110 110 THR THR A . n A 1 104 GLY 104 111 111 GLY GLY A . n A 1 105 ALA 105 112 112 ALA ALA A . n A 1 106 ALA 106 113 113 ALA ALA A . n A 1 107 PRO 107 114 114 PRO PRO A . n A 1 108 VAL 108 115 115 VAL VAL A . n A 1 109 VAL 109 116 116 VAL VAL A . n A 1 110 ALA 110 117 117 ALA ALA A . n A 1 111 GLU 111 118 118 GLU GLU A . n A 1 112 VAL 112 119 119 VAL VAL A . n A 1 113 ALA 113 120 120 ALA ALA A . n A 1 114 LYS 114 121 121 LYS LYS A . n A 1 115 ASP 115 122 122 ASP ASP A . n A 1 116 LEU 116 123 123 LEU LEU A . n A 1 117 GLY 117 124 124 GLY GLY A . n A 1 118 ILE 118 125 125 ILE ILE A . n A 1 119 LEU 119 126 126 LEU LEU A . n A 1 120 THR 120 127 127 THR THR A . n A 1 121 VAL 121 128 128 VAL VAL A . n A 1 122 ALA 122 129 129 ALA ALA A . n A 1 123 VAL 123 130 130 VAL VAL A . n A 1 124 VAL 124 131 131 VAL VAL A . n A 1 125 THR 125 132 132 THR THR A . n A 1 126 LYS 126 133 133 LYS LYS A . n A 1 127 PRO 127 134 134 PRO PRO A . n A 1 128 PHE 128 135 135 PHE PHE A . n A 1 129 ASN 129 136 136 ASN ASN A . n A 1 130 PHE 130 137 137 PHE PHE A . n A 1 131 GLU 131 138 138 GLU GLU A . n A 1 132 GLY 132 139 139 GLY GLY A . n A 1 133 LYS 133 140 140 LYS LYS A . n A 1 134 LYS 134 141 141 LYS LYS A . n A 1 135 ARG 135 142 142 ARG ARG A . n A 1 136 MET 136 143 143 MET MET A . n A 1 137 ALA 137 144 144 ALA ALA A . n A 1 138 PHE 138 145 145 PHE PHE A . n A 1 139 ALA 139 146 146 ALA ALA A . n A 1 140 GLU 140 147 147 GLU GLU A . n A 1 141 GLN 141 148 148 GLN GLN A . n A 1 142 GLY 142 149 149 GLY GLY A . n A 1 143 ILE 143 150 150 ILE ILE A . n A 1 144 THR 144 151 151 THR THR A . n A 1 145 GLU 145 152 152 GLU GLU A . n A 1 146 LEU 146 153 153 LEU LEU A . n A 1 147 SER 147 154 154 SER SER A . n A 1 148 LYS 148 155 155 LYS LYS A . n A 1 149 HIS 149 156 156 HIS HIS A . n A 1 150 VAL 150 157 157 VAL VAL A . n A 1 151 ASP 151 158 158 ASP ASP A . n A 1 152 SER 152 159 159 SER SER A . n A 1 153 LEU 153 160 160 LEU LEU A . n A 1 154 ILE 154 161 161 ILE ILE A . n A 1 155 THR 155 162 162 THR THR A . n A 1 156 ILE 156 163 163 ILE ILE A . n A 1 157 PRO 157 164 164 PRO PRO A . n A 1 158 ASN 158 165 165 ASN ASN A . n A 1 159 ASP 159 166 166 ASP ASP A . n A 1 160 LYS 160 167 167 LYS LYS A . n A 1 161 LEU 161 168 168 LEU LEU A . n A 1 162 LEU 162 169 169 LEU LEU A . n A 1 163 LYS 163 170 170 LYS ALA A . n A 1 164 VAL 164 171 171 VAL VAL A . n A 1 165 LEU 165 172 172 LEU LEU A . n A 1 166 GLY 166 173 173 GLY GLY A . n A 1 167 ARG 167 174 174 ARG ARG A . n A 1 168 GLY 168 175 175 GLY GLY A . n A 1 169 ILE 169 176 176 ILE ILE A . n A 1 170 SER 170 177 177 SER SER A . n A 1 171 LEU 171 178 178 LEU LEU A . n A 1 172 LEU 172 179 179 LEU LEU A . n A 1 173 ASP 173 180 180 ASP ASP A . n A 1 174 ALA 174 181 181 ALA ALA A . n A 1 175 PHE 175 182 182 PHE PHE A . n A 1 176 GLY 176 183 183 GLY GLY A . n A 1 177 ALA 177 184 184 ALA ALA A . n A 1 178 ALA 178 185 185 ALA ALA A . n A 1 179 ASN 179 186 186 ASN ASN A . n A 1 180 ASP 180 187 187 ASP ASP A . n A 1 181 VAL 181 188 188 VAL VAL A . n A 1 182 LEU 182 189 189 LEU LEU A . n A 1 183 LYS 183 190 190 LYS LYS A . n A 1 184 GLY 184 191 191 GLY GLY A . n A 1 185 ALA 185 192 192 ALA ALA A . n A 1 186 VAL 186 193 193 VAL VAL A . n A 1 187 GLN 187 194 194 GLN GLN A . n A 1 188 GLY 188 195 195 GLY GLY A . n A 1 189 ILE 189 196 196 ILE ILE A . n A 1 190 ALA 190 197 197 ALA ALA A . n A 1 191 GLU 191 198 198 GLU GLU A . n A 1 192 LEU 192 199 199 LEU LEU A . n A 1 193 ILE 193 200 200 ILE ILE A . n A 1 194 THR 194 201 201 THR THR A . n A 1 195 ARG 195 202 202 ARG ARG A . n A 1 196 PRO 196 203 203 PRO PRO A . n