data_6LMQ # _entry.id 6LMQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6LMQ pdb_00006lmq 10.2210/pdb6lmq/pdb WWPDB D_1300015079 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-09-23 2 'Structure model' 1 1 2023-11-22 3 'Structure model' 1 2 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' pdbx_entry_details 6 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6LMQ _pdbx_database_status.recvd_initial_deposition_date 2019-12-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 6LMI _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sugiyama, S.' 1 0000-0001-8141-6080 'Iwaki, T.' 2 ? 'Tamura, Y.' 3 ? 'Tomita, K.' 4 ? 'Matsuoka, E.' 5 0000-0002-1176-9937 'Arita, S.' 6 ? 'Seki, T.' 7 ? 'Yoshinaga, T.' 8 ? 'Kawasuji, T.' 9 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Bioorg.Med.Chem. _citation.journal_id_ASTM BMECEP _citation.journal_id_CSD 1200 _citation.journal_id_ISSN 1464-3391 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 28 _citation.language ? _citation.page_first 115643 _citation.page_last 115643 _citation.title 'Discovery of novel integrase-LEDGF/p75 allosteric inhibitors based on a benzene scaffold.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bmc.2020.115643 _citation.pdbx_database_id_PubMed 32773094 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sugiyama, S.' 1 ? primary 'Iwaki, T.' 2 ? primary 'Tamura, Y.' 3 ? primary 'Tomita, K.' 4 ? primary 'Matsuoka, E.' 5 ? primary 'Arita, S.' 6 ? primary 'Seki, T.' 7 ? primary 'Yoshinaga, T.' 8 ? primary 'Kawasuji, T.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Integrase catalytic' 18434.723 1 2.7.7.- F185K ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 non-polymer syn 'TRIETHYLENE GLYCOL' 150.173 1 ? ? ? ? 4 non-polymer syn ;(2S)-2-[2-(3,4-dihydro-2H-1,4-benzoxazin-6-yl)-4-(3,4-dimethylphenyl)-3,6-dimethyl-5-(methylsulfonylamino)phenyl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid ; 566.708 1 ? ? ? ? 5 water nat water 18.015 27 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GSHMHGQVDCSPGIWQLD(CAF)THLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFT STTVKAA(CAF)WWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGE RIVDIIATDIQTKE ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTV KAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIAT DIQTKE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'TRIETHYLENE GLYCOL' PGE 4 ;(2S)-2-[2-(3,4-dihydro-2H-1,4-benzoxazin-6-yl)-4-(3,4-dimethylphenyl)-3,6-dimethyl-5-(methylsulfonylamino)phenyl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid ; 940 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 HIS n 1 6 GLY n 1 7 GLN n 1 8 VAL n 1 9 ASP n 1 10 CYS n 1 11 SER n 1 12 PRO n 1 13 GLY n 1 14 ILE n 1 15 TRP n 1 16 GLN n 1 17 LEU n 1 18 ASP n 1 19 CAF n 1 20 THR n 1 21 HIS n 1 22 LEU n 1 23 GLU n 1 24 GLY n 1 25 LYS n 1 26 VAL n 1 27 ILE n 1 28 LEU n 1 29 VAL n 1 30 ALA n 1 31 VAL n 1 32 HIS n 1 33 VAL n 1 34 ALA n 1 35 SER n 1 36 GLY n 1 37 TYR n 1 38 ILE n 1 39 GLU n 1 40 ALA n 1 41 GLU n 1 42 VAL n 1 43 ILE n 1 44 PRO n 1 45 ALA n 1 46 GLU n 1 47 THR n 1 48 GLY n 1 49 GLN n 1 50 GLU n 1 51 THR n 1 52 ALA n 1 53 TYR n 1 54 PHE n 1 55 LEU n 1 56 LEU n 1 57 LYS n 1 58 LEU n 1 59 ALA n 1 60 GLY n 1 61 ARG n 1 62 TRP n 1 63 PRO n 1 64 VAL n 1 65 LYS n 1 66 THR n 1 67 VAL n 1 68 HIS n 1 69 THR n 1 70 ASP n 1 71 ASN n 1 72 GLY n 1 73 SER n 1 74 ASN n 1 75 PHE n 1 76 THR n 1 77 SER n 1 78 THR n 1 79 THR n 1 80 VAL n 1 81 LYS n 1 82 ALA n 1 83 ALA n 1 84 CAF n 1 85 TRP n 1 86 TRP n 1 87 ALA n 1 88 GLY n 1 89 ILE n 1 90 LYS n 1 91 GLN n 1 92 GLU n 1 93 PHE n 1 94 GLY n 1 95 ILE n 1 96 PRO n 1 97 TYR n 1 98 ASN n 1 99 PRO n 1 100 GLN n 1 101 SER n 1 102 GLN n 1 103 GLY n 1 104 VAL n 1 105 ILE n 1 106 GLU n 1 107 SER n 1 108 MET n 1 109 ASN n 1 110 LYS n 1 111 GLU n 1 112 LEU n 1 113 LYS n 1 114 LYS n 1 115 ILE n 1 116 ILE n 1 117 GLY n 1 118 GLN n 1 119 VAL n 1 120 ARG n 1 121 ASP n 1 122 GLN n 1 123 ALA n 1 124 GLU n 1 125 HIS n 1 126 LEU n 1 127 LYS n 1 128 THR n 1 129 ALA n 1 130 VAL n 1 131 GLN n 1 132 MET n 1 133 ALA n 1 134 VAL n 1 135 PHE n 1 136 ILE n 1 137 HIS n 1 138 ASN n 1 139 LYS n 1 140 LYS n 1 141 ARG n 1 142 LYS n 1 143 GLY n 1 144 GLY n 1 145 ILE n 1 146 GLY n 1 147 GLY n 1 148 TYR n 1 149 SER n 1 150 ALA n 1 151 GLY n 1 152 GLU n 1 153 ARG n 1 154 ILE n 1 155 VAL n 1 156 ASP n 1 157 ILE n 1 158 ILE n 1 159 ALA n 1 160 THR n 1 161 ASP n 1 162 ILE n 1 163 GLN n 1 164 THR n 1 165 LYS n 1 166 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 166 _entity_src_gen.gene_src_common_name HIV-1 _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus type 1 group M subtype B (isolate NY5)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11698 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 940 non-polymer . ;(2S)-2-[2-(3,4-dihydro-2H-1,4-benzoxazin-6-yl)-4-(3,4-dimethylphenyl)-3,6-dimethyl-5-(methylsulfonylamino)phenyl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid ; ? 'C31 H38 N2 O6 S' 566.708 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CAF 'L-peptide linking' n S-DIMETHYLARSINOYL-CYSTEINE 'CYSTEIN-S-YL CACODYLATE' 'C5 H12 As N O3 S' 241.140 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PGE non-polymer . 'TRIETHYLENE GLYCOL' ? 'C6 H14 O4' 150.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 47 ? ? ? A . n A 1 2 SER 2 48 ? ? ? A . n A 1 3 HIS 3 49 ? ? ? A . n A 1 4 MET 4 50 ? ? ? A . n A 1 5 HIS 5 51 ? ? ? A . n A 1 6 GLY 6 52 ? ? ? A . n A 1 7 GLN 7 53 ? ? ? A . n A 1 8 VAL 8 54 ? ? ? A . n A 1 9 ASP 9 55 ? ? ? A . n A 1 10 CYS 10 56 56 CYS CYS A . n A 1 11 SER 11 57 57 SER SER A . n A 1 12 PRO 12 58 58 PRO PRO A . n A 1 13 GLY 13 59 59 GLY GLY A . n A 1 14 ILE 14 60 60 ILE ILE A . n A 1 15 TRP 15 61 61 TRP TRP A . n A 1 16 GLN 16 62 62 GLN GLN A . n A 1 17 LEU 17 63 63 LEU LEU A . n A 1 18 ASP 18 64 64 ASP ASP A . n A 1 19 CAF 19 65 65 CAF CAF A . n A 1 20 THR 20 66 66 THR THR A . n A 1 21 HIS 21 67 67 HIS HIS A . n A 1 22 LEU 22 68 68 LEU LEU A . n A 1 23 GLU 23 69 69 GLU GLU A . n A 1 24 GLY 24 70 70 GLY GLY A . n A 1 25 LYS 25 71 71 LYS LYS A . n A 1 26 VAL 26 72 72 VAL VAL A . n A 1 27 ILE 27 73 73 ILE ILE A . n A 1 28 LEU 28 74 74 LEU LEU A . n A 1 29 VAL 29 75 75 VAL VAL A . n A 1 30 ALA 30 76 76 ALA ALA A . n A 1 31 VAL 31 77 77 VAL VAL A . n A 1 32 HIS 32 78 78 HIS HIS A . n A 1 33 VAL 33 79 79 VAL VAL A . n A 1 34 ALA 34 80 80 ALA ALA A . n A 1 35 SER 35 81 81 SER SER A . n A 1 36 GLY 36 82 82 GLY GLY A . n A 1 37 TYR 37 83 83 TYR TYR A . n A 1 38 ILE 38 84 84 ILE ILE A . n A 1 39 GLU 39 85 85 GLU GLU A . n A 1 40 ALA 40 86 86 ALA ALA A . n A 1 41 GLU 41 87 87 GLU GLU A . n A 1 42 VAL 42 88 88 VAL VAL A . n A 1 43 ILE 43 89 89 ILE ILE A . n A 1 44 PRO 44 90 90 PRO PRO A . n A 1 45 ALA 45 91 91 ALA ALA A . n A 1 46 GLU 46 92 92 GLU GLU A . n A 1 47 THR 47 93 93 THR THR A . n A 1 48 GLY 48 94 94 GLY GLY A . n A 1 49 GLN 49 95 95 GLN GLN A . n A 1 50 GLU 50 96 96 GLU GLU A . n A 1 51 THR 51 97 97 THR THR A . n A 1 52 ALA 52 98 98 ALA ALA A . n A 1 53 TYR 53 99 99 TYR TYR A . n A 1 54 PHE 54 100 100 PHE PHE A . n A 1 55 LEU 55 101 101 LEU LEU A . n A 1 56 LEU 56 102 102 LEU LEU A . n A 1 57 LYS 57 103 103 LYS LYS A . n A 1 58 LEU 58 104 104 LEU LEU A . n A 1 59 ALA 59 105 105 ALA ALA A . n A 1 60 GLY 60 106 106 GLY GLY A . n A 1 61 ARG 61 107 107 ARG ARG A . n A 1 62 TRP 62 108 108 TRP TRP A . n A 1 63 PRO 63 109 109 PRO PRO A . n A 1 64 VAL 64 110 110 VAL VAL A . n A 1 65 LYS 65 111 111 LYS LYS A . n A 1 66 THR 66 112 112 THR THR A . n A 1 67 VAL 67 113 113 VAL VAL A . n A 1 68 HIS 68 114 114 HIS HIS A . n A 1 69 THR 69 115 115 THR THR A . n A 1 70 ASP 70 116 116 ASP ASP A . n A 1 71 ASN 71 117 117 ASN ASN A . n A 1 72 GLY 72 118 118 GLY GLY A . n A 1 73 SER 73 119 119 SER SER A . n A 1 74 ASN 74 120 120 ASN ASN A . n A 1 75 PHE 75 121 121 PHE PHE A . n A 1 76 THR 76 122 122 THR THR A . n A 1 77 SER 77 123 123 SER SER A . n A 1 78 THR 78 124 124 THR THR A . n A 1 79 THR 79 125 125 THR THR A . n A 1 80 VAL 80 126 126 VAL VAL A . n A 1 81 LYS 81 127 127 LYS LYS A . n A 1 82 ALA 82 128 128 ALA ALA A . n A 1 83 ALA 83 129 129 ALA ALA A . n A 1 84 CAF 84 130 130 CAF CAF A . n A 1 85 TRP 85 131 131 TRP TRP A . n A 1 86 TRP 86 132 132 TRP TRP A . n A 1 87 ALA 87 133 133 ALA ALA A . n A 1 88 GLY 88 134 134 GLY GLY A . n A 1 89 ILE 89 135 135 ILE ILE A . n A 1 90 LYS 90 136 136 LYS LYS A . n A 1 91 GLN 91 137 137 GLN GLN A . n A 1 92 GLU 92 138 138 GLU GLU A . n A 1 93 PHE 93 139 139 PHE PHE A . n A 1 94 GLY 94 140 140 GLY GLY A . n A 1 95 ILE 95 141 141 ILE ILE A . n A 1 96 PRO 96 142 142 PRO PRO A . n A 1 97 TYR 97 143 ? ? ? A . n A 1 98 ASN 98 144 ? ? ? A . n A 1 99 PRO 99 145 ? ? ? A . n A 1 100 GLN 100 146 ? ? ? A . n A 1 101 SER 101 147 ? ? ? A . n A 1 102 GLN 102 148 ? ? ? A . n A 1 103 GLY 103 149 ? ? ? A . n A 1 104 VAL 104 150 150 VAL VAL A . n A 1 105 ILE 105 151 151 ILE ILE A . n A 1 106 GLU 106 152 152 GLU GLU A . n A 1 107 SER 107 153 153 SER SER A . n A 1 108 MET 108 154 154 MET MET A . n A 1 109 ASN 109 155 155 ASN ASN A . n A 1 110 LYS 110 156 156 LYS LYS A . n A 1 111 GLU 111 157 157 GLU GLU A . n A 1 112 LEU 112 158 158 LEU LEU A . n A 1 113 LYS 113 159 159 LYS LYS A . n A 1 114 LYS 114 160 160 LYS LYS A . n A 1 115 ILE 115 161 161 ILE ILE A . n A 1 116 ILE 116 162 162 ILE ILE A . n A 1 117 GLY 117 163 163 GLY GLY A . n A 1 118 GLN 118 164 164 GLN GLN A . n A 1 119 VAL 119 165 165 VAL VAL A . n A 1 120 ARG 120 166 166 ARG ARG A . n A 1 121 ASP 121 167 167 ASP ASP A . n A 1 122 GLN 122 168 168 GLN GLN A . n A 1 123 ALA 123 169 169 ALA ALA A . n A 1 124 GLU 124 170 170 GLU GLU A . n A 1 125 HIS 125 171 171 HIS HIS A . n A 1 126 LEU 126 172 172 LEU LEU A . n A 1 127 LYS 127 173 173 LYS LYS A . n A 1 128 THR 128 174 174 THR THR A . n A 1 129 ALA 129 175 175 ALA ALA A . n A 1 130 VAL 130 176 176 VAL VAL A . n A 1 131 GLN 131 177 177 GLN GLN A . n A 1 132 MET 132 178 178 MET MET A . n A 1 133 ALA 133 179 179 ALA ALA A . n A 1 134 VAL 134 180 180 VAL VAL A . n A 1 135 PHE 135 181 181 PHE PHE A . n A 1 136 ILE 136 182 182 ILE ILE A . n A 1 137 HIS 137 183 183 HIS HIS A . n A 1 138 ASN 138 184 184 ASN ASN A . n A 1 139 LYS 139 185 185 LYS LYS A . n A 1 140 LYS 140 186 186 LYS LYS A . n A 1 141 ARG 141 187 187 ARG ARG A . n A 1 142 LYS 142 188 188 LYS LYS A . n A 1 143 GLY 143 189 ? ? ? A . n A 1 144 GLY 144 190 ? ? ? A . n A 1 145 ILE 145 191 ? ? ? A . n A 1 146 GLY 146 192 ? ? ? A . n A 1 147 GLY 147 193 193 GLY GLY A . n A 1 148 TYR 148 194 194 TYR TYR A . n A 1 149 SER 149 195 195 SER SER A . n A 1 150 ALA 150 196 196 ALA ALA A . n A 1 151 GLY 151 197 197 GLY GLY A . n A 1 152 GLU 152 198 198 GLU GLU A . n A 1 153 ARG 153 199 199 ARG ARG A . n A 1 154 ILE 154 200 200 ILE ILE A . n A 1 155 VAL 155 201 201 VAL VAL A . n A 1 156 ASP 156 202 202 ASP ASP A . n A 1 157 ILE 157 203 203 ILE ILE A . n A 1 158 ILE 158 204 204 ILE ILE A . n A 1 159 ALA 159 205 205 ALA ALA A . n A 1 160 THR 160 206 206 THR THR A . n A 1 161 ASP 161 207 207 ASP ASP A . n A 1 162 ILE 162 208 208 ILE ILE A . n A 1 163 GLN 163 209 209 GLN GLN A . n A 1 164 THR 164 210 ? ? ? A . n A 1 165 LYS 165 211 ? ? ? A . n A 1 166 GLU 166 212 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 940 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 940 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 1 SO4 SO4 A . C 2 SO4 1 302 2 SO4 SO4 A . D 3 PGE 1 303 1 PGE PGE A . E 4 940 1 304 1 940 940 A . F 5 HOH 1 401 21 HOH HOH A . F 5 HOH 2 402 20 HOH HOH A . F 5 HOH 3 403 8 HOH HOH A . F 5 HOH 4 404 10 HOH HOH A . F 5 HOH 5 405 5 HOH HOH A . F 5 HOH 6 406 23 HOH HOH A . F 5 HOH 7 407 7 HOH HOH A . F 5 HOH 8 408 16 HOH HOH A . F 5 HOH 9 409 27 HOH HOH A . F 5 HOH 10 410 34 HOH HOH A . F 5 HOH 11 411 24 HOH HOH A . F 5 HOH 12 412 11 HOH HOH A . F 5 HOH 13 413 4 HOH HOH A . F 5 HOH 14 414 1 HOH HOH A . F 5 HOH 15 415 9 HOH HOH A . F 5 HOH 16 416 2 HOH HOH A . F 5 HOH 17 417 6 HOH HOH A . F 5 HOH 18 418 39 HOH HOH A . F 5 HOH 19 419 17 HOH HOH A . F 5 HOH 20 420 41 HOH HOH A . F 5 HOH 21 421 32 HOH HOH A . F 5 HOH 22 422 3 HOH HOH A . F 5 HOH 23 423 15 HOH HOH A . F 5 HOH 24 424 37 HOH HOH A . F 5 HOH 25 425 36 HOH HOH A . F 5 HOH 26 426 38 HOH HOH A . F 5 HOH 27 427 35 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A CAF 65 ? CE2 ? A CAF 19 CE2 2 1 Y 1 A CAF 130 ? CE2 ? A CAF 84 CE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? 