A 1 197 GLY 197 204 204 GLY GLY A . n A 1 198 LEU 198 205 205 LEU LEU A . n A 1 199 MET 199 206 206 MET MET A . n A 1 200 ASN 200 207 207 ASN ASN A . n A 1 201 VAL 201 208 208 VAL VAL A . n A 1 202 ASP 202 209 209 ASP ASP A . n A 1 203 PHE 203 210 210 PHE PHE A . n A 1 204 ALA 204 211 211 ALA ALA A . n A 1 205 ASP 205 212 212 ASP ASP A . n A 1 206 VAL 206 213 213 VAL VAL A . n A 1 207 ARG 207 214 214 ARG ARG A . n A 1 208 THR 208 215 215 THR THR A . n A 1 209 VAL 209 216 216 VAL VAL A . n A 1 210 MET 210 217 217 MET MET A . n A 1 211 SER 211 218 218 SER SER A . n A 1 212 GLU 212 219 219 GLU GLU A . n A 1 213 MET 213 220 220 MET MET A . n A 1 214 GLY 214 221 221 GLY GLY A . n A 1 215 TYR 215 222 222 TYR TYR A . n A 1 216 ALA 216 223 223 ALA ALA A . n A 1 217 MET 217 224 224 MET MET A . n A 1 218 MET 218 225 225 MET MET A . n A 1 219 GLY 219 226 226 GLY GLY A . n A 1 220 SER 220 227 227 SER SER A . n A 1 221 GLY 221 228 228 GLY GLY A . n A 1 222 VAL 222 229 229 VAL VAL A . n A 1 223 ALA 223 230 230 ALA ALA A . n A 1 224 SER 224 231 231 SER SER A . n A 1 225 GLY 225 232 232 GLY GLY A . n A 1 226 GLU 226 233 233 GLU GLU A . n A 1 227 ASP 227 234 234 ASP ASP A . n A 1 228 ARG 228 235 235 ARG ARG A . n A 1 229 ALA 229 236 236 ALA ALA A . n A 1 230 GLU 230 237 237 GLU GLU A . n A 1 231 GLU 231 238 238 GLU GLU A . n A 1 232 ALA 232 239 239 ALA ALA A . n A 1 233 ALA 233 240 240 ALA ALA A . n A 1 234 GLU 234 241 241 GLU GLU A . n A 1 235 MET 235 242 242 MET MET A . n A 1 236 ALA 236 243 243 ALA ALA A . n A 1 237 ILE 237 244 244 ILE ILE A . n A 1 238 SER 238 245 245 SER SER A . n A 1 239 SER 239 246 246 SER SER A . n A 1 240 PRO 240 247 247 PRO PRO A . n A 1 241 LEU 241 248 248 LEU LEU A . n A 1 242 LEU 242 249 249 LEU LEU A . n A 1 243 GLU 243 250 250 GLU GLU A . n A 1 244 ASP 244 251 251 ASP ASP A . n A 1 245 ILE 245 252 252 ILE ILE A . n A 1 246 ASP 246 253 253 ASP ASP A . n A 1 247 LEU 247 254 254 LEU LEU A . n A 1 248 SER 248 255 255 SER SER A . n A 1 249 GLY 249 256 256 GLY GLY A . n A 1 250 ALA 250 257 257 ALA ALA A . n A 1 251 ARG 251 258 258 ARG ARG A . n A 1 252 GLY 252 259 259 GLY GLY A . n A 1 253 VAL 253 260 260 VAL VAL A . n A 1 254 LEU 254 261 261 LEU LEU A . n A 1 255 VAL 255 262 262 VAL VAL A . n A 1 256 ASN 256 263 263 ASN ASN A . n A 1 257 ILE 257 264 264 ILE ILE A . n A 1 258 THR 258 265 265 THR THR A . n A 1 259 ALA 259 266 266 ALA ALA A . n A 1 260 GLY 260 267 267 GLY GLY A . n A 1 261 PHE 261 268 268 PHE PHE A . n A 1 262 ASP 262 269 269 ASP ASP A . n A 1 263 LEU 263 270 270 LEU LEU A . n A 1 264 ARG 264 271 271 ARG ARG A . n A 1 265 LEU 265 272 272 LEU LEU A . n A 1 266 ASP 266 273 273 ASP ASP A . n A 1 267 GLU 267 274 274 GLU GLU A . n A 1 268 PHE 268 275 275 PHE PHE A . n A 1 269 GLU 269 276 276 GLU GLU A . n A 1 270 THR 270 277 277 THR THR A . n A 1 271 VAL 271 278 278 VAL VAL A . n A 1 272 GLY 272 279 279 GLY GLY A . n A 1 273 ASN 273 280 280 ASN ASN A . n A 1 274 THR 274 281 281 THR THR A . n A 1 275 ILE 275 282 282 ILE ILE A . n A 1 276 ARG 276 283 283 ARG ARG A . n A 1 277 ALA 277 284 284 ALA ALA A . n A 1 278 PHE 278 285 285 PHE PHE A . n A 1 279 ALA 279 286 286 ALA ALA A . n A 1 280 SER 280 287 287 SER SER A . n A 1 281 ASP 281 288 288 ASP ASP A . n A 1 282 ASN 282 289 289 ASN ASN A . n A 1 283 ALA 283 290 290 ALA ALA A . n A 1 284 THR 284 291 291 THR THR A . n A 1 285 VAL 285 292 292 VAL VAL A . n A 1 286 VAL 286 293 293 VAL VAL A . n A 1 287 ILE 287 294 294 ILE ILE A . n A 1 288 GLY 288 295 295 GLY GLY A . n A 1 289 THR 289 296 296 THR THR A . n A 1 290 SER 290 297 