'Zbyszek Otwinowski' hkl@hkl-xray.com ? ? ? ? ? http://www.hkl-xray.com/ ? DENZO ? ? program . 1 ? 'data scaling' ? ? 'Zbyszek Otwinowski' hkl@hkl-xray.com ? ? ? ? ? http://www.hkl-xray.com/ ? SCALEPACK ? ? program . 2 ? phasing ? ? 'Alexei Vaguine' alexei@ysbl.york.ac.uk ? ? ? ? Fortran_77 http://www.ccp4.ac.uk/dist/html/molrep.html ? MOLREP ? ? program 10.2.31 3 ? refinement ? ? 'Garib N. Murshudov' garib@ysbl.york.ac.uk ? ? ? ? Fortran_77 http://www.ccp4.ac.uk/dist/html/refmac5.html ? REFMAC ? ? program 5.5.0102 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Apr. 1, 2019' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.25 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6LMQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 71.885 _cell.length_a_esd ? _cell.length_b 71.885 _cell.length_b_esd ? _cell.length_c 65.520 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6LMQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6LMQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.65 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.60 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Sodium cacodylate pH6.5, 0.206M Ammonium sulfate, 1% PEG 8000, 5mM DTT' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-07-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6LMQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.100 _reflns.d_resolution_low 62.25 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11752 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.100 _reflns.pdbx_Rmerge_I_obs 0.064 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.411 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.100 2.140 ? ? ? ? ? ? 580 99.800 ? ? ? ? 0.544 ? ? ? ? ? ? ? ? 4.600 ? 0.939 ? ? ? ? ? 1 1 ? ? ? 2.140 2.180 ? ? ? ? ? ? 572 99.300 ? ? ? ? 0.520 ? ? ? ? ? ? ? ? 4.800 ? 1.015 ? ? ? ? ? 2 1 ? ? ? 2.180 2.220 ? ? ? ? ? ? 573 99.800 ? ? ? ? 0.441 ? ? ? ? ? ? ? ? 4.800 ? 0.940 ? ? ? ? ? 3 1 ? ? ? 2.220 2.260 ? ? ? ? ? ? 602 100.000 ? ? ? ? 0.384 ? ? ? ? ? ? ? ? 4.900 ? 1.062 ? ? ? ? ? 4 1 ? ? ? 2.260 2.310 ? ? ? ? ? ? 564 99.800 ? ? ? ? 0.338 ? ? ? ? ? ? ? ? 4.900 ? 0.978 ? ? ? ? ? 5 1 ? ? ? 2.310 2.370 ? ? ? ? ? ? 574 99.700 ? ? ? ? 0.313 ? ? ? ? ? ? ? ? 5.000 ? 1.069 ? ? ? ? ? 6 1 ? ? ? 2.370 2.420 ? ? ? ? ? ? 583 100.000 ? ? ? ? 0.297 ? ? ? ? ? ? ? ? 5.000 ? 1.073 ? ? ? ? ? 7 1 ? ? ? 2.420 2.490 ? ? ? ? ? ? 585 100.000 ? ? ? ? 0.235 ? ? ? ? ? ? ? ? 5.000 ? 1.070 ? ? ? ? ? 8 1 ? ? ? 2.490 2.560 ? ? ? ? ? ? 584 99.800 ? ? ? ? 0.190 ? ? ? ? ? ? ? ? 5.100 ? 1.152 ? ? ? ? ? 9 1 ? ? ? 2.560 2.650 ? ? ? ? ? ? 583 100.000 ? ? ? ? 0.184 ? ? ? ? ? ? ? ? 5.100 ? 1.215 ? ? ? ? ? 10 1 ? ? ? 2.650 2.740 ? ? ? ? ? ? 578 100.000 ? ? ? ? 0.149 ? ? ? ? ? ? ? ? 5.100 ? 1.228 ? ? ? ? ? 11 1 ? ? ? 2.740 2.850 ? ? ? ? ? ? 590 99.700 ? ? ? ? 0.127 ? ? ? ? ? ? ? ? 5.200 ? 1.392 ? ? ? ? ? 12 1 ? ? ? 2.850 2.980 ? ? ? ? ? ? 580 99.700 ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 5.300 ? 1.541 ? ? ? ? ? 13 1 ? ? ? 2.980 3.140 ? ? ? ? ? ? 601 100.000 ? ? ? ? 0.087 ? ? ? ? ? ? ? ? 5.200 ? 1.620 ? ? ? ? ? 14 1 ? ? ? 3.140 3.330 ? ? ? ? ? ? 579 99.800 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 5.300 ? 1.863 ? ? ? ? ? 15 1 ? ? ? 3.330 3.590 ? ? ? ? ? ? 604 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 5.400 ? 1.938 ? ? ? ? ? 16 1 ? ? ? 3.590 3.950 ? ? ? ? ? ? 589 99.700 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 5.300 ? 2.017 ? ? ? ? ? 17 1 ? ? ? 3.950 4.520 ? ? ? ? ? ? 606 99.200 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 5.400 ? 2.037 ? ? ? ? ? 18 1 ? ? ? 4.520 5.700 ? ? ? ? ? ? 607 99.500 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 5.300 ? 1.835 ? ? ? ? ? 19 1 ? ? ? 5.700 50.000 ? ? ? ? ? ? 618 94.200 ? ? ? ? 0.029 ? ? ? ? ? ? ? ? 4.900 ? 1.793 ? ? ? ? ? 20 1 ? ? ? # _refine.aniso_B[1][1] 0.8000 _refine.aniso_B[1][2] 0.4000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.8000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -1.2000 _refine.B_iso_max 96.520 _refine.B_iso_mean 41.2780 _refine.B_iso_min 4.740 _refine.correlation_coeff_Fo_to_Fc 0.9480 _refine.correlation_coeff_Fo_to_Fc_free 0.9420 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6LMQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1000 _refine.ls_d_res_low 62.2500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11184 _refine.ls_number_reflns_R_free 557 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5400 _refine.ls_percent_reflns_R_free 4.7000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2132 _refine.ls_R_factor_R_free 0.2395 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2119 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3LPT _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1970 _refine.pdbx_overall_ESU_R_Free 0.1680 _refine.pdbx_solvent_vdw_probe_radii 1.4000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.3620 _refine.overall_SU_ML 0.1190 _refine.overall_SU_R_Cruickshank_DPI 0.1971 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1000 _refine_hist.d_res_low 62.2500 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 1205 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 143 _refine_hist.pdbx_B_iso_mean_ligand 42.46 _refine_hist.pdbx_B_iso_mean_solvent 41.23 _refine_hist.pdbx_number_atoms_protein 1118 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 60 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.026 0.022 1199 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 2.111 1.997 1626 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 6.415 5.000 140 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.896 24.783 46 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 20.336 15.000 199 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 14.385 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.159 0.200 180 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.011 0.021 856 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.1000 _refine_ls_shell.d_res_low 2.1530 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 36 _refine_ls_shell.number_reflns_R_work 812 _refine_ls_shell.percent_reflns_obs 99.3000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3700 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2920 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6LMQ _struct.title ;Crystal structure of HIV-1 integrase catalytic core domain in complex with 2-(tert-butoxy)-2-[3-(3,4-dihydro-2H-1,4-benzoxazin-6-yl)-6-methanesulfonamido-2,3',4',5-tetramethyl-[1,1'-biphenyl]-4-yl]acetic acid ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6LMQ _struct_keywords.text 'hydrolase transferase/inhibitor, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POL_HV1N5 _struct_ref.pdbx_db_accession P12497 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA CWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQ TKE ; _struct_ref.pdbx_align_begin 1197 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6LMQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 166 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P12497 _struct_ref_seq.db_align_beg 1197 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1359 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 50 _struct_ref_seq.pdbx_auth_seq_align_end 212 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6LMQ GLY A 1 ? UNP P12497 ? ? 'expression tag' 47 1 1 6LMQ SER A 2 ? UNP P12497 ? ? 'expression tag' 48 2 1 6LMQ HIS A 3 ? UNP P12497 ? ? 'expression tag' 49 3 1 6LMQ LYS A 139 ? UNP P12497 PHE 1332 'engineered mutation' 185 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5050 ? 1 MORE -56 ? 1 'SSA (A^2)' 13430 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_554 -x,-x+y,-z-2/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -43.6800000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 47 ? TRP A 62 ? THR A 93 TRP A 108 1 ? 16 HELX_P HELX_P2 AA2 ASN A 71 ? THR A 76 ? ASN A 117 THR A 122 5 ? 6 HELX_P HELX_P3 AA3 SER A 77 ? GLY A 88 ? SER A 123 GLY A 134 1 ? 12 HELX_P HELX_P4 AA4 SER A 107 ? ARG A 120 ? SER A 153 ARG A 166 1 ? 14 HELX_P HELX_P5 AA5 ASP A 121 ? ALA A 123 ? ASP A 167 ALA A 169 5 ? 3 HELX_P HELX_P6 AA6 HIS A 125 ? LYS A 140 ? HIS A 171 LYS A 186 1 ? 16 HELX_P HELX_P7 AA7 SER A 149 ? GLN A 163 ? SER A 195 GLN A 209 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 18 C ? ? ? 1_555 A CAF 19 N ? ? A ASP 64 A CAF 65 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? A CAF 19 C ? ? ? 1_555 A THR 20 N ? ? A CAF 65 A THR 66 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale3 covale both ? A ALA 83 C ? ? ? 1_555 A CAF 84 N ? ? A ALA 129 A CAF 130 1_555 ? ? ? ? ? ? ? 1.352 ? ? covale4 covale both ? A CAF 84 C ? ? ? 1_555 A TRP 85 N ? ? A CAF 130 A TRP 131 1_555 ? ? ? ? ? ? ? 1.310 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CAF A 19 ? . . . . CAF A 65 ? 1_555 . . . . . . . CYS 1 CAF None 'Non-standard residue' 2 CAF A 84 ? . . . . CAF A 130 ? 1_555 . . . . . . . CYS 1 CAF None 'Non-standard residue' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 95 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 141 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 96 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 142 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.96 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 38 ? ILE A 43 ? ILE A 84 ILE A 89 AA1 2 LYS A 25 ? HIS A 32 ? LYS A 71 HIS A 78 AA1 3 ILE A 14 ? LEU A 22 ? ILE A 60 LEU A 68 AA1 4 THR A 66 ? HIS A 68 ? THR A 112 HIS A 114 AA1 5 LYS A 90 ? GLN A 91 ? LYS A 136 GLN A 137 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 41 ? O GLU A 87 N LEU A 28 ? N LEU A 74 AA1 2 3 O VAL A 29 ? O VAL A 75 N ASP A 18 ? N ASP A 64 AA1 3 4 N LEU A 17 ? N LEU A 63 O HIS A 68 ? O HIS A 114 AA1 4 5 N VAL A 67 ? N VAL A 113 O LYS A 90 ? O LYS A 136 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 301 ? 6 'binding site for residue SO4 A 301' AC2 Software A SO4 302 ? 4 'binding site for residue SO4 A 302' AC3 Software A PGE 303 ? 5 'binding site for residue PGE A 303' AC4 Software A 940 304 ? 13 'binding site for residue 940 A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 LYS A 25 ? LYS A 71 . ? 1_555 ? 2 AC1 6 ARG A 120 ? ARG A 166 . ? 1_555 ? 3 AC1 6 HIS A 125 ? HIS A 171 . ? 1_555 ? 4 AC1 6 LEU A 126 ? LEU A 172 . ? 1_555 ? 5 AC1 6 HOH F . ? HOH A 402 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 405 . ? 1_555 ? 7 AC2 4 THR A 20 ? THR A 66 . ? 1_555 ? 8 AC2 4 HIS A 21 ? HIS A 67 . ? 1_555 ? 9 AC2 4 LYS A 65 ? LYS A 111 . ? 2_545 ? 10 AC2 4 LYS A 113 ? LYS A 159 . ? 1_555 ? 11 AC3 5 GLU A 50 ? GLU A 96 . ? 6_554 ? 12 AC3 5 TYR A 53 ? TYR A 99 . ? 6_554 ? 13 AC3 5 HIS A 125 ? HIS A 171 . ? 1_555 ? 14 AC3 5 LYS A 127 ? LYS A 173 . ? 1_555 ? 15 AC3 5 HOH F . ? HOH A 401 . ? 1_555 ? 16 AC4 13 GLN A 49 ? GLN A 95 . ? 1_555 ? 17 AC4 13 LEU A 56 ? LEU A 102 . ? 