297 SER SER A . n A 1 291 LEU 291 298 298 LEU LEU A . n A 1 292 ASP 292 299 299 ASP ASP A . n A 1 293 PRO 293 300 300 PRO PRO A . n A 1 294 ASP 294 301 301 ASP ASP A . n A 1 295 MET 295 302 302 MET MET A . n A 1 296 ASN 296 303 303 ASN ASN A . n A 1 297 ASP 297 304 304 ASP ASP A . n A 1 298 GLU 298 305 305 GLU GLU A . n A 1 299 LEU 299 306 306 LEU LEU A . n A 1 300 ARG 300 307 307 ARG ARG A . n A 1 301 VAL 301 308 308 VAL VAL A . n A 1 302 THR 302 309 309 THR THR A . n A 1 303 VAL 303 310 310 VAL VAL A . n A 1 304 VAL 304 311 311 VAL VAL A . n A 1 305 ALA 305 312 312 ALA ALA A . n A 1 306 THR 306 313 313 THR THR A . n A 1 307 GLY 307 314 314 GLY GLY A . n A 1 308 ILE 308 315 315 ILE ILE A . n A 1 309 GLY 309 316 316 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GDP 1 401 401 GDP GDP A . C 3 HOH 1 501 9 HOH HOH A . C 3 HOH 2 502 7 HOH HOH A . C 3 HOH 3 503 3 HOH HOH A . C 3 HOH 4 504 2 HOH HOH A . C 3 HOH 5 505 1 HOH HOH A . C 3 HOH 6 506 4 HOH HOH A . C 3 HOH 7 507 10 HOH HOH A . C 3 HOH 8 508 8 HOH HOH A . C 3 HOH 9 509 5 HOH HOH A . C 3 HOH 10 510 11 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 170 ? CG ? A LYS 163 CG 2 1 Y 1 A LYS 170 ? CD ? A LYS 163 CD 3 1 Y 1 A LYS 170 ? CE ? A LYS 163 CE 4 1 Y 1 A LYS 170 ? NZ ? A LYS 163 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 88.789 _cell.angle_alpha_esd ? _cell.angle_beta 72.057 _cell.angle_beta_esd ? _cell.angle_gamma 72.445 _cell.angle_gamma_esd ? _cell.entry_id 6LL6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.280 _cell.length_a_esd ? _cell.length_b 41.670 _cell.length_b_esd ? _cell.length_c 45.030 _cell.length_c_esd ? _cell.volume 64948.229 _cell.volume_esd ? _cell.Z_PDB 1 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6LL6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall 'P 1' _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6LL6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.04 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.75 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PCB buffer, PEG 1500' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-07-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL32XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL32XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 41.33 _reflns.entry_id 6LL6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.50 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8681 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.64 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.975 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.56 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 869 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.856 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 44.22 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6LL6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.50 _refine.ls_d_res_low 42.71 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8678 _refine.ls_number_reflns_R_free 433 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.76 _refine.ls_percent_reflns_R_free 4.99 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1865 _refine.ls_R_factor_R_free 0.2415 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1836 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.97 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model unreleased _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.3589 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3197 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 42.71 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 2205 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2167 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0078 ? 