1_555 ? 18 AC4 13 THR A 78 ? THR A 124 . ? 1_555 ? 19 AC4 13 THR A 79 ? THR A 125 . ? 1_555 ? 20 AC4 13 ALA A 83 ? ALA A 129 . ? 1_555 ? 21 AC4 13 TRP A 86 ? TRP A 132 . ? 1_555 ? 22 AC4 13 GLN A 122 ? GLN A 168 . ? 6_554 ? 23 AC4 13 ALA A 123 ? ALA A 169 . ? 6_554 ? 24 AC4 13 GLU A 124 ? GLU A 170 . ? 6_554 ? 25 AC4 13 HIS A 125 ? HIS A 171 . ? 6_554 ? 26 AC4 13 THR A 128 ? THR A 174 . ? 6_554 ? 27 AC4 13 MET A 132 ? MET A 178 . ? 6_554 ? 28 AC4 13 HOH F . ? HOH A 420 . ? 1_555 ? # _pdbx_entry_details.entry_id 6LMQ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 PHE _pdbx_validate_close_contact.auth_seq_id_1 139 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 CB _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 PRO _pdbx_validate_close_contact.auth_seq_id_2 142 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 151 ? ? -119.54 -153.82 2 1 GLU A 152 ? ? -161.28 -84.67 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CAF 19 A CAF 65 ? CYS 'modified residue' 2 A CAF 84 A CAF 130 ? CYS 'modified residue' # _pdbx_phasing_MR.entry_id 6LMQ _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.380 _pdbx_phasing_MR.d_res_low_rotation 19.780 _pdbx_phasing_MR.d_res_high_translation 2.380 _pdbx_phasing_MR.d_res_low_translation 19.780 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 47 ? A GLY 1 2 1 Y 1 A SER 48 ? A SER 2 3 1 Y 1 A HIS 49 ? A HIS 3 4 1 Y 1 A MET 50 ? A MET 4 5 1 Y 1 A HIS 51 ? A HIS 5 6 1 Y 1 A GLY 52 ? A GLY 6 7 1 Y 1 A GLN 53 ? A GLN 7 8 1 Y 1 A VAL 54 ? A VAL 8 9 1 Y 1 A ASP 55 ? A ASP 9 10 1 Y 1 A TYR 143 ? A TYR 97 11 1 Y 1 A ASN 144 ? A ASN 98 12 1 Y 1 A PRO 145 ? A PRO 99 13 1 Y 1 A GLN 146 ? A GLN 100 14 1 Y 1 A SER 147 ? A SER 101 15 1 Y 1 A GLN 148 ? A GLN 102 16 1 Y 1 A GLY 149 ? A GLY 103 17 1 Y 1 A GLY 189 ? A GLY 143 18 1 Y 1 A GLY 190 ? A GLY 144 19 1 Y 1 A ILE 191 ? A ILE 145 20 1 Y 1 A GLY 192 ? A GLY 146 21 1 Y 1 A THR 210 ? A THR 164 22 1 Y 1 A LYS 211 ? A LYS 165 23 1 Y 1 A GLU 212 ? A GLU 166 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 940 O6 O N N 1 940 S S N N 2 940 O5 O N N 3 940 C31 C N N 4 940 N2 N N N 5 940 C30 C Y N 6 940 C28 C Y N 7 940 C29 C N N 8 940 C9 C Y N 9 940 C5 C Y N 10 940 C4 C Y N 11 940 C3 C Y N 12 940 C2 C Y N 13 940 C1 C N N 14 940 C7 C Y N 15 940 C8 C N N 16 940 C6 C Y N 17 940 C10 C Y N 18 940 C11 C N N 19 940 C12 C Y N 20 940 C21 C Y N 21 940 C22 C N S 22 940 O2 O N N 23 940 C23 C N N 24 940 C26 C N N 25 940 C25 C N N 26 940 C24 C N N 27 940 C27 C N N 28 940 O4 O N N 29 940 O3 O N N 30 940 C13 C Y N 31 940 C20 C Y N 32 940 C19 C Y N 33 940 C16 C Y N 34 940 C15 C Y N 35 940 C14 C Y N 36 940 O1 O N N 37 940 C17 C N N 38 940 C18 C N N 39 940 N1 N N N 40 940 H1 H N N 41 940 H2 H N N 42 940 H3 H N N 43 940 H4 H N N 44 940 H5 H N N 45 940 H6 H N N 46 940 H7 H N N 47 940 H8 H N N 48 940 H9 H N N 49 940 H10 H N N 50 940 H11 H N N 51 940 H12 H N N 52 940 H13 H N N 53 940 H14 H N N 54 940 H15 H N N 55 940 H16 H N N 56 940 H17 H N N 57 940 H18 H N N 58 940 H19 H N N 59 940 H20 H N N 60 940 H21 H N N 61 940 H22 H N N 62 940 H23 H N N 63 940 H24 H N N 64 940 H25 H N N 65 940 H26 H N N 66 940 H27 H N N 67 940 H28 H N N 68 940 H29 H N N 69 940 H30 H N N 70 940 H31 H N N 71 940 H32 H N N 72 940 H33 H N N 73 940 H34 H N N 74 940 H35 H N N 75 940 H36 H N N 76 940 H37 H N N 77 940 H38 H N N 78 ALA N N N N 79 ALA CA C N S 80 ALA C C N N 81 ALA O O N N 82 ALA CB C N N 83 ALA OXT O N N 84 ALA H H N N 85 ALA H2 H N N 86 ALA HA H N N 87 ALA HB1 H N N 88 ALA HB2 H N N 89 ALA HB3 H N N 90 ALA HXT H N N 91 ARG N N N N 92 ARG CA C N S 93 ARG C C N N 94 ARG O O N N 95 ARG CB C N N 96 ARG CG C N N 97 ARG CD C N N 98 ARG NE N N N 99 ARG CZ C N N 100 ARG NH1 N N N 101 ARG NH2 N N N 102 ARG OXT O N N 103 ARG H H N N 104 ARG H2 H N N 105 ARG HA H N N 106 ARG HB2 H N N 107 ARG HB3 H N N 108 ARG HG2 H N N 109 ARG HG3 H N N 110 ARG HD2 H N N 111 ARG HD3 H N N 112 ARG HE H N N 113 ARG HH11 H N N 114 ARG HH12 H N N 115 ARG HH21 H N N 116 ARG HH22 H N N 117 ARG HXT H N N 118 ASN N N N N 119 ASN CA C N S 120 ASN C C N N 121 ASN O O N N 122 ASN CB C N N 123 ASN CG C N N 124 ASN OD1 O N N 125 ASN ND2 N N N 126 ASN OXT O N N 127 ASN H H N N 128 ASN H2 H N N 129 ASN HA H N N 130 ASN HB2 H N N 131 ASN HB3 H N N 132 ASN HD21 H N N 133 ASN HD22 H N N 134 ASN HXT H N N 135 ASP N N N N 136 ASP CA C N S 137 ASP C C N N 138 ASP O O N N 139 ASP CB C N N 140 ASP CG C N N 141 ASP OD1 O N N 142 ASP OD2 O N N 143 ASP OXT O N N 144 ASP H H N N 145 ASP H2 H N N 146 ASP HA H N N 147 ASP HB2 H N N 148 ASP HB3 H N N 149 ASP HD2 H N N 150 ASP HXT H N N 151 CAF N N N N 152 CAF CA C N R 153 CAF CB C N N 154 CAF C C N N 155 CAF O O N N 156 CAF OXT O N N 157 CAF SG S N N 158 CAF AS AS N N 159 CAF CE1 C N N 160 CAF CE2 C N N 161 CAF O1 O N N 162 CAF H H N N 163 CAF H2 H N N 164 CAF HA H N N 165 CAF HB2 H N N 166 CAF HB3 H N N 167 CAF HXT H N N 168 CAF HE11 H N N 169 CAF HE12 H N N 170 CAF HE13 H N N 171 CAF HE21 H N N 172 CAF HE22 H N N 173 CAF HE23 H N N 174 CYS N N N N 175 CYS CA C N R 176 CYS C C N N 177 CYS O O N N 178 CYS CB C N N 179 CYS SG S N N 180 CYS OXT O N N 181 CYS H H N N 182 CYS H2 H N N 183 CYS HA H N N 184 CYS HB2 H N N 185 CYS HB3 H N N 186 CYS HG H N N 187 CYS HXT H N N 188 GLN N N N N 189 GLN CA C N S 190 GLN C C N N 191 GLN O O N N 192 GLN CB C N N 193 GLN CG C N N 194 GLN CD C N N 195 GLN OE1 O N N 196 GLN NE2 N N N 197 GLN OXT O N N 198 GLN H H N N 199 GLN H2 H N N 200 GLN HA H N N 201 GLN HB2 H N N 202 GLN HB3 H N N 203 GLN HG2 H N N 204 GLN HG3 H N N 205 GLN HE21 H N N 206 GLN HE22 H N N 207 GLN HXT H N N 208 GLU N N N N 209 GLU CA C N S 210 GLU C C N N 211 GLU O O N N 212 GLU CB C N N 213 GLU CG C N N 214 GLU CD C N N 215 GLU OE1 O N N 216 GLU OE2 O N N 217 GLU OXT O N N 218 GLU H H N N 219 GLU H2 H N N 220 GLU HA H N N 221 GLU HB2 H N N 222 GLU HB3 H N N 