2216 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0081 ? 3003 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0568 ? 359 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0045 ? 396 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 20.7830 ? 797 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.50 2.86 . . 143 2737 99.76 . . . 0.2983 . 0.2132 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.86 3.61 . . 145 2756 99.79 . . . 0.2707 . 0.2059 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.61 42.71 . . 145 2752 99.72 . . . 0.2110 . 0.1638 . . . . . . . . . . . # _struct.entry_id 6LL6 _struct.title 'Crsyal structure of EcFtsZ (residues 11-316)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6LL6 _struct_keywords.text 'cell division, Escherichia coli, CELL CYCLE' _struct_keywords.pdbx_keywords 'CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A2W6PFK5_ECOLX _struct_ref.pdbx_db_accession A0A2W6PFK5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRA ALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLK VLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLE DIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIG ; _struct_ref.pdbx_align_begin 11 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6LL6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 309 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A2W6PFK5 _struct_ref_seq.db_align_beg 11 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 316 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 11 _struct_ref_seq.pdbx_auth_seq_align_end 316 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6LL6 GLY A 1 ? UNP A0A2W6PFK5 ? ? 'expression tag' 8 1 1 6LL6 HIS A 2 ? UNP A0A2W6PFK5 ? ? 'expression tag' 9 2 1 6LL6 MET A 3 ? UNP A0A2W6PFK5 ? ? 'expression tag' 10 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 770 ? 1 MORE -5 ? 1 'SSA (A^2)' 12890 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 12 ? ARG A 26 ? GLY A 19 ARG A 33 1 ? 15 HELX_P HELX_P2 AA2 ASP A 38 ? THR A 45 ? ASP A 45 THR A 52 1 ? 8 HELX_P HELX_P3 AA3 ASN A 66 ? GLU A 76 ? ASN A 73 GLU A 83 1 ? 11 HELX_P HELX_P4 AA4 ASP A 77 ? GLU A 86 ? ASP A 84 GLU A 93 1 ? 10 HELX_P HELX_P5 AA5 GLY A 100 ? LEU A 116 ? GLY A 107 LEU A 123 1 ? 17 HELX_P HELX_P6 AA6 PHE A 128 ? GLU A 131 ? PHE A 135 GLU A 138 5 ? 4 HELX_P HELX_P7 AA7 GLY A 132 ? SER A 147 ? GLY A 139 SER A 154 1 ? 16 HELX_P HELX_P8 AA8 ASP A 159 ? VAL A 164 ? ASP A 166 VAL A 171 5 ? 6 HELX_P HELX_P9 AA9 SER A 170 ? ARG A 195 ? SER A 177 ARG A 202 1 ? 26 HELX_P HELX_P10 AB1 ASP A 202 ? SER A 211 ? ASP A 209 SER A 218 1 ? 10 HELX_P HELX_P11 AB2 ASP A 227 ? SER A 238 ? ASP A 234 SER A 245 1 ? 12 HELX_P HELX_P12 AB3 SER A 239 ? GLU A 243 ? SER A 246 GLU A 250 5 ? 5 HELX_P HELX_P13 AB4 ASP A 246 ? ALA A 250 ? ASP A 253 ALA A 257 5 ? 5 HELX_P HELX_P14 AB5 ARG A 264 ? ALA A 279 ? ARG A 271 ALA A 286 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 49 ? GLN A 52 ? GLN A 56 GLN A 59 AA1 2 VAL A 30 ? ASN A 36 ? VAL A 37 ASN A 43 AA1 3 ILE A 6 ? VAL A 11 ? ILE A 13 VAL A 18 AA1 4 MET A 90 ? GLY A 96 ? MET A 97 GLY A 103 AA1 5 LEU A 119 ? LYS A 126 ? LEU A 126 LYS A 133 AA1 6 SER A 152 ? PRO A 157 ? SER A 159 PRO A 164 AA1 7 GLY A 214 ? SER A 224 ? GLY A 221 SER A 231 AA1 8 GLU A 298 ? THR A 306 ? GLU A 305 THR A 313 AA1 9 GLY A 252 ? ALA A 259 ? GLY A 259 ALA A 266 AA1 10 THR A 284 ? LEU A 291 ? THR A 291 LEU A 298 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 51 ? O ILE A 58 N ALA A 34 ? N ALA A 41 AA1 2 3 O GLU A 31 ? O GLU A 38 N VAL A 8 ? N VAL A 15 AA1 3 4 N ILE A 9 ? N ILE A 16 O PHE A 92 ? O PHE A 99 AA1 4 5 N ILE A 93 ? N ILE A 100 O VAL A 123 ? O VAL A 130 AA1 5 6 N ALA A 122 ? N ALA A 129 O ILE A 154 ? O ILE A 161 AA1 6 7 N LEU A 153 ? N LEU A 160 O ALA A 216 ? O ALA A 223 AA1 7 8 N GLY A 219 ? N GLY A 226 O VAL A 303 ? O VAL A 310 AA1 8 9 O ARG A 300 ? O ARG A 307 N THR A 258 ? N THR A 265 AA1 9 10 N ILE A 257 ? N ILE A 264 O SER A 290 ? O SER A 297 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id GDP _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 15 _struct_site.details 'binding site for residue GDP A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 GLY A 12 ? GLY A 19 . ? 1_555 ? 2 AC1 15 GLY A 13 ? GLY A 20 . ? 1_555 ? 3 AC1 15 GLY A 14 ? GLY A 21 . ? 1_555 ? 4 AC1 15 ASN A 17 ? ASN A 24 . ? 1_555 ? 5 AC1 15 GLY A 96 ? GLY A 103 . ? 1_555 ? 6 AC1 15 GLY A 99 ? GLY A 106 . ? 1_555 ? 7 AC1 15 GLY A 100 ? GLY A 107 . ? 1_555 ? 8 AC1 15 THR A 101 ? THR A 108 . ? 1_555 ? 9 AC1 15 GLY A 102 ? GLY A 109 . ? 1_555 ? 10 AC1 15 PRO A 127 ? PRO A 134 . ? 1_555 ? 11 AC1 15 GLU A 131 ? GLU A 138 . ? 1_555 ? 12 AC1 15 PHE A 175 ? PHE A 182 . ? 1_555 ? 13 AC1 15 ASN A 179 ? ASN A 186 . ? 1_555 ? 14 AC1 15 HOH C . ? HOH A 503 . ? 1_555 ? 15 AC1 15 HOH C . ? HOH A 506 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 33 ? ? 71.21 120.91 2 1 ARG A 174 ? ? 70.81 -158.85 3 1 ARG A 202 ? ? -158.60 55.08 4 1 ASN A 303 ? ? -105.74 -66.98 # _space_group_symop.id 1 _space_group_symop.operation_xyz x,y,z # _pdbx_entry_details.entry_id 6LL6 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 8 ? A GLY 1 2 1 Y 1 A HIS 9 ? A HIS 2 3 1 Y 1 A MET 10 ? A MET 3 4 1 Y 1 A GLY 63 ? A GLY 56 5 1 Y 1 A ILE 64 ? A ILE 57 6 1 Y 1 A THR 65 ? A THR 58 7 1 Y 1 A LYS 66 ? A LYS 59 8 1 Y 1 A GLY 67 ? A GLY 60 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GDP PB P N N 74 GDP O1B O N N 75 GDP O2B O N N 76 GDP O3B O N N 77 GDP O3A O N N 78 GDP PA P N N 79 GDP O1A O N N 80 GDP O2A O N N 81 GDP "O5'" O N N 82 GDP "C5'" C N N 83 GDP "C4'" C N R 84 GDP "O4'" O N N 85 GDP "C3'" C N S 86 GDP "O3'" O N N 87 GDP "C2'" C N R 88 GDP "O2'" O N N 89 GDP "C1'" C N R 90 GDP N9 N Y N 91 GDP C8 C Y N 92 GDP N7 N Y N 93 GDP C5 C Y N 94 GDP C6 C N N 95 GDP O6 O N N 96 GDP N1 N N N 97 GDP C2 C N N 98 GDP N2 N N N 99 GDP N3 N N N 100 GDP C4 C Y N 101 GDP HOB2 H N N 102 GDP HOB3 H N N 103 GDP HOA2 H N N 104 GDP "H5'" H N N 105 GDP "H5''" H N N 106 GDP "H4'" H N N 107 GDP "H3'" H N N 108 GDP "HO3'" H N N 109 GDP "H2'" H N N 110 GDP "HO2'" H N N 111 GDP "H1'" H N N 112 GDP H8 H N N 113 GDP HN1 H N N 114 GDP HN21 H N N 115 GDP HN22 H N N 116 GLN N N N N 117 GLN CA C N S 118 GLN C C N N 119 GLN O O N N 120 GLN CB C N N 121 GLN CG C N N 122 GLN CD C N N 123 GLN OE1 O N N 124 GLN NE2 N N N 125 GLN OXT O N N 126 GLN H H N N 127 GLN H2 H N N 128 GLN HA H N N 129 GLN HB2 H N N 130 GLN HB3 H N N 131 GLN HG2 H N N 132 GLN HG3 H N N 133 GLN HE21 H N N 134 GLN HE22 H N N 135 GLN HXT H N N 136 GLU N N N N 137 GLU CA C N S 138 GLU C C N N 139 GLU O O N N 140 GLU CB C N N 141 GLU CG C N N 142 GLU CD C N N 143 GLU OE1 O N N 144 GLU OE2 O N N 145 GLU OXT O N N 146 GLU H H N N 147 GLU H2 H N N 148 GLU HA H N N 149 GLU HB2 H N N 150 GLU HB3 H N N 151 GLU HG2 H N N 152 GLU HG3 H N N 153 GLU HE2 H N N 154 GLU HXT H N N 155 GLY N N N N 156 GLY CA C N N 157 GLY C C N N 158 GLY O O N N 159 GLY OXT O N N 160 GLY