223 GLU HG2 H N N 224 GLU HG3 H N N 225 GLU HE2 H N N 226 GLU HXT H N N 227 GLY N N N N 228 GLY CA C N N 229 GLY C C N N 230 GLY O O N N 231 GLY OXT O N N 232 GLY H H N N 233 GLY H2 H N N 234 GLY HA2 H N N 235 GLY HA3 H N N 236 GLY HXT H N N 237 HIS N N N N 238 HIS CA C N S 239 HIS C C N N 240 HIS O O N N 241 HIS CB C N N 242 HIS CG C Y N 243 HIS ND1 N Y N 244 HIS CD2 C Y N 245 HIS CE1 C Y N 246 HIS NE2 N Y N 247 HIS OXT O N N 248 HIS H H N N 249 HIS H2 H N N 250 HIS HA H N N 251 HIS HB2 H N N 252 HIS HB3 H N N 253 HIS HD1 H N N 254 HIS HD2 H N N 255 HIS HE1 H N N 256 HIS HE2 H N N 257 HIS HXT H N N 258 HOH O O N N 259 HOH H1 H N N 260 HOH H2 H N N 261 ILE N N N N 262 ILE CA C N S 263 ILE C C N N 264 ILE O O N N 265 ILE CB C N S 266 ILE CG1 C N N 267 ILE CG2 C N N 268 ILE CD1 C N N 269 ILE OXT O N N 270 ILE H H N N 271 ILE H2 H N N 272 ILE HA H N N 273 ILE HB H N N 274 ILE HG12 H N N 275 ILE HG13 H N N 276 ILE HG21 H N N 277 ILE HG22 H N N 278 ILE HG23 H N N 279 ILE HD11 H N N 280 ILE HD12 H N N 281 ILE HD13 H N N 282 ILE HXT H N N 283 LEU N N N N 284 LEU CA C N S 285 LEU C C N N 286 LEU O O N N 287 LEU CB C N N 288 LEU CG C N N 289 LEU CD1 C N N 290 LEU CD2 C N N 291 LEU OXT O N N 292 LEU H H N N 293 LEU H2 H N N 294 LEU HA H N N 295 LEU HB2 H N N 296 LEU HB3 H N N 297 LEU HG H N N 298 LEU HD11 H N N 299 LEU HD12 H N N 300 LEU HD13 H N N 301 LEU HD21 H N N 302 LEU HD22 H N N 303 LEU HD23 H N N 304 LEU HXT H N N 305 LYS N N N N 306 LYS CA C N S 307 LYS C C N N 308 LYS O O N N 309 LYS CB C N N 310 LYS CG C N N 311 LYS CD C N N 312 LYS CE C N N 313 LYS NZ N N N 314 LYS OXT O N N 315 LYS H H N N 316 LYS H2 H N N 317 LYS HA H N N 318 LYS HB2 H N N 319 LYS HB3 H N N 320 LYS HG2 H N N 321 LYS HG3 H N N 322 LYS HD2 H N N 323 LYS HD3 H N N 324 LYS HE2 H N N 325 LYS HE3 H N N 326 LYS HZ1 H N N 327 LYS HZ2 H N N 328 LYS HZ3 H N N 329 LYS HXT H N N 330 MET N N N N 331 MET CA C N S 332 MET C C N N 333 MET O O N N 334 MET CB C N N 335 MET CG C N N 336 MET SD S N N 337 MET CE C N N 338 MET OXT O N N 339 MET H H N N 340 MET H2 H N N 341 MET HA H N N 342 MET HB2 H N N 343 MET HB3 H N N 344 MET HG2 H N N 345 MET HG3 H N N 346 MET HE1 H N N 347 MET HE2 H N N 348 MET HE3 H N N 349 MET HXT H N N 350 PGE C1 C N N 351 PGE O1 O N N 352 PGE C2 C N N 353 PGE O2 O N N 354 PGE C3 C N N 355 PGE C4 C N N 356 PGE O4 O N N 357 PGE C6 C N N 358 PGE C5 C N N 359 PGE O3 O N N 360 PGE H1 H N N 361 PGE H12 H N N 362 PGE HO1 H N N 363 PGE H2 H N N 364 PGE H22 H N N 365 PGE H3 H N N 366 PGE H32 H N N 367 PGE H4 H N N 368 PGE H42 H N N 369 PGE HO4 H N N 370 PGE H6 H N N 371 PGE H62 H N N 372 PGE H5 H N N 373 PGE H52 H N N 374 PHE N N N N 375 PHE CA C N S 376 PHE C C N N 377 PHE O O N N 378 PHE CB C N N 379 PHE CG C Y N 380 PHE CD1 C Y N 381 PHE CD2 C Y N 382 PHE CE1 C Y N 383 PHE CE2 C Y N 384 PHE CZ C Y N 385 PHE OXT O N N 386 PHE H H N N 387 PHE H2 H N N 388 PHE HA H N N 389 PHE HB2 H N N 390 PHE HB3 H N N 391 PHE HD1 H N N 392 PHE HD2 H N N 393 PHE HE1 H N N 394 PHE HE2 H N N 395 PHE HZ H N N 396 PHE HXT H N N 397 PRO N N N N 398 PRO CA C N S 399 PRO C C N N 400 PRO O O N N 401 PRO CB C N N 402 PRO CG C N N 403 PRO CD C N N 404 PRO OXT O N N 405 PRO H H N N 406 PRO HA H N N 407 PRO HB2 H N N 408 PRO HB3 H N N 409 PRO HG2 H N N 410 PRO HG3 H N N 411 PRO HD2 H N N 412 PRO HD3 H N N 413 PRO HXT H N N 414 SER N N N N 415 SER CA C N S 416 SER C C N N 417 SER O O N N 418 SER CB C N N 419 SER OG O N N 420 SER OXT O N N 421 SER H H N N 422 SER H2 H N N 423 SER HA H N N 424 SER HB2 H N N 425 SER HB3 H N N 426 SER HG H N N 427 SER HXT H N N 428 SO4 S S N N 429 SO4 O1 O N N 430 SO4 O2 O N N 431 SO4 O3 O N N 432 SO4 O4 O N N 433 THR N N N N 434 THR CA C N S 435 THR C C N N 436 THR O O N N 437 THR CB C N R 438 THR OG1 O N N 439 THR CG2 C N N 440 THR OXT O N N 441 THR H H N N 442 THR H2 H N N 443 THR HA H N N 444 THR HB H N N 445 THR HG1 H N N 446 THR HG21 H N N 447 THR HG22 H N N 448 THR HG23 H N N 449 THR HXT H N N 450 TRP N N N N 451 TRP CA C N S 452 TRP C C N N 453 TRP O O N N 454 TRP CB C N N 455 TRP CG C Y N 456 TRP CD1 C Y N 457 TRP CD2 C Y N 458 TRP NE1 N Y N 459 TRP CE2 C Y N 460 TRP CE3 C Y N 461 TRP CZ2 C Y N 462 TRP CZ3 C Y N 463 TRP CH2 C Y N 464 TRP OXT O N N 465 TRP H H N N 466 TRP H2 H N N 467 TRP HA H N N 468 TRP HB2 H N N 469 TRP HB3 H N N 470 TRP HD1 H N N 471 TRP HE1 H N N 472 TRP HE3 H N N 473 TRP HZ2 H N N 474 TRP HZ3 H N N 475 TRP HH2 H N N 476 TRP HXT H N N 477 TYR N N N N 478 TYR CA C N S 479 TYR C C N N 480 TYR O O N N 481 TYR CB C N N 482 TYR CG C Y N 483 TYR CD1 C Y N 484 TYR CD2 C Y N 485 TYR CE1 C Y N 486 TYR CE2 C Y N 487 TYR CZ C Y N 488 TYR OH O N N 489 TYR OXT O N N 490 TYR H H N N 491 TYR H2 H N N 492 TYR HA H N N 493 TYR HB2 H N N 494 TYR HB3 H N N 495 TYR HD1 H N N 496 TYR HD2 H N N 497 TYR HE1 H N N 498 TYR HE2 H N N 499 TYR HH H N N 500 TYR HXT H N N 501 VAL N N N N 502 VAL CA C N S 503 VAL C C N N 504 VAL O O N N 505 VAL CB C N N 506 VAL CG1 C N N 507 VAL CG2 C N N 508 VAL OXT O N N 509 VAL H H N N 510 VAL H2 H N N 511 VAL HA H N N 512 VAL HB H N N 513 VAL HG11 H N N 514 VAL HG12 H N N 515 VAL HG13 H N N 516 VAL HG21 H N N 517 VAL HG22 H N N 518 VAL HG23 H N N 519 VAL HXT H N N 520 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 940 C18 N1 sing N N 1 940 C18 C17 sing N N 2 940 N1 C15 sing N N 3 940 O4 C27 doub N N 4 940 O3 C27 sing N N 5 940 C8 C7 sing N N 6 940 C17 O1 sing N N 7 940 C27 C22 sing N N 8 940 C15 C14 doub Y N 9 940 C15 C16 sing Y N 10 940 C14 C13 sing Y N 11 940 C6 C7 doub Y N 12 940 C6 C5 sing Y N 13 940 C7 C2 sing Y N 14 940 O1 C16 sing N N 15 940 C16 C19 doub Y N 16 940 C22 C21 sing N N 17 940 C22 O2 sing N N 18 940 C13 C12 sing N N 19 940 C13 C20 doub Y N 20 940 C21 C12 doub Y N 21 940 C21 C28 sing Y N 22 940 C12 C10 sing Y N 23 940 C29 C28 sing N N 24 940 C28 C30 doub Y N 25 940 C10 