H H N N 161 GLY H2 H N N 162 GLY HA2 H N N 163 GLY HA3 H N N 164 GLY HXT H N N 165 HIS N N N N 166 HIS CA C N S 167 HIS C C N N 168 HIS O O N N 169 HIS CB C N N 170 HIS CG C Y N 171 HIS ND1 N Y N 172 HIS CD2 C Y N 173 HIS CE1 C Y N 174 HIS NE2 N Y N 175 HIS OXT O N N 176 HIS H H N N 177 HIS H2 H N N 178 HIS HA H N N 179 HIS HB2 H N N 180 HIS HB3 H N N 181 HIS HD1 H N N 182 HIS HD2 H N N 183 HIS HE1 H N N 184 HIS HE2 H N N 185 HIS HXT H N N 186 HOH O O N N 187 HOH H1 H N N 188 HOH H2 H N N 189 ILE N N N N 190 ILE CA C N S 191 ILE C C N N 192 ILE O O N N 193 ILE CB C N S 194 ILE CG1 C N N 195 ILE CG2 C N N 196 ILE CD1 C N N 197 ILE OXT O N N 198 ILE H H N N 199 ILE H2 H N N 200 ILE HA H N N 201 ILE HB H N N 202 ILE HG12 H N N 203 ILE HG13 H N N 204 ILE HG21 H N N 205 ILE HG22 H N N 206 ILE HG23 H N N 207 ILE HD11 H N N 208 ILE HD12 H N N 209 ILE HD13 H N N 210 ILE HXT H N N 211 LEU N N N N 212 LEU CA C N S 213 LEU C C N N 214 LEU O O N N 215 LEU CB C N N 216 LEU CG C N N 217 LEU CD1 C N N 218 LEU CD2 C N N 219 LEU OXT O N N 220 LEU H H N N 221 LEU H2 H N N 222 LEU HA H N N 223 LEU HB2 H N N 224 LEU HB3 H N N 225 LEU HG H N N 226 LEU HD11 H N N 227 LEU HD12 H N N 228 LEU HD13 H N N 229 LEU HD21 H N N 230 LEU HD22 H N N 231 LEU HD23 H N N 232 LEU HXT H N N 233 LYS N N N N 234 LYS CA C N S 235 LYS C C N N 236 LYS O O N N 237 LYS CB C N N 238 LYS CG C N N 239 LYS CD C N N 240 LYS CE C N N 241 LYS NZ N N N 242 LYS OXT O N N 243 LYS H H N N 244 LYS H2 H N N 245 LYS HA H N N 246 LYS HB2 H N N 247 LYS HB3 H N N 248 LYS HG2 H N N 249 LYS HG3 H N N 250 LYS HD2 H N N 251 LYS HD3 H N N 252 LYS HE2 H N N 253 LYS HE3 H N N 254 LYS HZ1 H N N 255 LYS HZ2 H N N 256 LYS HZ3 H N N 257 LYS HXT H N N 258 MET N N N N 259 MET CA C N S 260 MET C C N N 261 MET O O N N 262 MET CB C N N 263 MET CG C N N 264 MET SD S N N 265 MET CE C N N 266 MET OXT O N N 267 MET H H N N 268 MET H2 H N N 269 MET HA H N N 270 MET HB2 H N N 271 MET HB3 H N N 272 MET HG2 H N N 273 MET HG3 H N N 274 MET HE1 H N N 275 MET HE2 H N N 276 MET HE3 H N N 277 MET HXT H N N 278 PHE N N N N 279 PHE CA C N S 280 PHE C C N N 281 PHE O O N N 282 PHE CB C N N 283 PHE CG C Y N 284 PHE CD1 C Y N 285 PHE CD2 C Y N 286 PHE CE1 C Y N 287 PHE CE2 C Y N 288 PHE CZ C Y N 289 PHE OXT O N N 290 PHE H H N N 291 PHE H2 H N N 292 PHE HA H N N 293 PHE HB2 H N N 294 PHE HB3 H N N 295 PHE HD1 H N N 296 PHE HD2 H N N 297 PHE HE1 H N N 298 PHE HE2 H N N 299 PHE HZ H N N 300 PHE HXT H N N 301 PRO N N N N 302 PRO CA C N S 303 PRO C C N N 304 PRO O O N N 305 PRO CB C N N 306 PRO CG C N N 307 PRO CD C N N 308 PRO OXT O N N 309 PRO H H N N 310 PRO HA H N N 311 PRO HB2 H N N 312 PRO HB3 H N N 313 PRO HG2 H N N 314 PRO HG3 H N N 315 PRO HD2 H N N 316 PRO HD3 H N N 317 PRO HXT H N N 318 SER N N N N 319 SER CA C N S 320 SER C C N N 321 SER O O N N 322 SER CB C N N 323 SER OG O N N 324 SER OXT O N N 325 SER H H N N 326 SER H2 H N N 327 SER HA H N N 328 SER HB2 H N N 329 SER HB3 H N N 330 SER HG H N N 331 SER HXT H N N 332 THR N N N N 333 THR CA C N S 334 THR C C N N 335 THR O O N N 336 THR CB C N R 337 THR OG1 O N N 338 THR CG2 C N N 339 THR OXT O N N 340 THR H H N N 341 THR H2 H N N 342 THR HA H N N 343 THR HB H N N 344 THR HG1 H N N 345 THR HG21 H N N 346 THR HG22 H N N 347 THR HG23 H N N 348 THR HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GDP PB O1B doub N N 70 GDP PB O2B sing N N 71 GDP PB O3B sing N N 72 GDP PB O3A sing N N 73 GDP O2B HOB2 sing N N 74 GDP O3B HOB3 sing N N 75 GDP O3A PA sing N N 76 GDP PA O1A doub N N 77 GDP PA O2A sing N N 78 GDP PA "O5'" sing N