C11 sing N N 26 940 C10 C9 doub Y N 27 940 C30 C9 sing Y N 28 940 C30 N2 sing N N 29 940 C9 C5 sing N N 30 940 N2 S sing N N 31 940 C5 C4 doub Y N 32 940 O2 C23 sing N N 33 940 C2 C1 sing N N 34 940 C2 C3 doub Y N 35 940 C19 C20 sing Y N 36 940 C26 C23 sing N N 37 940 O5 S doub N N 38 940 C4 C3 sing Y N 39 940 S C31 sing N N 40 940 S O6 doub N N 41 940 C23 C25 sing N N 42 940 C23 C24 sing N N 43 940 C31 H1 sing N N 44 940 C31 H2 sing N N 45 940 C31 H3 sing N N 46 940 N2 H4 sing N N 47 940 C29 H5 sing N N 48 940 C29 H6 sing N N 49 940 C29 H7 sing N N 50 940 C4 H8 sing N N 51 940 C3 H9 sing N N 52 940 C1 H10 sing N N 53 940 C1 H11 sing N N 54 940 C1 H12 sing N N 55 940 C8 H13 sing N N 56 940 C8 H14 sing N N 57 940 C8 H15 sing N N 58 940 C6 H16 sing N N 59 940 C11 H17 sing N N 60 940 C11 H18 sing N N 61 940 C11 H19 sing N N 62 940 C22 H20 sing N N 63 940 C26 H21 sing N N 64 940 C26 H22 sing N N 65 940 C26 H23 sing N N 66 940 C25 H24 sing N N 67 940 C25 H25 sing N N 68 940 C25 H26 sing N N 69 940 C24 H27 sing N N 70 940 C24 H28 sing N N 71 940 C24 H29 sing N N 72 940 O3 H30 sing N N 73 940 C20 H31 sing N N 74 940 C19 H32 sing N N 75 940 C14 H33 sing N N 76 940 C17 H34 sing N N 77 940 C17 H35 sing N N 78 940 C18 H36 sing N N 79 940 C18 H37 sing N N 80 940 N1 H38 sing N N 81 ALA N CA sing N N 82 ALA N H sing N N 83 ALA N H2 sing N N 84 ALA CA C sing N N 85 ALA CA CB sing N N 86 ALA CA HA sing N N 87 ALA C O doub N N 88 ALA C OXT sing N N 89 ALA CB HB1 sing N N 90 ALA CB HB2 sing N N 91 ALA CB HB3 sing N N 92 ALA OXT HXT sing N N 93 ARG N CA sing N N 94 ARG N H sing N N 95 ARG N H2 sing N N 96 ARG CA C sing N N 97 ARG CA CB sing N N 98 ARG CA HA sing N N 99 ARG C O doub N N 100 ARG C OXT sing N N 101 ARG CB CG sing N N 102 ARG CB HB2 sing N N 103 ARG CB HB3 sing N N 104 ARG CG CD sing N N 105 ARG CG HG2 sing N N 106 ARG CG HG3 sing N N 107 ARG CD NE sing N N 108 ARG CD HD2 sing N N 109 ARG CD HD3 sing N N 110 ARG NE CZ sing N N 111 ARG NE HE sing N N 112 ARG CZ NH1 sing N N 113 ARG CZ NH2 doub N N 114 ARG NH1 HH11 sing N N 115 ARG NH1 HH12 sing N N 116 ARG NH2 HH21 sing N N 117 ARG NH2 HH22 sing N N 118 ARG OXT HXT sing N N 119 ASN N CA sing N N 120 ASN N H sing N N 121 ASN N H2 sing N N 122 ASN CA C sing N N 123 ASN CA CB sing N N 124 ASN CA HA sing N N 125 ASN C O doub N N 126 ASN C OXT sing N N 127 ASN CB CG sing N N 128 ASN CB HB2 sing N N 129 ASN CB HB3 sing N N 130 ASN CG OD1 doub N N 131 ASN CG ND2 sing N N 132 ASN ND2 HD21 sing N N 133 ASN ND2 HD22 sing N N 134 ASN OXT HXT sing N N 135 ASP N CA sing N N 136 ASP N H sing N N 137 ASP N H2 sing N N 138 ASP CA C sing N N 139 ASP CA CB sing N N 140 ASP CA HA sing N N 141 ASP C O doub N N 142 ASP C OXT sing N N 143 ASP CB CG sing N N 144 ASP CB HB2 sing N N 145 ASP CB HB3 sing N N 146 ASP CG OD1 doub N N 147 ASP CG OD2 sing N N 148 ASP OD2 HD2 sing N N 149 ASP OXT HXT sing N N 150 CAF N CA sing N N 151 CAF N H sing N N 152 CAF N H2 sing N N 153 CAF CA CB sing N N 154 CAF CA C sing N N 155 CAF CA HA sing N N 156 CAF CB SG sing N N 157 CAF CB HB2 sing N N 158 CAF CB HB3 sing N N 159 CAF C O doub N N 160 CAF C OXT sing N N 161 CAF OXT HXT sing N N 162 CAF SG AS sing N N 163 CAF AS CE1 sing N N 164 CAF AS CE2 sing N N 165 CAF AS O1 doub N N 166 CAF CE1 HE11 sing N N 167 CAF CE1 HE12 sing N N 168 CAF CE1 HE13 sing N N 169 CAF CE2 HE21 sing N N 170 CAF CE2 HE22 sing N N 171 CAF CE2 HE23 sing N N 172 CYS N CA sing N N 173 CYS N H sing N N 174 CYS N H2 sing N N 175 CYS CA C sing N N 176 CYS CA CB sing N N 177 CYS CA HA sing N N 178 CYS C O doub N N 179 CYS C OXT sing N N 180 CYS CB SG sing N N 181 CYS CB HB2 sing N N 182 CYS CB HB3 sing N N 183 CYS SG HG sing N N 184 CYS OXT HXT sing N N 185 GLN N CA sing N N 186 GLN N H sing N N 187 GLN N H2 sing N N 188 GLN CA C sing N N 189 GLN CA CB sing N N 190 GLN CA HA sing N N 191 GLN C O doub N N 192 GLN C OXT sing N N 193 GLN CB CG sing N N 194 GLN CB HB2 sing N N 195 GLN CB HB3 sing N N 196 GLN CG CD sing N N 197 GLN CG HG2 sing N N 198 GLN CG HG3 sing N N 199 GLN CD OE1 doub N N 200 GLN CD NE2 sing N N 201 GLN NE2 HE21 sing N N 202 GLN NE2 HE22 sing N N 203 GLN OXT HXT sing N N 204 GLU N CA sing N N 205 GLU N H sing N N 206 GLU N H2 sing N N 207 GLU CA C sing N N 208 GLU CA CB sing N N 209 GLU CA HA sing N N 210 GLU C O doub N N 211 GLU C OXT sing N N 212 GLU CB CG sing N N 213 GLU CB HB2 sing N N 214 GLU CB HB3 sing N N 215 GLU CG CD sing N N 216 GLU CG HG2 sing N N 217 GLU CG HG3 sing N N 218 GLU CD OE1 doub N N 219 GLU CD OE2 sing N N 220 GLU OE2 HE2 sing N N 221 GLU OXT HXT sing N N 222 GLY N CA sing N N 223 GLY N H sing N N 224 GLY N H2 sing N N 225 GLY CA C sing N N 226 GLY CA HA2 sing N N 227 GLY CA HA3 sing N N 228 GLY C O doub N N 229 GLY C OXT sing N N 230 GLY OXT HXT sing N N 231 HIS N CA sing N N 232 HIS N H sing N N 233 HIS N H2 sing N N 234 HIS CA C sing N N 235 HIS CA CB sing N N 236 HIS CA HA sing N N 237 HIS C O doub N N 238 HIS C OXT sing N N 239 HIS CB CG sing N N 240 HIS CB HB2 sing N N 241 HIS CB HB3 sing N N 242 HIS CG ND1 sing Y N 243 HIS CG CD2 doub Y N 244 HIS ND1 CE1 doub Y N 245 HIS ND1 HD1 sing N N 246 HIS CD2 NE2 sing Y N 247 HIS CD2 HD2 sing N N 248 HIS CE1 NE2 sing Y N 249 HIS CE1 HE1 sing N N 250 HIS NE2 HE2 sing N N 251 HIS OXT HXT sing N N 252 HOH O H1 sing N N 253 HOH O H2 sing N N 254 ILE N CA sing N N 255 ILE N H sing N N 256 ILE N H2 sing N N 257 ILE CA C sing N N 258 ILE CA CB sing N N 259 ILE CA HA sing N N 260 ILE C O doub N N 261 ILE C OXT sing N N 262 ILE CB CG1 sing N N 263 ILE CB CG2 sing N N 264 ILE CB HB sing N N 265 ILE CG1 CD1 sing N N 266 ILE CG1 HG12 sing N N 267 ILE CG1 HG13 sing N N 268 ILE CG2 HG21 sing N N 269 ILE CG2 HG22 sing N N 270 ILE CG2 HG23 sing N N 271 ILE CD1 HD11 sing N N 272 ILE CD1 HD12 sing N N 273 ILE CD1 HD13 sing N N 274 ILE OXT HXT sing N N 275 