N 79 GDP O2A HOA2 sing N N 80 GDP "O5'" "C5'" sing N N 81 GDP "C5'" "C4'" sing N N 82 GDP "C5'" "H5'" sing N N 83 GDP "C5'" "H5''" sing N N 84 GDP "C4'" "O4'" sing N N 85 GDP "C4'" "C3'" sing N N 86 GDP "C4'" "H4'" sing N N 87 GDP "O4'" "C1'" sing N N 88 GDP "C3'" "O3'" sing N N 89 GDP "C3'" "C2'" sing N N 90 GDP "C3'" "H3'" sing N N 91 GDP "O3'" "HO3'" sing N N 92 GDP "C2'" "O2'" sing N N 93 GDP "C2'" "C1'" sing N N 94 GDP "C2'" "H2'" sing N N 95 GDP "O2'" "HO2'" sing N N 96 GDP "C1'" N9 sing N N 97 GDP "C1'" "H1'" sing N N 98 GDP N9 C8 sing Y N 99 GDP N9 C4 sing Y N 100 GDP C8 N7 doub Y N 101 GDP C8 H8 sing N N 102 GDP N7 C5 sing Y N 103 GDP C5 C6 sing N N 104 GDP C5 C4 doub Y N 105 GDP C6 O6 doub N N 106 GDP C6 N1 sing N N 107 GDP N1 C2 sing N N 108 GDP N1 HN1 sing N N 109 GDP C2 N2 sing N N 110 GDP C2 N3 doub N N 111 GDP N2 HN21 sing N N 112 GDP N2 HN22 sing N N 113 GDP N3 C4 sing N N 114 GLN N CA sing N N 115 GLN N H sing N N 116 GLN N H2 sing N N 117 GLN CA C sing N N 118 GLN CA CB sing N N 119 GLN CA HA sing N N 120 GLN C O doub N N 121 GLN C OXT sing N N 122 GLN CB CG sing N N 123 GLN CB HB2 sing N N 124 GLN CB HB3 sing N N 125 GLN CG CD sing N N 126 GLN CG HG2 sing N N 127 GLN CG HG3 sing N N 128 GLN CD OE1 doub N N 129 GLN CD NE2 sing N N 130 GLN NE2 HE21 sing N N 131 GLN NE2 HE22 sing N N 132 GLN OXT HXT sing N N 133 GLU N CA sing N N 134 GLU N H sing N N 135 GLU N H2 sing N N 136 GLU CA C sing N N 137 GLU CA CB sing N N 138 GLU CA HA sing N N 139 GLU C O doub N N 140 GLU C OXT sing N N 141 GLU CB CG sing N N 142 GLU CB HB2 sing N N 143 GLU CB HB3 sing N N 144 GLU CG CD sing N N 145 GLU CG HG2 sing N N 146 GLU CG HG3 sing N N 147 GLU CD OE1 doub N N 148 GLU CD OE2 sing N N 149 GLU OE2 HE2 sing N N 150 GLU OXT HXT sing N N 151 GLY N CA sing N N 152 GLY N H sing N N 153 GLY N H2 sing N N 154 GLY CA C sing N N 155 GLY CA HA2 sing N N 156 GLY CA HA3 sing N N 157 GLY C O doub N N 158 GLY C OXT sing N N 159 GLY OXT HXT sing N N 160 HIS N CA sing N N 161 HIS N H sing N N 162 HIS N H2 sing N N 163 HIS CA C sing N N 164 HIS CA CB sing N N 165 HIS CA HA sing N N 166 HIS C O doub N N 167 HIS C OXT sing N N 168 HIS CB CG sing N N 169 HIS CB HB2 sing N N 170 HIS CB HB3 sing N N 171 HIS CG ND1 sing Y N 172 HIS CG CD2 doub Y N 173 HIS ND1 CE1 doub Y N 174 HIS ND1 HD1 sing N N 175 HIS CD2 NE2 sing Y N 176 HIS CD2 HD2 sing N N 177 HIS CE1 NE2 sing Y N 178 HIS CE1 HE1 sing N N 179 HIS NE2 HE2 sing N N 180 HIS OXT HXT sing N N 181 HOH O H1 sing N N 182 HOH O H2 sing N N 183 ILE N CA sing N N 184 ILE N H sing N N 185 ILE N H2 sing N N 186 ILE CA C sing N N 187 ILE CA CB sing N N 188 ILE CA HA sing N N 189 ILE C O doub N N 190 ILE C OXT sing N N 191 ILE CB CG1 sing N N 192 ILE CB CG2 sing N N 193 ILE CB HB sing N N 194 ILE CG1 CD1 sing N N 195 ILE CG1 HG12 sing N N 196 ILE CG1 HG13 sing N N 197 ILE CG2 HG21 sing N N 198 ILE CG2 HG22 sing N N 199 ILE CG2 HG23 sing N N 200 ILE CD1 HD11 sing N N 201 ILE CD1 HD12 sing N N 202 ILE CD1 HD13 sing N N 203 ILE OXT HXT sing N N 204 LEU N CA sing N N 205 LEU N H sing N N 206 LEU N H2 sing N N 207 LEU CA C sing N N 208 LEU CA CB sing N N 209 LEU CA HA sing N N 210 LEU C O doub N N 211 LEU C OXT sing N N 212 LEU CB CG sing N N 213 LEU CB HB2 sing N N 214 LEU CB HB3 sing N N 215 LEU CG CD1 sing N N 216 LEU CG CD2 sing N N 217 LEU CG HG sing N N 218 LEU CD1 HD11 sing N N 219 LEU CD1 HD12 sing N N 220 LEU CD1 HD13 sing N N 221 LEU CD2 HD21 sing N N 222 LEU CD2 HD22 sing N N 223 LEU CD2 HD23 sing N N 224 LEU OXT HXT sing N N 225 LYS N CA sing N N 226 LYS N H sing N N 227 LYS N H2 sing N N 228 LYS CA C sing N N 229 LYS CA CB sing N N 230 LYS CA HA sing N N 231 LYS C O doub N N 232 LYS C OXT sing N N 233 LYS CB CG sing N N 234 LYS CB HB2 sing N N 235 LYS CB HB3 sing N N 236 LYS CG CD sing N N 237 LYS CG HG2 sing N N 238 LYS CG HG3 sing N N 239 LYS CD CE sing N N 240 LYS CD HD2 sing N N 241 LYS CD HD3 sing N N 242 LYS CE NZ sing N N 243 LYS CE HE2 sing N N 244 LYS CE HE3 sing N N 245 LYS NZ HZ1 sing N N 246 LYS NZ HZ2 sing N N 247 LYS NZ HZ3 sing N N 248 LYS OXT HXT sing N N 249 MET N CA sing N N 250 MET N H sing N N 251 MET N H2 sing N N 252 MET CA C sing N N 253 MET CA CB sing N N 254 MET CA HA sing N N 255 MET C O doub N N 256 MET C OXT sing N N 257 MET CB CG sing N N 258 MET CB HB2 sing N N 259 MET CB HB3 sing N N 260 MET CG SD sing N N 261 MET CG HG2 sing N N 262 MET CG HG3 sing N N 263 MET SD CE sing N N 264 MET CE HE1 sing N N 265 MET CE HE2 sing N N 266 MET CE HE3 sing N N 267 MET OXT HXT sing N N 268 PHE N CA sing N N 269 PHE N H sing N N 270 PHE N H2 sing N N 271 PHE CA C sing N N 272 PHE CA CB sing N N 273 PHE CA HA sing N N 274 PHE C O doub N N 275 PHE C OXT sing N N 276 PHE CB CG sing N N 277 PHE CB HB2 sing N N 278 PHE CB HB3 sing N N 279 PHE CG CD1 doub Y N 280 PHE CG CD2 sing Y N 281 PHE CD1 CE1 sing Y N 282 PHE CD1 HD1 sing N N 283 PHE CD2 CE2 doub Y N 284 PHE CD2 HD2 sing N N 285 PHE CE1 CZ doub Y N 286 PHE CE1 HE1 sing N N 287 PHE CE2 CZ sing Y N 288 PHE CE2 HE2 sing N N 289 PHE CZ HZ sing N N 290 PHE OXT HXT sing N N 291 PRO N CA sing N N 292 PRO N CD sing N N 293 PRO N H sing N N 294 PRO CA C sing N N 295 PRO CA CB sing N N 296 PRO CA HA sing N N 297 PRO C O doub N N 298 PRO C OXT sing N N 299 PRO CB CG sing N N 300 PRO CB HB2 sing N N 301 PRO CB HB3 sing N N 302 PRO CG CD sing N N 303 PRO CG HG2 sing N N 304 PRO CG HG3 sing N N 305 PRO CD HD2 sing N N 306 PRO CD HD3 sing N N 307 PRO OXT HXT sing N N 308 SER N CA sing N N 309 SER N H sing N N 310 SER N H2 sing N N 311 SER CA C sing N N 312 SER CA CB sing N N 313 SER CA HA sing N N 314 SER C O doub N N 315 SER C OXT sing N N 316 SER CB OG sing N N 317 SER CB HB2 sing N N 318 SER CB HB3 sing N N 319 SER OG HG sing N N 320 SER OXT HXT sing N N 321 THR N CA sing N N 322 THR N H sing N N 323 THR N H2 sing N N 324 THR CA C sing N N 325 THR CA CB sing N N 326 THR CA HA sing N N 327 THR C O doub N N 328 THR C OXT sing N N 329 THR CB OG1 sing N N 330 THR CB CG2 sing N N 331 THR CB HB sing N N 332 THR OG1 HG1 sing N N 333 THR CG2 HG21 sing N N 334 THR CG2 HG22 sing N N 335 THR CG2 HG23 sing N N 336 THR OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Japan Society for the Promotion of Science (JSPS)' Japan 15J00589 1 'Japan Agency for Medical Research and Development (AMED)' Japan 19am0101070 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id GDP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id GDP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details unreleased # _space_group.name_H-M_alt 'P 1' _space_group.name_Hall 'P 1' _space_group.IT_number 1 _space_group.crystal_system triclinic _space_group.id 1 # _atom_sites.entry_id 6LL6 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.026123 _atom_sites.fract_transf_matrix[1][2] -0.008264 _atom_sites.fract_transf_matrix[1][3] -0.009142 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025170 _atom_sites.fract_transf_matrix[2][3] 0.001998 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023416 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 1.42069 35.72801 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_