LEU N CA sing N N 276 LEU N H sing N N 277 LEU N H2 sing N N 278 LEU CA C sing N N 279 LEU CA CB sing N N 280 LEU CA HA sing N N 281 LEU C O doub N N 282 LEU C OXT sing N N 283 LEU CB CG sing N N 284 LEU CB HB2 sing N N 285 LEU CB HB3 sing N N 286 LEU CG CD1 sing N N 287 LEU CG CD2 sing N N 288 LEU CG HG sing N N 289 LEU CD1 HD11 sing N N 290 LEU CD1 HD12 sing N N 291 LEU CD1 HD13 sing N N 292 LEU CD2 HD21 sing N N 293 LEU CD2 HD22 sing N N 294 LEU CD2 HD23 sing N N 295 LEU OXT HXT sing N N 296 LYS N CA sing N N 297 LYS N H sing N N 298 LYS N H2 sing N N 299 LYS CA C sing N N 300 LYS CA CB sing N N 301 LYS CA HA sing N N 302 LYS C O doub N N 303 LYS C OXT sing N N 304 LYS CB CG sing N N 305 LYS CB HB2 sing N N 306 LYS CB HB3 sing N N 307 LYS CG CD sing N N 308 LYS CG HG2 sing N N 309 LYS CG HG3 sing N N 310 LYS CD CE sing N N 311 LYS CD HD2 sing N N 312 LYS CD HD3 sing N N 313 LYS CE NZ sing N N 314 LYS CE HE2 sing N N 315 LYS CE HE3 sing N N 316 LYS NZ HZ1 sing N N 317 LYS NZ HZ2 sing N N 318 LYS NZ HZ3 sing N N 319 LYS OXT HXT sing N N 320 MET N CA sing N N 321 MET N H sing N N 322 MET N H2 sing N N 323 MET CA C sing N N 324 MET CA CB sing N N 325 MET CA HA sing N N 326 MET C O doub N N 327 MET C OXT sing N N 328 MET CB CG sing N N 329 MET CB HB2 sing N N 330 MET CB HB3 sing N N 331 MET CG SD sing N N 332 MET CG HG2 sing N N 333 MET CG HG3 sing N N 334 MET SD CE sing N N 335 MET CE HE1 sing N N 336 MET CE HE2 sing N N 337 MET CE HE3 sing N N 338 MET OXT HXT sing N N 339 PGE C1 O1 sing N N 340 PGE C1 C2 sing N N 341 PGE C1 H1 sing N N 342 PGE C1 H12 sing N N 343 PGE O1 HO1 sing N N 344 PGE C2 O2 sing N N 345 PGE C2 H2 sing N N 346 PGE C2 H22 sing N N 347 PGE O2 C3 sing N N 348 PGE C3 C4 sing N N 349 PGE C3 H3 sing N N 350 PGE C3 H32 sing N N 351 PGE C4 O3 sing N N 352 PGE C4 H4 sing N N 353 PGE C4 H42 sing N N 354 PGE O4 C6 sing N N 355 PGE O4 HO4 sing N N 356 PGE C6 C5 sing N N 357 PGE C6 H6 sing N N 358 PGE C6 H62 sing N N 359 PGE C5 O3 sing N N 360 PGE C5 H5 sing N N 361 PGE C5 H52 sing N N 362 PHE N CA sing N N 363 PHE N H sing N N 364 PHE N H2 sing N N 365 PHE CA C sing N N 366 PHE CA CB sing N N 367 PHE CA HA sing N N 368 PHE C O doub N N 369 PHE C OXT sing N N 370 PHE CB CG sing N N 371 PHE CB HB2 sing N N 372 PHE CB HB3 sing N N 373 PHE CG CD1 doub Y N 374 PHE CG CD2 sing Y N 375 PHE CD1 CE1 sing Y N 376 PHE CD1 HD1 sing N N 377 PHE CD2 CE2 doub Y N 378 PHE CD2 HD2 sing N N 379 PHE CE1 CZ doub Y N 380 PHE CE1 HE1 sing N N 381 PHE CE2 CZ sing Y N 382 PHE CE2 HE2 sing N N 383 PHE CZ HZ sing N N 384 PHE OXT HXT sing N N 385 PRO N CA sing N N 386 PRO N CD sing N N 387 PRO N H sing N N 388 PRO CA C sing N N 389 PRO CA CB sing N N 390 PRO CA HA sing N N 391 PRO C O doub N N 392 PRO C OXT sing N N 393 PRO CB CG sing N N 394 PRO CB HB2 sing N N 395 PRO CB HB3 sing N N 396 PRO CG CD sing N N 397 PRO CG HG2 sing N N 398 PRO CG HG3 sing N N 399 PRO CD HD2 sing N N 400 PRO CD HD3 sing N N 401 PRO OXT HXT sing N N 402 SER N CA sing N N 403 SER N H sing N N 404 SER N H2 sing N N 405 SER CA C sing N N 406 SER CA CB sing N N 407 SER CA HA sing N N 408 SER C O doub N N 409 SER C OXT sing N N 410 SER CB OG sing N N 411 SER CB HB2 sing N N 412 SER CB HB3 sing N N 413 SER OG HG sing N N 414 SER OXT HXT sing N N 415 SO4 S O1 doub N N 416 SO4 S O2 doub N N 417 SO4 S O3 sing N N 418 SO4 S O4 sing N N 419 THR N CA sing N N 420 THR N H sing N N 421 THR N H2 sing N N 422 THR CA C sing N N 423 THR CA CB sing N N 424 THR CA HA sing N N 425 THR C O doub N N 426 THR C OXT sing N N 427 THR CB OG1 sing N N 428 THR CB CG2 sing N N 429 THR CB HB sing N N 430 THR OG1 HG1 sing N N 431 THR CG2 HG21 sing N N 432 THR CG2 HG22 sing N N 433 THR CG2 HG23 sing N N 434 THR OXT HXT sing N N 435 TRP N CA sing N N 436 TRP N H sing N N 437 TRP N H2 sing N N 438 TRP CA C sing N N 439 TRP CA CB sing N N 440 TRP CA HA sing N N 441 TRP C O doub N N 442 TRP C OXT sing N N 443 TRP CB CG sing N N 444 TRP CB HB2 sing N N 445 TRP CB HB3 sing N N 446 TRP CG CD1 doub Y N 447 TRP CG CD2 sing Y N 448 TRP CD1 NE1 sing Y N 449 TRP CD1 HD1 sing N N 450 TRP CD2 CE2 doub Y N 451 TRP CD2 CE3 sing Y N 452 TRP NE1 CE2 sing Y N 453 TRP NE1 HE1 sing N N 454 TRP CE2 CZ2 sing Y N 455 TRP CE3 CZ3 doub Y N 456 TRP CE3 HE3 sing N N 457 TRP CZ2 CH2 doub Y N 458 TRP CZ2 HZ2 sing N N 459 TRP CZ3 CH2 sing Y N 460 TRP CZ3 HZ3 sing N N 461 TRP CH2 HH2 sing N N 462 TRP OXT HXT sing N N 463 TYR N CA sing N N 464 TYR N H sing N N 465 TYR N H2 sing N N 466 TYR CA C sing N N 467 TYR CA CB sing N N 468 TYR CA HA sing N N 469 TYR C O doub N N 470 TYR C OXT sing N N 471 TYR CB CG sing N N 472 TYR CB HB2 sing N N 473 TYR CB HB3 sing N N 474 TYR CG CD1 doub Y N 475 TYR CG CD2 sing Y N 476 TYR CD1 CE1 sing Y N 477 TYR CD1 HD1 sing N N 478 TYR CD2 CE2 doub Y N 479 TYR CD2 HD2 sing N N 480 TYR CE1 CZ doub Y N 481 TYR CE1 HE1 sing N N 482 TYR CE2 CZ sing Y N 483 TYR CE2 HE2 sing N N 484 TYR CZ OH sing N N 485 TYR OH HH sing N N 486 TYR OXT HXT sing N N 487 VAL N CA sing N N 488 VAL N H sing N N 489 VAL N H2 sing N N 490 VAL CA C sing N N 491 VAL CA CB sing N N 492 VAL CA HA sing N N 493 VAL C O doub N N 494 VAL C OXT sing N N 495 VAL CB CG1 sing N N 496 VAL CB CG2 sing N N 497 VAL CB HB sing N N 498 VAL CG1 HG11 sing N N 499 VAL CG1 HG12 sing N N 500 VAL CG1 HG13 sing N N 501 VAL CG2 HG21 sing N N 502 VAL CG2 HG22 sing N N 503 VAL CG2 HG23 sing N N 504 VAL OXT HXT sing N N 505 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3LPT _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6LMQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013911 _atom_sites.fract_transf_matrix[1][2] 0.008032 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016063 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015263 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol AS C N O S # loop_